Orthologs Set ID: EOG4006CB


Orthology Database
OrthoDB4
Gene Symbol(s)
ZGC:172136

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Danio rerio 6867 99, 190, 270, 389, 585, 741, 807, 876, 1051, 1336, 1459, 1551
Fugu rubripes 9527 99, 190, 270, 389, 585, 741, 807, 876, 1051, 1336, 1356, 1442, 1551
Gasterosteus aculeatus 12503 99, 190, 291, 383, 585, 741, 807, 876, 1051, 1354, 1459, 1551
Oryzias latipes 6431 99, 190, 270, 368, 585, 741, 807, 876
Tetraodon nigroviridis 7571 99, 190, 270, 371, 585, 653, 741, 807, 876, 1051, 1336, 1483, 1551

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Danio rerio 6867 ENSDART00000111458, NM_001111187 566376 ENSDARG00000078741 zgc:172136 danRer6
Fugu rubripes 9527 ENSTRUT00000041824 101075444 ENSTRUG00000016301 fr2
Gasterosteus aculeatus 12503 ENSGACT00000007800 ENSGACG00000005885 gasAcu1
Oryzias latipes 6431 ENSORLT00000013176 ENSORLG00000010510 oryLat2
Tetraodon nigroviridis 7571 ENSTNIT00000019917 ENSTNIG00000016585 tetNig2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Danio rerio 11536 ENSDARP00000098019 566376 ENSDARG00000078741 zgc:172136 danRer6
Fugu rubripes 41680 ENSTRUP00000041680 101075444 ENSTRUG00000016301 fr2
Gasterosteus aculeatus 7484 ENSGACP00000007781 ENSGACG00000005885 gasAcu1
Oryzias latipes 12364 ENSORLP00000013175 ENSORLG00000010510 oryLat2
Tetraodon nigroviridis 4528 ENSTNIP00000019687 ENSTNIG00000016585 tetNig2

multiple sequence alignment in CLUSTALW format


Danio_rerio|6867             ---------------------ATGTCTGTCCCCACCAAACAAGAGAGGACCGTATGTGTC
Gasterosteus_aculeatus|12503 AGAGAAAGCACCTCGGCCATCATGTCCAACTCGATGAAGCAGGAGAGAACCATTTGTGTT
Oryzias_latipes|6431         ---------------------ATGTCTACCTTGACAAAGCACAAGAGAACAGTTTGTGTT
Tetraodon_nigroviridis|7571  TCTCCACCATCAACAGGCACAATGTCCACTTCAGTAAAGCAAGAAAGAACAATCTGTGTT
Fugu_rubripes|9527           CTCCACTGCACACCGGGCGTAATGTCCACTTCGGTAAAGCAAGAGAGAACAATCTGCGTT
                                                  ***** .     .  **.** .*.**.**..* ** ** 

Danio_rerio|6867             CTCCTTCCCAACAAGGAGACACTGGACATCACAGTGGGGGTGAAAGCAACTGGTCAAGAT
Gasterosteus_aculeatus|12503 CTCCTCCCCAACAAAGACCAGCTGGACATCACCTTCGGGCCTAAGACGTCGGGACAGGAT
Oryzias_latipes|6431         CTCCTTCCCAACAAAGAGCAACTGGACATCACTGTGGGGATTAACGCCACAGGACAGGAT
Tetraodon_nigroviridis|7571  CTTCTCCCCAACAAAGACCAGCTGGACGTCACCGTCGGGCCAAAGTCCACAGGTCAGGAT
Fugu_rubripes|9527           CTCCTCCCCAACAAAGACCAGCTGGACGTCACTGTCGGGccAAAGTCCACGGGTCAAGAC
                             ** ** ********.** ...******.****  * ***   **  * :* **:**.** 

Danio_rerio|6867             GTGTTTCACCGTGTCTGCGAGCTTCTCGGTGTCAGAGAGCTGCACTACTTTGGATTAACT
Gasterosteus_aculeatus|12503 GTTTTAAATCGAGTGGCGGAGCGTCTTGGAATCAAACAGCTGCACTTTTTTGGCCTCACG
Oryzias_latipes|6431         GTTTTTAGTCGTGTAACGGAACATCTTGGAATCAACGACCTACACTTTTTTGGCCTCACG
Tetraodon_nigroviridis|7571  GTTTTCAATCGGGTGGAAGAGCTTCTTGGAATCAAGGAGCTGCACTTCTTCGGCCTAACG
Fugu_rubripes|9527           GTTTTCAGTCGGGTGGAGGAGCTTCTCGGAATCAAAGAGCTGCACTTCTTCGGCCTCACG
                             ** ** .. ** **    **.* *** **:.***.  * **.****: ** **. *.** 

Danio_rerio|6867             TTAGTCAAAAACAATGAGCACATCTTTCTGGACTTGGAAGAGAAACTTGCCAAGTATTTC
Gasterosteus_aculeatus|12503 GTGGTGAGGGACAATGAGCACATCTTTTTAGACTTGGAGGAGAAAATCACTAAGTACTTT
Oryzias_latipes|6431         GTGGTGAAAGACAACGAGCACATCTTTTTAGACCTGGAAGAGAAACTGGTGGAGTATTTT
Tetraodon_nigroviridis|7571  GTGGTGAAAGACAATGAGCATACGTTTTTAGACATGGAGGAGAAGCTGTCCAAGTACTTT
Fugu_rubripes|9527           GTGGTGAAAGATAATGAGCATACATTTTTGGACATGGAAGAGAAACTGTCCAAGTACTTT
                              *.** *...* ** ***** *  *** *.*** ****.*****..*    .**** ** 

Danio_rerio|6867             CCCAAGGAGTGGAAGCAGGACTCTGGGAAGGGGTCACAC---------------------
Gasterosteus_aculeatus|12503 CCTAAGGAATGGATGCAGGATTTTGGAAAGGTAAGGCACCTTGTTGCAAAGGGACTACTG
Oryzias_latipes|6431         TCTAAGGAATGGAAGCAAGAGCCTGGAAAGGTATCCCAG---------------------
Tetraodon_nigroviridis|7571  CCTAGGGATTGGAAGCAGGATTTGGGCAAGAGTCTACAC---------------------
Fugu_rubripes|9527           CCTAAGGATTGGAAGCAGGATTTGGGGAAGAGCTTACAG---------------------
                              * *.*** ****:***.**    ** ***.     **                      

Danio_rerio|6867             AGGAGGTCCATCCCTCCCCTGCTCTGTCTGAAGGTCCAGTATTATGTGGAGAACGGCAGA
Gasterosteus_aculeatus|12503 AAGAGACCGCTGCCACTGGTGCTCTGCCTCAAAGTGCAGTACTACATAGAAAACGGAAGA
Oryzias_latipes|6431         AAGAGACTCTTCACTCTTGTACTCTTCCTCAAAATACAGTTCTATGTAGAGAATGGAATA
Tetraodon_nigroviridis|7571  AAGAGGCCTTTGCCTCTAGTTCTCTGTCTCAAAGTGCAGTTCTACGTTGAAAATGGCCGA
Fugu_rubripes|9527           AAGAGACCTTTGCCTCTAATTCTCTGTCTCAAAGTGCAGTTCTACATTGAAAACGGTAGA
                             *.***.    * .*:*   * ****  ** **..* ****: ** .* **.** ** . *

Danio_rerio|6867             CTCATC---------------------TGTGAGCGTAAAGCGAGAAAGCTGTACTACTAT
Gasterosteus_aculeatus|12503 CTCTTT---------------TGTACCAGTGAACGTAAGGCACGGCACCTCTACTACTCC
Oryzias_latipes|6431         CTCATTAGGCCTCTCATGTGTGGCACCAGTGAAAAGAAGGCACAGCGTCTTTACTTCTCA
Tetraodon_nigroviridis|7571  CTCTTT---AGCTTCTGCGGCGGTACCAGCGAGCGAAAGGCACGGAACCTCTACTACTCT
Fugu_rubripes|9527           CTCTTT---------------------AGTGAACGAAAGGCACGGCACCTCTACTACTCT
                             ***:*                      :* **... **.**...... ** ****:**. 

Danio_rerio|6867             GACCTTCGTGAGCGAGTCCTGCGCTCTGAATGCCGACAGCAGGAGGAAGTGTATTTCCAG
Gasterosteus_aculeatus|12503 GACTTGCGGGAGCGGGTGCTCCGCTCTGAATGCCGGCAGCAGGAGGAGGTGTACTTCCAG
Oryzias_latipes|6431         GCTCTGCGGGAGCGAGTCCTGCGCTCCGAATGTCGTCAGCAGGAGGAGGTGTACTTCCAG
Tetraodon_nigroviridis|7571  GACCTGAGGGAGCGGGTGCTTCGTTCCGAGTGTCGACAGCAGGAGGAGGTGTATTTCCAG
Fugu_rubripes|9527           GACCTAAGAGAGCGAGTACTTCGCTCCGAGTGtcgacagcaggaggaggtgtacTTCCAG
                             *.  * .* *****.** ** ** ** **.** ** ***********.***** ******

Danio_rerio|6867             CTGGCAGGATTCGCTCTACAGGCCGATCACTCTGACCACTCATCAGAAGGACAGAGTCAC
Gasterosteus_aculeatus|12503 CTGGCAGGTTACGCCCTGCAGGCCAGTCTCGGTGACCACCATCTGCCCAGGGAGGGGATG
Oryzias_latipes|6431         CTGGCGGGTTACGCTCTGCAGGCCGACTTCGGTGATTACCTACTGTCGAGGGAGGGGGCA
Tetraodon_nigroviridis|7571  CTGGCAGGTTACGCCATGCAGGCCGACCTTGGCGATCACCCAGCG---GGCGTTGATACA
Fugu_rubripes|9527           CTGGCGGGTTACGCCATGCAGGCCGACCTCGGCGATCACCCAGTG---GACAACAATACA
                             *****.**:*:*** .*.******..  :    **  **  :  .   ..  : ..    

Danio_rerio|6867             GGACATGCCATGTATTTCCAACCCAAAGAATATTTTCCTCCATGGATAATAGCAAAGCGT
Gasterosteus_aculeatus|12503 GAGGTCACGCCTTACTTCGAACCCAAGGAGTACTTCCCCCCTTGGATTTTATCTAAGCGT
Oryzias_latipes|6431         GAGGTCAAATCCTATTTTGCACCCAAGCACTACTTTCCCCCCTGGaTTGTTGCTAAACGC
Tetraodon_nigroviridis|7571  GAGCTTAAAACTTATTTTGAACCCAAACAATACTTTCCTCCATGGATTATAGCTAAAAGA
Fugu_rubripes|9527           GAGCTTAAGCCTTATTTTGAACCCAAACAGTACTTTCCTCCCTGGATTATAGCTAAAAGG
                             *.. : ..    ** **  .******. * ** ** ** ** *****: *: *:**..* 

Danio_rerio|6867             GGCATCGACTACCTGCTGTGTCACGGGCCCAAGGTCCATAAGGAGCTGTGGGGAATGTCC
Gasterosteus_aculeatus|12503 GGACCGGACTACCTCCTCTGCCATGGGCCCAAGGTGCATCAGGAGCTGTGGGGCATGTCT
Oryzias_latipes|6431         GGGGAGAACTACCTGCTGTGCCACGGGCCTAAAGTACACCAGGAGCTGTGGGGAATGTCC
Tetraodon_nigroviridis|7571  GGCATAAACTATCTGCTGTGCCATGGGCCTAAAGTTCACCAGGAGTCTTTGGGT---CAA
Fugu_rubripes|9527           GGCATAAACTATCTCCTCTGCCATGGGCCCAAAGTTCATCAGGAACAGTGGGGCATGTCT
                             **    .**** ** ** ** ** ***** **.** ** .****.   * ***     . 

Danio_rerio|6867             TGTCGAGACGCTGTCCTGCTGTTCATCAGAGAGTCCTGCCGTCTGGAGGACGTCCCAGTC
Gasterosteus_aculeatus|12503 ACTCGGGAAGCCATGCTGCTCTTCATCAAGGAGGCCTGTCGACTGGAGGACGTGCCCGTC
Oryzias_latipes|6431         ACTCGTGATGCAATCCTCTGCTTCATCAGAGACTCGTGTCAGCTGGAGGACGTTCCCGTT
Tetraodon_nigroviridis|7571  TGTTTTTGCAGCGTCAGTGTGGTCATATCTGTTATTGTGACTCATGAAGATATTTATATC
Fugu_rubripes|9527           ACACGTGATGCCACCCTGCTCTTCATCAGGGAGGCTTGTCGACTCGAGGATGTACCTGTC
                             : :    . .  .  .      ****.:  *:       .  *: **.** .*  . .* 

Danio_rerio|6867             ACCTTCTATCGTCTGCAGAAGGACAAGAAAGAAGAGAAGGGTTCAGCATTGCTTGGACTC
Gasterosteus_aculeatus|12503 ACGTTTTACAGACTGCAGAAGGACAAAAAGGCAGAGAAAGGAACGGCGTTACTCGGCCTG
Oryzias_latipes|6431         ACATTTTATAGATTGCAAAAGGACAAGAAGGAGGACAGGAGAACGACGTTGCTCGGCCTC
Tetraodon_nigroviridis|7571  ATATACTATCATACCTTATCTGACAAAAAGGAAGAGAGGGGAACAGCGTTGCTGGGCCTG
Fugu_rubripes|9527           ATTTTCTACCGACTGCACAAGGacaaaaaggaagagagaggaacagCTTTGCTGGGGCTG
                             *  *: ** ..:    : :. *****.**.*..** *...*::*..* **.** ** ** 

Danio_rerio|6867             ACTCTCAGAGGAATGCAAGTGTTTCAGGAGGTGAACAACGTGCGTGATCTGCTCTATGAT
Gasterosteus_aculeatus|12503 ACCCTACGAGGAATGCAAGTTTATCAGGAGGTAAACAACATGCGACAGATGCTGTACAAC
Oryzias_latipes|6431         ACCCTGTGGGGAATGCAGGTTTATCAGGAGGTGAACAACACTCGACAGCTGCTTTACGAC
Tetraodon_nigroviridis|7571  ACCCTGCGAGGAATGCAGGTTTATCAGGAGGCAAACAGCATACGGCAGCTGCTGTATGGC
Fugu_rubripes|9527           ACCCTGCGAGGAATGCAGGTTTATCAGGAGGTCAACAACATACGGCAGCTGCTGTATGAC
                             ** **  *.********.** *:********  ****.*.  **  * .**** ** .. 

Danio_rerio|6867             TTCCCCTGGTTTCATGTGGGACGACTCACTTTCTTGGGAAAAAAGTTTGAGATCCAGCCG
Gasterosteus_aculeatus|12503 TTCCCCTGGTCAAACGTGGGGCGTCTCACCTTCCTGGGCAAGAAATTCGAGATCCAGCCA
Oryzias_latipes|6431         TTCCCCTGGTCAAGTGTCGGTCGTCTAACCTTCCTGGGCAAGAAATTTGAGATCCAGCCA
Tetraodon_nigroviridis|7571  TTTCCTTGGGCACATGTGGAAGGTCTCACTTTCCTGGGTAAGAAATTTGAGATCCAACCA
Fugu_rubripes|9527           TTTCCTTGGGCACACGTGGGGCGTCTCACTTTCCTGGGAAAGAAATTTGAGATCCAGCCA
                             ** ** ***  :.. ** *.  *:**.** *** **** **.**.** ********.**.

Danio_rerio|6867             GACGGTTTGCCCTCAGCGAGGAAGCTGGTTTACTATACGGGTTCGGCATTTCGCTCTCGT
Gasterosteus_aculeatus|12503 GATGGTTTGCCATCAGCCAGGAAGCTGGTTTACTACACCGGGTCATCGTTTCGCTCTCGC
Oryzias_latipes|6431         GATGGTTTGCCATCAGCCCGAAAGCTGGTTTACTACACCGGCTCGTCGTTCCGCTCTCGG
Tetraodon_nigroviridis|7571  GATGGCTTGCCGTCAGCCAGGAAGCTGGTTTACTACACCGGGTCATCGTTCCGCTCTCGT
Fugu_rubripes|9527           GATGGCTTGCCGTCAGCCAGGAAGCTGGTTTACTACACGGGGTCATCGTTCCGCTCTcgt
                             ** ** ***** ***** .*.************** ** ** **. *.** ******** 

Danio_rerio|6867             CATCTGCTTCTGCATCTGAGCTCATGTCATCGCTTATATCTGAGTTTACAGCCTGCCCTC
Gasterosteus_aculeatus|12503 CACCTCCTCCTGCACCTGAGCAGCAGCCATCGCCTCTACCTCAGCCTCCAGCCTGCCCTC
Oryzias_latipes|6431         CATCTCCTCTTGCACCTGAGCGGCAGCCATCAGCTGTACCTCAAGCTCCAACCTGCACTC
Tetraodon_nigroviridis|7571  CACCTCCTCCTGCACCTGAGCAGCAGTCACCGCATCTACCGAAGCCTCCAGCCTGCCCTC
Fugu_rubripes|9527           cacctcctcctgcacctgagcagcagccacCGCATCTACCGAAGCCTCCAGCCTGCCCTC
                             ** ** **  **** ******  .:* ** *.  * ** *  *.  *.**.*****.***

Danio_rerio|6867             AAACACCTGCGGCAGCTGGAAGAGACTGAGGAGAAGAAGCGGTATCGTGAATCTTACATC
Gasterosteus_aculeatus|12503 AAACACATACGCAAGCTGGAGGAGGGAGAAGATAAAAAGCGTTACAGAGAGTCATACATT
Oryzias_latipes|6431         AAACACCTACGC------------------------------------------------
Tetraodon_nigroviridis|7571  AAACACCTGCGCCAGCTGGAGGACAGCGAAGAGAAAAAGCGTTACAGAGAGTCATACATC
Fugu_rubripes|9527           AAACACCTGcgccagctggaggagagcgaaGAGAAAAAGCGTTACAGAGAGTCGTACATC
                             ******.*.**                                                 

Danio_rerio|6867             AGTGATGAGCTGGACCTGGACCAGCCATGCAGTGAAGGCAGTCCTCGTCTGTCCAGACAC
Gasterosteus_aculeatus|12503 AGTGATGACCTGGACATGGACCCCCCCGGCAGCGAGAGCAGCCCGGGTCTGTCCCGACGC
Oryzias_latipes|6431         ------------------------------------------------------------
Tetraodon_nigroviridis|7571  AGTGATGACTTGGACTTGGACCCCCATGGGAGCGAGAGCAGCCCCGGTCTGTCCCGACAC
Fugu_rubripes|9527           AGTGATGACCTGGACTTGGACCCTCATGGTAGCGAGAGCAGCCCCGGTCTGTCCCGAcac
                                                                                         

Danio_rerio|6867             TCCACCAGCAGCTCCGGCATCGAGGCGGACACCAGACAGAACAGCGTCTCGGTAGAGATG
Gasterosteus_aculeatus|12503 TCGACCAGCAGCTCCGGGATTGAAGCCGATGCCCGTCAACACAGCCTCTCCGCCGAGATG
Oryzias_latipes|6431         ------------------------------------------------------------
Tetraodon_nigroviridis|7571  TCCACCAGCAGCTCTGGAATCGAAGCCGATGGCCGTCAACACAGCGTCTCCACAGAGATC
Fugu_rubripes|9527           tccaccagcagctccggaATCGAAGCTGATGCCCGACAACACAGCATTTCCACAGAGATC
                                                                                         

Danio_rerio|6867             GTCTCAGTGGAGGAGAAAGAGAAA------------------------------------
Gasterosteus_aculeatus|12503 GGCTCCATGGAGGAGGAAGGTCAACGGCAAGCGGAGAATTGTTTGGGCTCCGCGGCCAGC
Oryzias_latipes|6431         ------------------------------------------------------------
Tetraodon_nigroviridis|7571  GCCTCCATGGAGGAGGAAAGTCATCAGCCAGTGGAGAAGAGTATCAGCTCAGCAGCAAGC
Fugu_rubripes|9527           GCctccatggaggaggacagTCACCAGCCGGTAGAAAAGAGGTTGAGCTCAGCAGCGAGC
                                                                                         

Danio_rerio|6867             ------------------TCCAGCATCAACACCAGCAGCACAGCTCAGAGCCATGAAGAG
Gasterosteus_aculeatus|12503 CGTGGCAGCGCCCGCACCTCTGGGTTCCACACGGGCCGCAGGGCTCGAATAGAAGACGAG
Oryzias_latipes|6431         ------------------------------------------------------------
Tetraodon_nigroviridis|7571  TGCGCCAGCTCCTGTACCTCAGGGTTTGAAGCAGGCAGCAAAACTCAG------GACGAT
Fugu_rubripes|9527           TGCGCCAGCTCCTCTACCTCAGGGTTTGAGGCAGGGAGCAAAGCTCAAGCACAGGATGAT
                                                                                         

Danio_rerio|6867             CACTGGCAGGAGACAGATTCGCAGGAGCCGGGAGAG---GTTTCTGTGGACGATCCTGTG
Gasterosteus_aculeatus|12503 GGGTGGCAAGAGGAA------------------GAGGGGGTCCTCGTGGATTCTCCTGAT
Oryzias_latipes|6431         ------------------------------------------------------------
Tetraodon_nigroviridis|7571  GGATGGAGAGACAAAGTCAATACCGGTGTTGGAAGCACAAAGGAAGCCACTCATTTTGAT
Fugu_rubripes|9527           GGCTGGAAGGAGGAAGttttctttgatATTCTAGAGGAGTGTCCGTGGACTGCACAGACC
                                                                                         

Danio_rerio|6867             GATCTCTTGCGATTGGCTGAGCTACTGGAGGGAGTGTCCGTCGACTGTCCCACCATCCAA
Gasterosteus_aculeatus|12503 GAGATGTTCCAGTTGGCTGATCTTCTGGAAGGAGTGTCAGTGGATTGTTCAGAACTCTCC
Oryzias_latipes|6431         ------------------------------------------------------------
Tetraodon_nigroviridis|7571  CAGATGTTCAAACTTGCCGATCTTCTTGAAGGAGTTTCGGTGGACTGTACGGAACTC---
Fugu_rubripes|9527           TGTCCAGGACTCAGTTGCCAAGTAATTGAATTTTGCAGGATATtatacaaacatttaaaa
                                                                                         

Danio_rerio|6867             TCAGTCAAGGACTCTAAAGATCAGCATATGAGCTCAGTCACAGGTAAA------------
Gasterosteus_aculeatus|12503 TCGGAGACTCTCGCGTCGGAGAAAATCTTTGTCTCTGCAGAAAACAAAGCATGTCTCCCA
Oryzias_latipes|6431         ------------------------------------------------------------
Tetraodon_nigroviridis|7571  TCGACTTCTTTGTCAAGTAATTACATTTTGTATAATATTACATATGGCAAATCTGACCCC
Fugu_rubripes|9527           agAACGTCGCATAAATTGTCAAACTCTTTTGGCCTCGTAGAAGATGGCAAGTCTGACCCC
                                                                                         

Danio_rerio|6867             ------------GACCAAACAGACCTAAGTGATCCAGACGGCCTGAAACAGGTTTTGAAT
Gasterosteus_aculeatus|12503 GACAGTGACGGAGACCTCAAAAAATTACGTAACAGGGATACTTTAAAACAGATGGTAAAA
Oryzias_latipes|6431         ------------------------------------------------------------
Tetraodon_nigroviridis|7571  AGTCAACCTGAAGATGATGGAAAAATACATAATACAGATGTGTTAAATCAGATGCTGAAA
Fugu_rubripes|9527           AATAATACTGAACATGATGgaaaaatatacagtaaagATTTGTTAAATCAGGTGCTGAAA
                                                                                         

Danio_rerio|6867             CAGAAGCTTTCTAACCCATCCGACTGCTATAATCTAAGCCTGGAGGACGTGCGACAGTTA
Gasterosteus_aculeatus|12503 TATAGGGCACAAGTTTGCGTGGACCGCCACAGTCAAAGCATAGATGACGTAAGTCTGTTT
Oryzias_latipes|6431         ------------------------------------------------------------
Tetraodon_nigroviridis|7571  CCCAAAAACCAGGTTTATGGGGATCGCCATAGCCACAGTCTAGATGATGTACGTCTTCTG
Fugu_rubripes|9527           CCGAAAAGTCAAGTTTGTGTGGATCGACAAAGCCACAGTCTAGATGATGTACGTCTGCTG
                                                                                         

Danio_rerio|6867             TCTCCTCTTCTTCCGCTGGGAACGCCGACAGCTCCAAACGCCTCCATCGGCTACACATTT
Gasterosteus_aculeatus|12503 CCCCCTGCGGCATCCCTGGGGACGACACTGCCGCCCGACTCCTCCCACAGCTACACCTGT
Oryzias_latipes|6431         ------------------------------------------------------------
Tetraodon_nigroviridis|7571  CCTCCTTCAGTACCATTGGGGACAAAACTGCCACCTGATTCATCTCATAGTTACACATTT
Fugu_rubripes|9527           CCTCTTCAAGCACCCTTGGGAACAACTCTGTCACCTGATTCATCCCATAGTTACACATTC
                                                                                         

Danio_rerio|6867             GCGCTCCCA---------------------------------------CATTCCCCAACC
Gasterosteus_aculeatus|12503 GGC---------------------------------------------------------
Oryzias_latipes|6431         ------------------------------------------------------------
Tetraodon_nigroviridis|7571  GGA---------------------------------------------------------
Fugu_rubripes|9527           GGTCTACAAGATGCCGCCACGACTAGGAAGTTGCCTGCTAATTACAACCATTTCCCCACT
                                                                                         

Danio_rerio|6867             AACCCATGTCCAGATGACACTTCACTCTGTGTCCAGAGACCCACGAACTGCCTTTCTCTG
Gasterosteus_aculeatus|12503 ------------------------------------------------------------
Oryzias_latipes|6431         ------------------------------------------------------------
Tetraodon_nigroviridis|7571  ------------------------------------------------------------
Fugu_rubripes|9527           TTAGACTGCCCAGCCAAAGCTTCTTTCTATGGCCACAGGTCTTCTAACTGCCTCTCCTTG
                                                                                         

Danio_rerio|6867             GCCCGCCTGGATGATAACCAGCCGCTGGAGCTTGTGCTATAA
Gasterosteus_aculeatus|12503 ------------------------------------------
Oryzias_latipes|6431         ------------------------------------------
Tetraodon_nigroviridis|7571  ------------------------------------------
Fugu_rubripes|9527           GACGTGTTGGATGACGAACAGTTCCTCGAATTTATACTTTAA
                                                                       

multiple sequence alignment in CLUSTALW format


Danio_rerio|11536           -------MSVPTKQERTVCVLLPNKETLDITVGVKATGQDVFHRVCELLGVRELHYFGLT
Gasterosteus_aculeatus|7484 RESTSAIMSNSMKQERTICVLLPNKDQLDITFGPKTSGQDVLNRVAERLGIKQLHFFGLT
Oryzias_latipes|12364       -------MSTLTKHKRTVCVLLPNKEQLDITVGINATGQDVFSRVTEHLGINDLHFFGLT
Tetraodon_nigroviridis|4528 SPPSTGTMSTSVKQERTICVLLPNKDQLDVTVGPKSTGQDVFNRVEELLGIKELHFFGLT
Fugu_rubripes|41680         LHCTPGVMSTSVKQERTICVLLPNKDQLDVTVGPKSTGQDVFSRVEELLGIKELHFFGLT
                                   **   *::**:*******: **:*.* :::****: ** * **:.:**:****

Danio_rerio|11536           LVKNNEHIFLDLEEKLAKYFPKEWKQDSGKGSH-------RRSIPPLLCLKVQYYVENGR
Gasterosteus_aculeatus|7484 VVRDNEHIFLDLEEKITKYFPKEWMQDFGKVRHLVAKGLLKRPLPLVLCLKVQYYIENGR
Oryzias_latipes|12364       VVKDNEHIFLDLEEKLVEYFSKEWKQEPGKVSQ-------KRLFTLVLFLKIQFYVENGI
Tetraodon_nigroviridis|4528 VVKDNEHTFLDMEEKLSKYFPRDWKQDLGKSLH-------KRPLPLVLCLKVQFYVENGR
Fugu_rubripes|41680         VVKDNEHTFLDMEEKLSKYFPKDWKQDLGKSLQ-------KRPLPLILCLKVQFYIENGR
                            :*::*** ***:***: :**.::* *: **  :       :* :. :* **:*:*:*** 

Danio_rerio|11536           LI-------CERKARKLYYYDLRERVLRSECRQQEEVYFQLAGFALQADHSDHSSEGQSH
Gasterosteus_aculeatus|7484 LF-----CTSERKARHLYYSDLRERVLRSECRQQEEVYFQLAGYALQASLGDHHLPREGM
Oryzias_latipes|12364       LIRPLMCGTSEKKAQRLYFSALRERVLRSECRQQEEVYFQLAGYALQADFGDYLLSREGA
Tetraodon_nigroviridis|4528 LF-SFCGGTSERKARNLYYSDLRERVLRSECRQQEEVYFQLAGYAMQADLGDHPA-GVDT
Fugu_rubripes|41680         LF-------SERKARHLYYSDLRERVLRSECRQQEEVYFQLAGYAMQADLGDHPV-DNNT
                            *:       .*:**:.**:  **********************:*:**. .*:     . 

Danio_rerio|11536           GHAMYFQPKEYFPPWIIAKRGIDYLLCHGPKVHKELWGMSCRDAVLLFIRESCRLEDVPV
Gasterosteus_aculeatus|7484 EVTPYFEPKEYFPPWILSKRGPDYLLCHGPKVHQELWGMSTREAMLLFIKEACRLEDVPV
Oryzias_latipes|12364       EVKSYFAPKHYFPPWIVAKRGENYLLCHGPKVHQELWGMSTRDAILCFIRDSCQLEDVPV
Tetraodon_nigroviridis|4528 ELKTYFEPKQYFPPWIIAKRGINYLLCHGPKVHQESLG-QCFCSVSVVISVIVTHEDIYI
Fugu_rubripes|41680         ELKPYFEPKQYFPPWIIAKRGINYLLCHGPKVHQEQWGMSTRDATLLFIREACRLEDVPV
                                ** **.******::*** :**********:*  * .   :   .*      **: :

Danio_rerio|11536           TFYRLQKDKKEEKGSALLGLTLRGMQVFQEVNNVRDLLYDFPWFHVGRLTFLGKKFEIQP
Gasterosteus_aculeatus|7484 TFYRLQKDKKAEKGTALLGLTLRGMQVYQEVNNMRQMLYNFPWSNVGRLTFLGKKFEIQP
Oryzias_latipes|12364       TFYRLQKDKKEDRRTTLLGLTLWGMQVYQEVNNTRQLLYDFPWSSVGRLTFLGKKFEIQP
Tetraodon_nigroviridis|4528 IYYHTLSDKKEERGTALLGLTLRGMQVYQEANSIRQLLYGFPWAHVEGLTFLGKKFEIQP
Fugu_rubripes|41680         IFYRLHKDKKEERGTALLGLTLRGMQVYQEVNNIRQLLYDFPWAHVGRLTFLGKKFEIQP
                             :*:  .*** :: ::****** ****:**.*. *::**.***  *  ************

Danio_rerio|11536           DGLPSARKLVYYTGSAFRSRHLLLHLSSCHRLYLSLQPALKHLRQLEETEEKKRYRESYI
Gasterosteus_aculeatus|7484 DGLPSARKLVYYTGSSFRSRHLLLHLSSSHRLYLSLQPALKHIRKLEEGEDKKRYRESYI
Oryzias_latipes|12364       DGLPSARKLVYYTGSSFRSRHLLLHLSGSHQLYLKLQPALKHLR----------------
Tetraodon_nigroviridis|4528 DGLPSARKLVYYTGSSFRSRHLLLHLSSSHRIYRSLQPALKHLRQLEDSEEKKRYRESYI
Fugu_rubripes|41680         DGLPSARKLVYYTGSSFRSRHLLLHLSSSHRIYRSLQPALKHLRQLEESEEKKRYRESYI
                            ***************:***********..*::* .*******:*                

Danio_rerio|11536           SDELDLDQPCSEGSPRLSRHSTSSSGIEADTRQNSVSVEMVSVEEKEK------------
Gasterosteus_aculeatus|7484 SDDLDMDPPGSESSPGLSRRSTSSSGIEADARQHSLSAEMGSMEEEGQRQAENCLGSAAS
Oryzias_latipes|12364       ------------------------------------------------------------
Tetraodon_nigroviridis|4528 SDDLDLDPHGSESSPGLSRHSTSSSGIEADGRQHSVSTEIASMEEESHQPVEKSISSAAS
Fugu_rubripes|41680         SDDLDLDPHGSESSPGLSRHSTSSSGIEADARQHSISTEIASMEEDSHQPVEKRLSSAAS
                                                                                        

Danio_rerio|11536           ------SSINTSSTAQSHEEHWQETDSQEPGE-VSVDDPVDLLRLAELLEGVSVDCPTIQ
Gasterosteus_aculeatus|7484 RGSARTSGFHTGRRARIEDEGWQEE------EGVLVDSPDEMFQLADLLEGVSVDCSELS
Oryzias_latipes|12364       ------------------------------------------------------------
Tetraodon_nigroviridis|4528 CASSCTSGFEAGSKTQ--DDGWRDKVNTGVGSTKEATHFDQMFKLADLLEGVSVDCTEL-
Fugu_rubripes|41680         CASSSTSGFEAGSKAQAQDDGWKEEVFFDILEECPWTAQTCPGLSCQVIEFCRILYKHLK
                                                                                        

Danio_rerio|11536           SVKDSKDQHMSSVTGK--------DQTDLSDPDGLKQVLNQKLSNPSDCYNLSLEDVRQL
Gasterosteus_aculeatus|7484 SETLASEKIFVSAENKACLPDSDGDLKKLRNRDTLKQMVKYRAQVCVDRHSQSIDDVSLF
Oryzias_latipes|12364       ------------------------------------------------------------
Tetraodon_nigroviridis|4528 STSLSSNYILYNITYGKSDPSQPEDDGKIHNTDVLNQMLKPKNQVYGDRHSHSLDDVRLL
Fugu_rubripes|41680         RTSHKLSNSFGLVEDGKSDPNNTEHDGKIYSKDLLNQVLKPKSQVCVDRQSHSLDDVRLL
                                                                                        

Danio_rerio|11536           SPLLPLGTPTAPNASIGYTFALP-------------HSPTNPCPDDTSLCVQRPTNCLSL
Gasterosteus_aculeatus|7484 PPAASLGTTLPPDSSHSYTCG---------------------------------------
Oryzias_latipes|12364       ------------------------------------------------------------
Tetraodon_nigroviridis|4528 PPSVPLGTKLPPDSSHSYTFG---------------------------------------
Fugu_rubripes|41680         PLQAPLGTTLSPDSSHSYTFGLQDAATTRKLPANYNHFPTLDCPAKASFYGHRSSNCLSL
                                                                                        

Danio_rerio|11536           ARLDDNQPLELVL
Gasterosteus_aculeatus|7484 -------------
Oryzias_latipes|12364       -------------
Tetraodon_nigroviridis|4528 -------------
Fugu_rubripes|41680         DVLDDEQFLEFIL