Orthologs Set ID: EOG4006CC


Orthology Database
OrthoDB4
Gene Symbol(s)
PRKACG

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 44714 12, 90
Callithrix jacchus 53481
Homo sapiens 93362
Pan troglodytes 36908
Pongo abelii 27659
Rhesus macaque 15485

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 44714 ENSCJAT00000003302 100392123 ENSCJAG00000001750 calJac3
Callithrix jacchus 53481 ENSCJAT00000043262 100408115 ENSCJAG00000022277 LOC100408115 calJac3
Homo sapiens 93362 ENST00000377276 5568 ENSG00000165059 PRKACG hg19,GRCh37
Pan troglodytes 36908 ENSPTRT00000038838 472944 ENSPTRG00000021003 PRKACG panTro2
Pongo abelii 27659 ENSPPYT00000022469 100431906 ENSPPYG00000019273 PRKACG ponAbe2
Rhesus macaque 15485 ENSMMUT00000028660 ENSMMUG00000020379 rheMac2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 35984 ENSCJAP00000049480 100392123 ENSCJAG00000001750 calJac3
Callithrix jacchus 44432 ENSCJAP00000040924 100408115 ENSCJAG00000022277 LOC100408115 calJac3
Homo sapiens 10423 ENSP00000366488 5568 ENSG00000165059 PRKACG hg19,GRCh37
Pan troglodytes 33104 ENSPTRP00000035898 472944 ENSPTRG00000021003 PRKACG panTro2
Pongo abelii 937 ENSPPYP00000021585 100431906 ENSPPYG00000019273 PRKACG ponAbe2
Rhesus macaque 7972 ENSMMUP00000026815 ENSMMUG00000020379 rheMac2

multiple sequence alignment in CLUSTALW format


Rhesus_macaque|15485     ---------------------------ATGGGCAACGCCGCCGCCAAGAAGGACACCGAG
Pongo_abelii|27659       ---------------------------ATGGGCAACGCCCCCGCCAAGAAGGACACCGAG
Homo_sapiens|93362       ---------------------------ATGGGCAACGCCCCCGCCAAGAAGGACACCGAG
Pan_troglodytes|36908    ---------------------------ATGGGCAACGCCCCCGCCAAGAAGGACACCGAG
Callithrix_jacchus|44714 GCGGCCCCTGCCGTCGCCACAAACACCATGGACAACGCTCCCGCCAAGAAGGACACCAAG
Callithrix_jacchus|53481 ---------------------------ATGGGCAACGTGCCCGCCAAG---GACACCGAG
                                                    ****.*****   ********   ******.**

Rhesus_macaque|15485     CAGGAG---ACCGTGAACGAGTTCCTAGCCAAAGCCAGAGGAGATTTCCTCTACAGATGG
Pongo_abelii|27659       CAGGAGAAGAGCGCGACGGAGTTCCTAGTCAAAGCCAGAGGAGATTTCCTCTACAGATGG
Homo_sapiens|93362       CAGGAGGAGAGCGTGAACGAGTTCCTAGCCAAAGCCAGAGGAGATTTCCTCTACAGATGG
Pan_troglodytes|36908    CAGGAGGAGAGCGTGAACGAGTTCCTAGCCAAAGCCAGAGGAGATTTCCTCTACAGATGG
Callithrix_jacchus|44714 CAGGAG------GTGAAAGAGTTCCTAGCCAGAGCCAAAGAAGATTTCCTCTACAGATGG
Callithrix_jacchus|53481 CAGAAG---GTCGTGAAAGAGTTCATAGCCGGAGCCAAAGAAGATTTCCTCCGTAGATGG
                         ***.**      * **. ******.*** *..*****.**.********** . ******

Rhesus_macaque|15485     GGAAACCCCGCTCAAAACACCGCCAGCTCGGATCAGTTTGAACGGCTCAAGACGCTGGGC
Pongo_abelii|27659       GGAAACCCCGCTCAAAACACCGCCAGCTCCGATCAGTTTGAACGGCTCAGGACGCTGGGC
Homo_sapiens|93362       GGAAACCCCGCTCAAAACACCGCCAGCTCGGATCAGTTCGAACGGCTCAGGACGCTGGGC
Pan_troglodytes|36908    GGAAACCCCGCTCAAAACACCGCCAGCTCGGATCAGTTCGAACGGCTCAGGACGCTGGGC
Callithrix_jacchus|44714 GAACACCCTGTTCAGAACACCGCCAGCTCGGATCAGTTTGAACTGCTCAAGACGCTGGGC
Callithrix_jacchus|53481 GAACGCCCGGTTCAGAACACCGCCCGCTTGGATCAGTTTAAACTGCTCAAGACGCTGGGC
                         *.*..*** * ***.*********.***  ******** .*** *****.**********

Rhesus_macaque|15485     ACCGGCTCCTACGGGCGGGTGATGCTGGTGAGGCACCGGGAGACCGGCAACCACTACGCC
Pongo_abelii|27659       ACCGGCTCCTTCGGGCGGGTGATGCTGGTGAGGCACCGGGAGACCGGCGGCCACTACGCC
Homo_sapiens|93362       ATGGGCTCCTTCGGGCGGGTGATGCTGGTGAGGCACCAGGAGACCGGCGGCCACTACGCC
Pan_troglodytes|36908    ATGGGCTCCTTCGGGCGGGTGATGCTGGTGAGGCACCGGGAGACCGGCGGCCACTACGCC
Callithrix_jacchus|44714 GCGGGCTCCTTCGGGCGGGTGGTGCTGGTGAGGCACCAGGAGAGCGGCGGCCACTACGCC
Callithrix_jacchus|53481 ATCGGCTCCTTCGGGCGGGTGGTCCTGGTGAGTCACCGGGAGAGCGGCAGCCACTATGCC
                         .  *******:**********.* ******** ****.***** ****..****** ***

Rhesus_macaque|15485     ATGAAGATCCTCGACAAGCAGAAGGTGGTGAGGCTGAAGCAGGTCGAGCACACACTGAAC
Pongo_abelii|27659       ATGAAGATCCTTCACAAGCAGAAGCTGGTGAAGCTGAAGCAGGTCGAGCACACACTGAAC
Homo_sapiens|93362       ATGAAGATCCTCAACAAGCAGAAGGTGGTGAAGATGAAGCAGGTCGAGCACATACTGAAC
Pan_troglodytes|36908    ATGAAGATCCTCAACAAGCAGAAGGTGGTGAAGATGAAGCAGGTCGAGCATATACTGAAC
Callithrix_jacchus|44714 ATGAAGATCCTCAACAAGCAGAAGGTGGTGAAACTGAAGCAGGTCGAGCAAGTCCTGAGC
Callithrix_jacchus|53481 ATGAAGATCCTCAACAAGGAGAAGGTGGTGAGACTGAAACAGGTCCAGCACGTCCTGAAC
                         ***********  ***** ***** ******...****.****** **** . .****.*

Rhesus_macaque|15485     GAGAAGCGCATCCTGCAGGCGATCAACTTTCCGTTCCTTGTCAAGCTCCAGTTCTCCTTT
Pongo_abelii|27659       GAGAAGCGCATCCTGCAGGCGATCGACTTTCCGTTCCTCGTCAAGCTCCAGTTCTCCTTT
Homo_sapiens|93362       GAGAAGCGCATCCTGCAGGCGATCGACTTTCCGTTCCTCGTCAAGCTCCAGTTCTCCTTT
Pan_troglodytes|36908    GAGAAGCGCATCCTGCAGGCGATCGACTTTCCGTTCCTCGTCAAACTCCAGTTCTCCTTT
Callithrix_jacchus|44714 GAGAAGCGCATCCTGCAGGCGATCAACTTTCCGTTCCTTGTCAAGCTCCAGTTCTCCTTC
Callithrix_jacchus|53481 GAGAAGCGCATCCTGCAGGCGATCGACTTTCCGTTCCTCGTCAAGCTCCATTTCTCCTTC
                         ************************.************* *****.***** ******** 

Rhesus_macaque|15485     AAGGACAACTCCAACCTGTACCTGGTGATGGAGTATGTGCCGGGTGGGGAGATGTTCTCT
Pongo_abelii|27659       AAGGACAACTCCTACCTGTACCTGGTGATGGAGTACGTGCCGGGTGGGGAGATGTTCTCC
Homo_sapiens|93362       AAGGACAACTCCTACCTGTACCTGGTGATGGAGTACGTGCCGGGTGGGGAGATGTTCTCC
Pan_troglodytes|36908    AAGGACAACTCCTACCTGTACCTGGTGATGGAGTACGTGCCCGGTGGGGAGATGTTCTCC
Callithrix_jacchus|44714 AGGGACAACTCCAACCTGTACCTGGTGATGGAGTACGTGCCGGGTGGGGACATGTTCTCC
Callithrix_jacchus|53481 AGGGACAACTCCAACCTGTACCTGGTGATGGAGTACGTGCCGGGTGGGGACGTGTTCTCC
                         *.**********:********************** ***** ******** .******* 

Rhesus_macaque|15485     CACCTACGGCGCGTCGGAAGGTTCAGCGAGCCCCAGGCCTGTTTCTATGCCGCCCAGGTC
Pongo_abelii|27659       CACCTACGGCGCGTCGGAAGTTTCAGCGAGCCCCATGCCTGTTTCTATGCCGCCCAGGTC
Homo_sapiens|93362       CGCCTACAGCGCGTCGGAAGGTTTAGCGAGCCCCATGCCTGTTTCTATGCCGCCCAGGTC
Pan_troglodytes|36908    CGCCTACAGCGCGTCGGAAGGTTTAGCGAGCCCCATGCCTGTTTCTATGCCGCCCAGGTC
Callithrix_jacchus|44714 CGCCTACGGCGCGTTGGAAAGTTCAGAGAGCCCCATGCCTGTTTCTGTGCCGCCCAGATC
Callithrix_jacchus|53481 CACCTACAGCGCGTCGGAAGGTTCACAGAGCCCCATGCCGGTTTCTATGCCGCCCAGATC
                         *.*****.****** ****. ** * .******** *** ******.**********.**

Rhesus_macaque|15485     GTCCTGGCCTTCCAGTACCTACACTCGCTCGACCTCATCCACCGCGACCTGAAGCCCGAG
Pongo_abelii|27659       GTCCTGGCCTTCCAGTACCTACACTCGCTTGACCTCATCCACCGCGACCTGAAGCCCGAG
Homo_sapiens|93362       GTCCTGGCCGTCCAGTACCTACACTCGCTCGACCTCATCCACCGCGACCTGAAGCCCGAG
Pan_troglodytes|36908    GTCCTGGCCTTCCAGTACCTACACTCGCTCGACCTCATCCACCGCGACCTGAAGCCAGAG
Callithrix_jacchus|44714 GTCCTGGCCTTCCAGTACCTGCACTCGCGCGACCTCATCCACCGCGACCTGAAGCCCGAG
Callithrix_jacchus|53481 GTCCTGGCCTTCCAGTACTTGCACTCGCTCGACCTCATCCACCGCGACCTGAAGCCCGAG
                         ********* ******** *.*******  **************************.***

Rhesus_macaque|15485     AATCTCCTCATCGACCAGCAGGGCTACCTGCAGGTGACGGACTTCGGTTTCGCCAAGCGC
Pongo_abelii|27659       AATCTCCTCATCGACCAGCAGGGCTACCTGCGGGTGACGGACTTCGGTTTCGCCAAGCGC
Homo_sapiens|93362       AATCTCCTCATCGACCAGCAGGGCTACCTGCAGGTGACGGACTTCGGTTTCGCCAAGCGC
Pan_troglodytes|36908    AATCTCCTCATCGACCAGCAGGGCTACCTGCAGGTGACGGACTTCGGTTTCGCCAAGCGC
Callithrix_jacchus|44714 AACATCGTCATCGACCAGCAGGGCTACCTGCGGGTGACGGACTTCGGTTTCGCCAAGCGC
Callithrix_jacchus|53481 AACATCGTCATCGACCAGCAGGGCTACCTGCGGGTGACCGACTTCGGTTTCGCCAAGCGC
                         ** .** ************************.****** *********************

Rhesus_macaque|15485     GTGAAGGGCCGCACTTGGACCCTGTGCGGGACCCCAGAGTACCTGGCCCCCGAGATCATC
Pongo_abelii|27659       GTGAAGGGCCGTACTTGGACCTTGTGCGGGACCCCACAGTACCTGGCCCCCGAGATCATC
Homo_sapiens|93362       GTGAAGGGCCGCACTTGGACCTTGTGCGGGACCCCAGAGTACCTGGCCCCCGAGATCATC
Pan_troglodytes|36908    GTGAAGGGCCGCACTTGGACCTTGTGCGGGACCCCAGAGTACCTGGCCCCCGAGATCATC
Callithrix_jacchus|44714 GTGAGGGGCCGCACTTGGACCCTGTGCGGGACCCCCGAGTACCTTGCCCCCGAGATCATC
Callithrix_jacchus|53481 GTGAGGGGCCGCACTTGGACCCTGTGCGGGACCCCAGAGTACCTGGCCCCCGAGATCATC
                         ****.****** ********* *************. ******* ***************

Rhesus_macaque|15485     CTGAGCAAAGGCTACAACAAGGCCGTGGACTGGTGGGCCCTAGGGGTGCTCATCTATGAG
Pongo_abelii|27659       CTGAGCAAAGGCTACAACAAGGCCGTGGACTGGTGGGCCCTAGGGGTGCTCATCTATGAG
Homo_sapiens|93362       CTGAGCAAAGGCTACAACAAGGCCGTGGACTGGTGGGCCCTAGGGGTGCTCATCTATGAG
Pan_troglodytes|36908    CTGAGCAAAGGCTACAACAAGGCCGTGGACTGGTGGGCCCTAGGGGTGCTCATCTATGAG
Callithrix_jacchus|44714 CTGAACAAAGGCTACAGCAAGGCCGTGGACTGGTGGGCCCTGGGGGTGCTCACCTATGAG
Callithrix_jacchus|53481 CTGAACAAAGGCTACAGCAAGGCCGTGGACTGGTGGACCCTGGGGGTGCTCATCTATGAG
                         ****.***********.*******************.****.********** *******

Rhesus_macaque|15485     ATGACCGCGGGCTTCCCGCCCTTCTACGCCGACCAGCCCATCCAGATCTACGAGAAGATC
Pongo_abelii|27659       ATGACTGTGGGCTTCCCACCCTTCTACGCCGACGAACCCATCCAGATCTACGAGAAGATC
Homo_sapiens|93362       ATGGCCGTGGGCTTCCCACCCTTCTACGCCGACCAGCCCATCCAGATCTACGAGAAGATC
Pan_troglodytes|36908    ATGGCCGTGGGCTTCTCACCCTTCTACGCCGACCAGCCCATCCAGATCTACGAGAAGATC
Callithrix_jacchus|44714 ATGGCCATGGGCTTCCCGCCCTTCTATGCTGACCAGGCGGTCCAAATCTACCAGAAGATC
Callithrix_jacchus|53481 ATGGCCGTGGGCTTCCCGCCCTTCTACGCCGACCAGCGGAATTCCGTCTTCCAAAACATC
                         ***.* . ******* *.******** ** *** *.   .:  . .***:* *.** ***

Rhesus_macaque|15485     GTCTCTGGGAAGGTGCGGTTTCCCTCCCAACTCAGCCCTGACCTCAAGGACCTGCTGCGG
Pongo_abelii|27659       GTCTCTGGGAGGGTGCGGTTTCCCTCCAAACTCAGCTCTGACCTCAAGGATCTGCTGCGG
Homo_sapiens|93362       GTCTCTGGGAGGGTGCGGTTTCCCTCCAAACTCAGCTCTGACCTCAAGCATCTGCTGCGG
Pan_troglodytes|36908    GTCTCTGGGAGGGTGCGGTTTCCCTCCAAACTCAGCTCTGACCTCAAGGATCTGCTGCGG
Callithrix_jacchus|44714 GTCTCTGGGAAGGTGCAGTTCCCCTCCCACGTCAGCTCTGACCTCAAGGACCTGCTGCGG
Callithrix_jacchus|53481 CTCTCCGGGAAGGTGCGGTTCCCCTCCCATGTCAGCTCTGACCTCAAGAACCTGCTGCGG
                          **** ****.*****.*** ******.*  ***** *********** * *********

Rhesus_macaque|15485     AGCCTGCTGCAGGTGGACCTCACCAAGCGCTTCGGAAACCTCAAGAACGGGGTTGGCGAC
Pongo_abelii|27659       AGCCTGCTCCAGGTGGACCTCACCAAGCGCTTCGGAAACCTCAGGAACGGGGTTGGCGAC
Homo_sapiens|93362       AGCCTGCTGCAGGTGGACCTCACCAAGCGCTTCGGAAACCTCAGGAACGGGGTTGGCGAC
Pan_troglodytes|36908    AGCCTGCTGCAGGTGGACCTCACCAAGCGCTTCGGAAACCTCAGGAACGGGGTTGGCGAC
Callithrix_jacchus|44714 AACCTGCTGCAGGTGGACCTCTCCAAGCGCTTCGGGAACCTCCGGAATGGGGTCGGCGAC
Callithrix_jacchus|53481 AACCTGCTGCAGGTGGACCTCTCCAAGCGCTTCGGGAACCTCCGGAACGGGGTCGGCGAC
                         *.****** ************:*************.******..*** ***** ******

Rhesus_macaque|15485     ATCAAGAACCACAAGTGGTTTGCCACAACCAACTGGATCGCCCTCTTTGAGAAGAAGGTG
Pongo_abelii|27659       ATCAAGAACCACAAGTGGTTCGCCACAACCAGCTGGATCGCCATCTATGAGAAGAAGGTG
Homo_sapiens|93362       ATCAAGAACCACAAGTGGTTCGCCACAACCAGCTGGATCGCCATCTATGAGAAGAAGGTG
Pan_troglodytes|36908    ATCAAGAACCACAAGTGGTTCGCCACAACCAGCTGGATCGCCATCTATGAGAAGAAGGTG
Callithrix_jacchus|44714 ATCAAGAACCACAAGTGGTTCACCACAACCAATTGGATTGCCATCTATGAGAAGAAGGTG
Callithrix_jacchus|53481 ATCAAGAACCACAAGTGGTTCGCCACAACCAATTGGATCGCCATCTATGAGAAACAGGTG
                         ******************** .*********. ***** ***.***:******..*****

Rhesus_macaque|15485     GAAGCTCCCTTCATCCCGAAGTACACAGGCCCTGGGGATGCCAGTAACTTTGACAGCTAC
Pongo_abelii|27659       GAAGCCCCCTTCATCCCGAAGTACACAGGCCCTGGGGATGCCAGTAACTTTGACGACTAC
Homo_sapiens|93362       GAAGCTCCCTTCATCCCGAAGTACACAGGCCCTGGGGATGCCAGTAACTTTGACGACTAC
Pan_troglodytes|36908    GAAGCTCCCTTCATCCCGAAGTACACAGGCCCTGGGGATGCCAGTAACTTTGACGACTAC
Callithrix_jacchus|44714 AAAGCTCCCTTCATCCCGAAGTTGGCAGGCCCTGGGGATGCCAGTAACTTTGACAACTAC
Callithrix_jacchus|53481 GAAGCTCCCTTCATCCCGAAGTTCGCAGGCCCTGGGGATGCCAGTAACTTTGACAACTAC
                         .**** ****************: .*****************************..****

Rhesus_macaque|15485     GAGGAGGAAGAGATCCGGATCTCCGTCAATGAGAAGTGTGCCAGCAAGTTTGCTGAGTTT
Pongo_abelii|27659       GAGGAGGAAGAGCTCCGGATCTCCATCAATGAGAAGTGTGCCAAGGAGTTTTCTGAGTTT
Homo_sapiens|93362       GAGGAGGAAGAGCTCCGGATCTCCATCAATGAGAAGTGTGCCAAGGAGTTTTCTGAGTTT
Pan_troglodytes|36908    GAGGAGGAGGAGCTCCGGATCTCCATCAATGAGAAGTGTGCCAAGGAGTTTTCTGAGTTT
Callithrix_jacchus|44714 GAGGAGGAAGAGATCTGGATCTCCATCAACGAGAAGTGTGCCAACGAGTTTTCTGAGTTT
Callithrix_jacchus|53481 GAGGAGGAAGAGATCCGGATCTCCATCAACGAGAAGTATGCCAACGAGTTTTCTCAGTTT
                         ********.***.** ********.**** *******.*****. .***** ** *****

Rhesus_macaque|15485     TAG
Pongo_abelii|27659       ---
Homo_sapiens|93362       TAG
Pan_troglodytes|36908    TAG
Callithrix_jacchus|44714 TAG
Callithrix_jacchus|53481 TAG
                            

multiple sequence alignment in CLUSTALW format


Rhesus_macaque|7972      ---------MGNAAAKKDTEQE-TVNEFLAKARGDFLYRWGNPAQNTASSDQFERLKTLG
Pongo_abelii|937         ---------MGNAPAKKDTEQEKSATEFLVKARGDFLYRWGNPAQNTASSDQFERLRTLG
Homo_sapiens|10423       ---------MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLG
Pan_troglodytes|33104    ---------MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLG
Callithrix_jacchus|35984 AAPAVATNTMDNAPAKKDTKQE--VKEFLARAKEDFLYRWEHPVQNTASSDQFELLKTLG
Callithrix_jacchus|44432 ---------MGNVPAK-DTEQK-VVKEFIAGAKEDFLRRWERPVQNTARLDQFKLLKTLG
                                  *.*..** **:*:  ..**:. *: *** ** .*.****  ***: *:***

Rhesus_macaque|7972      TGSYGRVMLVRHRETGNHYAMKILDKQKVVRLKQVEHTLNEKRILQAINFPFLVKLQFSF
Pongo_abelii|937         TGSFGRVMLVRHRETGGHYAMKILHKQKLVKLKQVEHTLNEKRILQAIDFPFLVKLQFSF
Homo_sapiens|10423       MGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSF
Pan_troglodytes|33104    MGSFGRVMLVRHRETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSF
Callithrix_jacchus|35984 AGSFGRVVLVRHQESGGHYAMKILNKQKVVKLKQVEQVLSEKRILQAINFPFLVKLQFSF
Callithrix_jacchus|44432 IGSFGRVVLVSHRESGSHYAMKILNKEKVVRLKQVQHVLNEKRILQAIDFPFLVKLHFSF
                          **:***:** *:*:*.*******.*:*:*::***:: *.********:*******:***

Rhesus_macaque|7972      KDNSNLYLVMEYVPGGEMFSHLRRVGRFSEPQACFYAAQVVLAFQYLHSLDLIHRDLKPE
Pongo_abelii|937         KDNSYLYLVMEYVPGGEMFSHLRRVGSFSEPHACFYAAQVVLAFQYLHSLDLIHRDLKPE
Homo_sapiens|10423       KDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPE
Pan_troglodytes|33104    KDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAFQYLHSLDLIHRDLKPE
Callithrix_jacchus|35984 RDNSNLYLVMEYVPGGDMFSRLRRVGKFREPHACFCAAQIVLAFQYLHSRDLIHRDLKPE
Callithrix_jacchus|44432 RDNSNLYLVMEYVPGGDVFSHLQRVGRFTEPHAGFYAAQIVLAFQYLHSLDLIHRDLKPE
                         :*** ***********::**:*:*** * **:* * ***:***.***** **********

Rhesus_macaque|7972      NLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYE
Pongo_abelii|937         NLLIDQQGYLRVTDFGFAKRVKGRTWTLCGTPQYLAPEIILSKGYNKAVDWWALGVLIYE
Homo_sapiens|10423       NLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYE
Pan_troglodytes|33104    NLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYE
Callithrix_jacchus|35984 NIVIDQQGYLRVTDFGFAKRVRGRTWTLCGTPEYLAPEIILNKGYSKAVDWWALGVLTYE
Callithrix_jacchus|44432 NIVIDQQGYLRVTDFGFAKRVRGRTWTLCGTPEYLAPEIILNKGYSKAVDWWTLGVLIYE
                         *::*******:**********:**********:********.***.******:**** **

Rhesus_macaque|7972      MTAGFPPFYADQPIQIYEKIVSGKVRFPSQLSPDLKDLLRSLLQVDLTKRFGNLKNGVGD
Pongo_abelii|937         MTVGFPPFYADEPIQIYEKIVSGRVRFPSKLSSDLKDLLRSLLQVDLTKRFGNLRNGVGD
Homo_sapiens|10423       MAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGD
Pan_troglodytes|33104    MAVGFSPFYADQPIQIYEKIVSGRVRFPSKLSSDLKDLLRSLLQVDLTKRFGNLRNGVGD
Callithrix_jacchus|35984 MAMGFPPFYADQAVQIYQKIVSGKVQFPSHVSSDLKDLLRNLLQVDLSKRFGNLRNGVGD
Callithrix_jacchus|44432 MAVGFPPFYADQRNSVFQNILSGKVRFPSHVSSDLKNLLRNLLQVDLSKRFGNLRNGVGD
                         *: **.*****:  .::::*:**:*:***::*.***.***.******:******:*****

Rhesus_macaque|7972      IKNHKWFATTNWIALFEKKVEAPFIPKYTGPGDASNFDSYEEEEIRISVNEKCASKFAEF
Pongo_abelii|937         IKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
Homo_sapiens|10423       IKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
Pan_troglodytes|33104    IKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
Callithrix_jacchus|35984 IKNHKWFTTTNWIAIYEKKVKAPFIPKLAGPGDASNFDNYEEEEIWISINEKCANEFSEF
Callithrix_jacchus|44432 IKNHKWFATTNWIAIYEKQVEAPFIPKFAGPGDASNFDNYEEEEIRISINEKYANEFSQF
                         *******:**.***::**:*:****** :*********.*****: **:*** *.:*::*