Orthologs Set ID: EOG4006CD


Orthology Database
OrthoDB4
Gene Symbol(s)
GM16594,GR22F,GE15434

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Drosophila melanogaster 317 987
Drosophila sechellia 14323 912, 987
Drosophila simulans 2033 987
Drosophila yakuba 15502 987

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Drosophila melanogaster 317 FBtr0077902, NM_164437 117349 FBgn0041249 Gr22f dm3
Drosophila sechellia 14323 FBtr0199579 6617406 FBgn0171507 GM16594 droSec1
Drosophila simulans 2033 FBtr0222805 6730605 FBgn0194289 GD22895 droSim1
Drosophila yakuba 15502 FBtr0261952 6526452 FBgn0233010 GE15434 droYak2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Drosophila melanogaster 300 FBpp0077568 117349 FBgn0041249 Gr22f dm3
Drosophila sechellia 6479 FBpp0198071 6617406 FBgn0171507 GM16594 droSec1
Drosophila simulans 12483 FBpp0221297 6730605 FBgn0194289 GD22895 droSim1
Drosophila yakuba 5861 FBpp0260444 6526452 FBgn0233010 GE15434 droYak2

multiple sequence alignment in CLUSTALW format


Drosophila_yakuba|15502     ------ATGTACCAACCACGACGCGGTTTCAGCTGCCACTTGGCATGGCTCATACTGCAG
Drosophila_melanogaster|317 ATGAAAATGTTCCAACCTCGTCGCGGCTTCAGTTGCCATTTGGCATGGTTCATGCTGCAG
Drosophila_sechellia|14323  ------ATGTTCCAACCTCGTCGTGGTTTCAATTGCCATTTGGCATGGTTCATGCTGCAG
Drosophila_simulans|2033    ------ATGTTCCAACCTCGTCGTGGTTTCAGTTGCCATTTGGCATGGTTCATGCTGCAG
                                  ****:******:**:** ** ****. ***** ********* ****.******

Drosophila_yakuba|15502     ACGACTCTCTACGCATCCTGGCTACTGGGACTGTTTCCCTTCACTTTCGATTCCCGAAGA
Drosophila_melanogaster|317 ACGACCCTCTACGCATCCTGGCTACTGGGACTGTTCCCCTTCACTTTCGATTCCCGGAGA
Drosophila_sechellia|14323  ACGACCCTCTACGCATCCTGGCTACTGGGACTGTTCCCCTTCACTTTCGATTCCCGGAGA
Drosophila_simulans|2033    ACGACCCTCTACGCATCCTGGCTACTGGGACTGTTCCCCTTCACTTTCGATTCCCGGAGA
                            ***** ***************************** ********************.***

Drosophila_yakuba|15502     AGGCAGCTGAAACGTTCCCGATGGCTGCTACTCTACGGTTTTATTCTG---CATTCTTGC
Drosophila_melanogaster|317 AAGCAGTTGAAACGCTCCCGATGGCTTCTCCTCTACGGTTTCGTTCTG---CATTCTCTG
Drosophila_sechellia|14323  AAGCAGTTGAAACGCTCCCGATGGCTTCTACTCTACGGATTCGTTCTTAACCATTCTCTG
Drosophila_simulans|2033    AAGCAGTTGAAACGCTCCCGATGGCTTCTACTCTACGGTTTCATTCTG---AATTCTCTG
                            *.**** ******* *********** **.********:** .****    .*****   

Drosophila_yakuba|15502     GCCATGTGCCTGGCGTTGAGTAGCTACTTTGCAGTTCGGCAGCGGAAAAAAAATCACGCA
Drosophila_melanogaster|317 GCCATGTGCCTAGCCATGAGTAGCCACTTGGCATCCAAGCAGCGAAGGAAATATAATGCA
Drosophila_sechellia|14323  ACCATGTGCCTAGCCTTGAGTAGCCACCTGGCGTCTAAGCAGCGAAGGAAATATAATGCA
Drosophila_simulans|2033    GCCATGTGCCTAGCCTTGAGTAGCCACCTGGCGTCTAAGCAGCGAAGGAAATATAATGCA
                            .**********.** :******** ** * **.   ..******.*..***:**.* ***

Drosophila_yakuba|15502     TTTGAGCGCAATCCGCTGCTGGAGCTCATATACCTACGGTTTGCACATACAGTGTTTTTT
Drosophila_melanogaster|317 TTTGAGCGCAATCCGCTGTTGGAGAAAATATATATGCAATTTCAGGTTACTACATTCTTC
Drosophila_sechellia|14323  TTCGAGCGCAATCCGCTGTTGGAGAAAATATATCTGCAGTTCGAGGTTACTGCATTCTTC
Drosophila_simulans|2033    TTTGAGCGCAATCCGCTGTTGGAGAAAATATATCTGCAGTTCGAGGTTACTGCATTCTTG
                            ** *************** *****.:.***** .*.*..**  .. :***:. .** ** 

Drosophila_yakuba|15502     TCCATAGGCTTATTAATACTCATGAATGTTTGGAAAAGCAACACGATTCTGAAGATTGCC
Drosophila_melanogaster|317 ACTATAAGCGTACTACTGCTCATGAATGTTTGGAAAAGCAACACGGTTCGGAAAATTGCC
Drosophila_sechellia|14323  ACTATAAGCGTACTACTGCTCATGAATGTTTGGAAAAGCAACACGGTTCGGGAAATTGCC
Drosophila_simulans|2033    ACTATAAGCGTACTACTGCTCATGAATGTTTGGAAAAGCAACACGGTTCGGGAAATTGCC
                            :* ***.** ** **.*.***************************.*** *.*.******

Drosophila_yakuba|15502     AATGAACTGCTCACCCTAGAGTGGCAGGTAAAAAACCTTTTGACTATGAAGAACTGTCCC
Drosophila_melanogaster|317 AATGAACTACTCACCCTTGAGGGCCAGGTAAAAGACCTTCTCACTCTGAAGAACTGTCCC
Drosophila_sechellia|14323  AATGAACTACTCACCCTAGAAGGCCAGGTAAAAGACCTTCTCTCTCCGAAGAATTGTCCC
Drosophila_simulans|2033    AATGAGCTACTCACCCTAGAGGGCCAGGTAAAAGACCTTCTCACTCCGAAGAATTGTCCC
                            *****.**.********:**. * *********.***** * :**. ****** ******

Drosophila_yakuba|15502     AACTTTAACTGTTTCGTGCTTAATAAAAGTGTGACTGCAATGGGTCAGATCATAGTGTCA
Drosophila_melanogaster|317 AACTTTAACTGTTTCGTGATTAAAAAACATGTGGCTGCAATAGGTCAGTTCGTGATTTCA
Drosophila_sechellia|14323  AACTTAAACTGTTTCGTGATCAAAAAACATGTGGCTGTAATAGGTCAGCTCATGATTTCA
Drosophila_simulans|2033    AACTTTAACTGTTTCGTGATTAAAAAACATGTGGCTGTAATAGGTCAGCTCATGATTTCA
                            *****:************.* **:***..****.*** ***.****** **.*..* ***

Drosophila_yakuba|15502     ATCTTGTTCTGTCTGTGGCAAGAAAATTCGTACCCGAAGATCCTAAAGATCCTCTGCTGC
Drosophila_melanogaster|317 ATTTACTTCTGCCTATGCCAAGAAAATTCGTACCCGAAGATCCTTAAGATCCTTTGCTGC
Drosophila_sechellia|14323  ATTTACTTCTGTCTACGCCAAGAAAATTCGTACCCGAAGATCCTTAAGATCCTTTGCTGC
Drosophila_simulans|2033    ATTTACTTCTGTCTACGCCAAGAAAATTCGTACCCGAAGATCCTTAAGATCCTTTGCTGC
                            ** *: ***** **. * **************************:******** ******

Drosophila_yakuba|15502     CTGCCACTGCTCGGCTGCCAATTGATTATTATGCACTTTCATACCGAAATCATTTTGGTG
Drosophila_melanogaster|317 CTGCCATCGGTGGGCTTGCAGCTGATTATAATGCACTTTCATACCGAAATCATTTTGGTC
Drosophila_sechellia|14323  CTGCCATCGGTGGGCTCGCAACTGATTATAATGCACTTTCATACCGAAATCATTTTGGTC
Drosophila_simulans|2033    CTGCCATCGGTGGGCTCGCAACTGATTATAATGCACTTTCATACCGAAATTATTTTGGTC
                            ******  * * ****  **. *******:******************** ******** 

Drosophila_yakuba|15502     TACCGCTATGTTTGGCTGCTCAATGAAACACTGCAGGACTCATGCAAGCTGAGCTCCTCA
Drosophila_melanogaster|317 TACCGCTATGTGTGGCTGGTCAATGAAACCCTCGAAGATTCACACCATCTAAGCTCCTCA
Drosophila_sechellia|14323  TACCGCTACGTGTGGCTGGTCAATGAAACTCTCGAAGAGTCCAACCATCTGAGCTCCTCA
Drosophila_simulans|2033    TACCGCTACGTGTGGCTGGTCAATGAAACCCTTGAAGGGTCTAACCATCTGAGCTCCTCA
                            ******** ** ****** ********** **  *.*. **  .*.* **.*********

Drosophila_yakuba|15502     AGAATTCGCGCACTCACGTCCTTGTACGATCGGCTGGTGAAGCTGAGTGAAACGGTGGTA
Drosophila_melanogaster|317 AGAATTCACGCACTAGCATCCTTGTACGATCGCCTGCTGAAGCTGAGTGAATTGGTGGTA
Drosophila_sechellia|14323  AGAATTCGCGCACTCGCATCCTTGTACGATCTCCTGCTGAAGCTGAGTGAATTGGTGGTT
Drosophila_simulans|2033    AGAATTCGCGCACTCGCATCCTTGTACGATCGCCTGCTGAAGCTGAGTGAATTGGTGGTT
                            *******.******..*.*************  *** **************: ******:

Drosophila_yakuba|15502     GCGAGCAACGATACCCAGCTTATCCTTTTGCTAACTATTTATCTAATCGGTAATACTGTG
Drosophila_melanogaster|317 GCGTGCAACGATTTGCAACTGATCCTTATGCTAATTATTTATTTAATCGGAAACACTGTG
Drosophila_sechellia|14323  GCGAACAACGATTTGCAGCTGATCCTTATGCTAACTATCTATTTAATCGGAAACACTGTG
Drosophila_simulans|2033    GCGAGCAACGATTTGCAGCTGATCCTTATGCTAACTATCTATTTAATCGGAAACACTGTG
                            ***:.*******:  **.** ******:****** *** *** *******:** ******

Drosophila_yakuba|15502     CAAATCTTTTTCCTCATCGTGCTGGGAGTTAGCATGAACCAGCGGTATATTTACTTGATG
Drosophila_melanogaster|317 CAAATCTTTTTCCTCATTGTGCTCGGAGTAAGCATGAATAAGCGGTATATTTACTTAGTG
Drosophila_sechellia|14323  CAAATCTTTTTCCTCATCGTGCTCGGAGTGAGCATGAACATGCGGTATATTTACTTAGTG
Drosophila_simulans|2033    CAAATCTTTTTCCTCATCGTGCTCGGAGTGAGCATGAACATGCGGTATATTTACTTAGTG
                            ***************** ***** ***** ******** .:***************..**

Drosophila_yakuba|15502     GCTTCCCCTCAATTGCTGCTAAATTTTTGGGACTTCTGGCTGAATGTTGTGGTGTGCGAT
Drosophila_melanogaster|317 GCTTCCCCACAATTGATCATCAATTTCTGGGACTTCTGGCTGAATATCGTGGTGTGTGAT
Drosophila_sechellia|14323  GCTTCCCCTCAATTGATCCTGAATATTTGGGATTTCTGGCTGAATATCGTGGTGTGCGAT
Drosophila_simulans|2033    GCTTCCCCTCAATTGATCCTTAATATATGGGATTTCTGGCTGAATATCGTGGTGTGCGAT
                            ********:******.* .* ***:* ***** ************.* ******** ***

Drosophila_yakuba|15502     CTCACTCAAAAGTGTGGAGACCGAACATCGAAAGTCCTGAAACAATTCACTGTTCTGGAA
Drosophila_melanogaster|317 CTTGCCGGAAAGTGTGGAGACCAAACATCAAAGGTCCTGAAACTGTTCACTGATCTGGAG
Drosophila_sechellia|14323  ------AGTCATTGTGGAGATCAGACCTCAAAGGTCCTGAAACTGTTCACTGATCTGGAG
Drosophila_simulans|2033    CTCGCCGGAAAGTGTGGAGATCAGACCTCAAAGGTCCTGAAACTGTTCACTGATCTGGAG
                                   .:.* ******** *..**.**.**.**********:.*******:******.

Drosophila_yakuba|15502     CAACATAATGAGCAGTTGGAGCGAAGTTTGAATGAATTCGCATGGCTTTGCACTCAGCGC
Drosophila_melanogaster|317 CACGACGATGAAGAGTTAGAGAGAAGTTTGAATGAATTCGCATGGCTGTGCACCCACCGC
Drosophila_sechellia|14323  CACGACGATGAGGATTTGGAGAAAAGT---------------------------------
Drosophila_simulans|2033    CACGACGATGAGGAAGTGGAGAGAAGTTTGAACGAATTTGCATGGCTGTGCACCCACCGC
                            **. * .****. *  *.***..****                                 

Drosophila_yakuba|15502     AAATTTCGATTTCAGCTGTGCGGACTCTTTCCTATTAACTATAACATGGGCTTTCAAATG
Drosophila_melanogaster|317 AAGTTTCGGTTTCAGCTGTGTGGTCTCTTTTCCATTAACCACAACATGGGCTTTCAAATG
Drosophila_sechellia|14323  ---------------CTGTGTGGTCTCTTTTCCATTAACTACAACATGGGCTTTCAAATG
Drosophila_simulans|2033    AAGTTTCGGTTTCAGCTGTGTGGTCTCTTTTCCATTAACTACAACATGGGCTTTCAAATG
                                           ***** **:****** * ****** * ******************

Drosophila_yakuba|15502     ATCATCACCAGTTTTCTATACGTGGTTTACCTGGTTCAGTTCGATTTCATGAATTTGTGA
Drosophila_melanogaster|317 ATCATCACCAGTTTTCTATACCTGGTTTACCTGCTTCAGTTTGACTTCATGAACTTGTAA
Drosophila_sechellia|14323  ATCATCACCAGTTTTCTTTACCTGGTTTACCTGGTTCAATTCGACTTAATGAACTTGTAA
Drosophila_simulans|2033    ATCATCACCAGTTTTCTTTACCTGGTTTACCTGGTTCAGTTCGACTTCATGAACTTGTAA
                            *****************:*** *********** ****.** ** **.***** ****.*

multiple sequence alignment in CLUSTALW format


Drosophila_yakuba|5861      --MYQPRRGFSCHLAWLILQTTLYASWLLGLFPFTFDSRRRQLKRSRWLLLYGFIL-HSC
Drosophila_melanogaster|300 MKMFQPRRGFSCHLAWFMLQTTLYASWLLGLFPFTFDSRRKQLKRSRWLLLYGFVL-HSL
Drosophila_sechellia|6479   --MFQPRRGFNCHLAWFMLQTTLYASWLLGLFPFTFDSRRKQLKRSRWLLLYGFVLNHSL
Drosophila_simulans|12483   --MFQPRRGFSCHLAWFMLQTTLYASWLLGLFPFTFDSRRKQLKRSRWLLLYGFIL-NSL
                              *:******.*****::**********************:*************:* :* 

Drosophila_yakuba|5861      AMCLALSSYFAVRQRKKNHAFERNPLLELIYLRFAHTVFFSIGLLILMNVWKSNTILKIA
Drosophila_melanogaster|300 AMCLAMSSHLASKQRRKYNAFERNPLLEKIYMQFQVTTFFTISVLLLMNVWKSNTVRKIA
Drosophila_sechellia|6479   TMCLALSSHLASKQRRKYNAFERNPLLEKIYLQFEVTAFFTISVLLLMNVWKSNTVREIA
Drosophila_simulans|12483   AMCLALSSHLASKQRRKYNAFERNPLLEKIYLQFEVTAFLTISVLLLMNVWKSNTVREIA
                            :****:**::* :**:* :********* **::*  *.*::*.:*:*********: :**

Drosophila_yakuba|5861      NELLTLEWQVKNLLTMKNCPNFNCFVLNKSVTAMGQIIVSILFCLWQENSYPKILKILCC
Drosophila_melanogaster|300 NELLTLEGQVKDLLTLKNCPNFNCFVIKKHVAAIGQFVISIYFCLCQENSYPKILKILCC
Drosophila_sechellia|6479   NELLTLEGQVKDLLSPKNCPNLNCFVIKKHVAVIGQLMISIYFCLRQENSYPKILKILCC
Drosophila_simulans|12483   NELLTLEGQVKDLLTPKNCPNFNCFVIKKHVAVIGQLMISIYFCLRQENSYPKILKILCC
                            ******* ***:**: *****:****::* *:.:**:::** *** **************

Drosophila_yakuba|5861      LPLLGCQLIIMHFHTEIILVYRYVWLLNETLQDSCKLSSSRIRALTSLYDRLVKLSETVV
Drosophila_melanogaster|300 LPSVGLQLIIMHFHTEIILVYRYVWLVNETLEDSHHLSSSRIHALASLYDRLLKLSELVV
Drosophila_sechellia|6479   LPSVGSQLIIMHFHTEIILVYRYVWLVNETLEESNHLSSSRIRALASLYDLLLKLSELVV
Drosophila_simulans|12483   LPSVGSQLIIMHFHTEIILVYRYVWLVNETLEGSNHLSSSRIRALASLYDRLLKLSELVV
                            ** :* ********************:****: * :******:**:**** *:**** **

Drosophila_yakuba|5861      ASNDTQLILLLTIYLIGNTVQIFFLIVLGVSMNQRYIYLMASPQLLLNFWDFWLNVVVCD
Drosophila_melanogaster|300 ACNDLQLILMLIIYLIGNTVQIFFLIVLGVSMNKRYIYLVASPQLIINFWDFWLNIVVCD
Drosophila_sechellia|6479   ANNDLQLILMLTIYLIGNTVQIFFLIVLGVSMNMRYIYLVASPQLILNIWDFWLNIVVCD
Drosophila_simulans|12483   ASNDLQLILMLTIYLIGNTVQIFFLIVLGVSMNMRYIYLVASPQLILNIWDFWLNIVVCD
                            * ** ****:* ********************* *****:*****::*:******:****

Drosophila_yakuba|5861      LTQKCGDRTSKVLKQFTVLEQHNEQLERSLNEFAWLCTQRKFRFQLCGLFPINYNMGFQM
Drosophila_melanogaster|300 LAGKCGDQTSKVLKLFTDLEHDDEELERSLNEFAWLCTHRKFRFQLCGLFSINHNMGFQM
Drosophila_sechellia|6479   --SHCGDQTSKVLKLFTDLEHDDEDLEKS----------------LCGLFSINYNMGFQM
Drosophila_simulans|12483   LAGKCGDQTSKVLKLFTDLEHDDEEVERSLNEFAWLCTHRKFRFQLCGLFSINYNMGFQM
                               :***:****** ** **:.:*::*:*                *****.**:******

Drosophila_yakuba|5861      IITSFLYVVYLVQFDFMNL
Drosophila_melanogaster|300 IITSFLYLVYLLQFDFMNL
Drosophila_sechellia|6479   IITSFLYLVYLVQFDLMNL
Drosophila_simulans|12483   IITSFLYLVYLVQFDFMNL
                            *******:***:***:***