Orthologs Set ID: EOG4006CF


Orthology Database
OrthoDB4
Gene Symbol(s)
IRX5

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Bos taurus 8576 249, 658
Callithrix jacchus 8217 249, 658, 882, 918
Canis familiaris 9948 249, 658
Cavia porcellus 17746 249, 658, 1236, 1272, 1458
Danio rerio 29182 249, 655
Dipodomys ordii 7378 249, 411, 417, 423, 435, 658, 1584, 1614, 1626, 1632
Echinops telfairi 2347 159, 164, 180, 227, 234, 249, 386, 658, 771, 840, 845, 1016, 1023, 1136
Equus caballus 18306 249, 333, 537
Erinaceus europaeus 17385 249, 543, 556, 573, 591, 618, 624, 633, 646, 1226, 1278
Fugu rubripes 10566 249, 655
Gallus gallus 3990 249, 429
Gasterosteus aculeatus 2476 249, 651, 803, 1221, 1581, 1615, 1659
Gorilla gorilla 11566 249, 658
Homo sapiens 31801 249, 658
Macropus eugenii 8397 6, 104, 249, 658
Microcebus murinus 2476 9, 42, 123, 168, 207, 249, 255, 262, 267, 372, 658, 1392
Monodelphis domestica 4284 249, 658
Mus musculus 42416 249, 658
Ochotona princeps 11968 658, 977
Oryctolagus cuniculus 16251 114, 147, 249, 658
Oryzias latipes 15671 249, 670, 1624
Otolemur garnettii 4285 249, 658, 753, 840, 845, 875, 891, 937, 953, 960, 1045, 1107, 1230
Pan troglodytes 14422 249, 658
Pongo abelii 10647 249, 658
Procavia capensis 3713 658, 753, 851
Pteropus vampyrus 7450 9, 18, 48, 54, 249, 658
Rattus norvegicus 16850 249, 658
Rhesus macaque 25023 249, 661
Tarsius syrichta 7137 513, 658, 1263
Tetraodon nigroviridis 13767 249, 655
Tupaia belangeri 5563 249, 658, 847, 1312, 1350, 1401, 1410, 1449, 1454, 1485, 1499, 1567, 1581, 1591, 1601, 1620
Xenopus tropicalis 18231 249, 655

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Bos taurus 8576 ENSBTAT00000006356 532896 ENSBTAG00000004838 IRX5 bosTau4
Callithrix jacchus 8217 ENSCJAT00000025186 100408727 ENSCJAG00000012968 IRX5 calJac3
Canis familiaris 9948 ENSCAFT00000015017 487276 ENSCAFG00000009443 IRX5 canFam2
Cavia porcellus 17746 ENSCPOT00000012100 100718252 ENSCPOG00000011984 IRX5 cavPor3
Danio rerio 29182 ENSDART00000043857 573346 ENSDARG00000034043 irx5a danRer6
Dipodomys ordii 7378 ENSDORT00000005903 ENSDORG00000005903 Irx5 dipOrd1
Echinops telfairi 2347 ENSETET00000002295 ENSETEG00000002297 IRX5 TENREC
Equus caballus 18306 ENSECAT00000025199 100147216 ENSECAG00000023545 IRX5 equCab2
Erinaceus europaeus 17385 ENSEEUT00000015645 ENSEEUG00000015645 IRX5 eriEur1
Fugu rubripes 10566 ENSTRUT00000025420 101067172 ENSTRUG00000010063 irx5a fr2
Gallus gallus 3990 ENSGALT00000005677 ENSGALG00000003588 galGal3
Gasterosteus aculeatus 2476 ENSGACT00000022065 ENSGACG00000016681 irx5a gasAcu1
Gorilla gorilla 11566 ENSGGOT00000022619 101144938 ENSGGOG00000027776 IRX5 gorGor3
Homo sapiens 31801 ENST00000394636, NM_005853 10265 ENSG00000176842 IRX5 hg19,GRCh37
Macropus eugenii 8397 ENSMEUT00000008386 ENSMEUG00000008376 IRX5 Meug_1.0
Microcebus murinus 2476 ENSMICT00000002308 ENSMICG00000002308 IRX5 micMur1
Monodelphis domestica 4284 ENSMODT00000016825 100014608 ENSMODG00000013202 IRX5 monDom5
Mus musculus 42416 ENSMUST00000034184 54352 ENSMUSG00000031737 Irx5 mm9
Ochotona princeps 11968 ENSOPRT00000002989 ENSOPRG00000003007 IRX5 OchPri2.0
Oryctolagus cuniculus 16251 ENSOCUT00000003246 ENSOCUG00000003240 IRX5 oryCun2.0
Oryzias latipes 15671 ENSORLT00000017200 101173451 ENSORLG00000013711 irx5a oryLat2
Otolemur garnettii 4285 ENSOGAT00000004135 100964692 ENSOGAG00000004133 IRX5 otoGar1
Pan troglodytes 14422 ENSPTRT00000014964 454093 ENSPTRG00000008121 IRX5 panTro2
Pongo abelii 10647 ENSPPYT00000008647 100445153 ENSPPYG00000007355 IRX5 ponAbe2
Procavia capensis 3713 ENSPCAT00000003591 ENSPCAG00000003649 IRX5 proCap1
Pteropus vampyrus 7450 ENSPVAT00000005731 ENSPVAG00000005731 IRX5 pteVam1
Rattus norvegicus 16850 ENSRNOT00000015272 498918 ENSRNOG00000011180 Irx5 rn4
Rhesus macaque 25023 ENSMMUT00000024528 697968 ENSMMUG00000017440 IRX5 rheMac2
Tarsius syrichta 7137 ENSTSYT00000006378 ENSTSYG00000006383 IRX5 tarSyr1
Tetraodon nigroviridis 13767 ENSTNIT00000016826 ENSTNIG00000013613 IRX5 tetNig2
Tupaia belangeri 5563 ENSTBET00000005564 ENSTBEG00000005553 tupBel1
Xenopus tropicalis 18231 ENSXETT00000006137 100038201 ENSXETG00000002816 irx5 xenTro2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Bos taurus 13591 ENSBTAP00000006356 532896 ENSBTAG00000004838 IRX5 bosTau4
Callithrix jacchus 1166 ENSCJAP00000023807 100408727 ENSCJAG00000012968 IRX5 calJac3
Canis familiaris 14959 ENSCAFP00000013897 487276 ENSCAFG00000009443 IRX5 canFam2
Cavia porcellus 13953 ENSCPOP00000010782 100718252 ENSCPOG00000011984 IRX5 cavPor3
Danio rerio 13841 ENSDARP00000043856 573346 ENSDARG00000034043 irx5a danRer6
Dipodomys ordii 6932 ENSDORP00000005528 ENSDORG00000005903 Irx5 dipOrd1
Echinops telfairi 1861 ENSETEP00000001862 ENSETEG00000002297 IRX5 TENREC
Equus caballus 20984 ENSECAP00000020959 100147216 ENSECAG00000023545 IRX5 equCab2
Erinaceus europaeus 14285 ENSEEUP00000014282 ENSEEUG00000015645 IRX5 eriEur1
Fugu rubripes 25317 ENSTRUP00000025317 101067172 ENSTRUG00000010063 irx5a fr2
Gallus gallus 6061 ENSGALP00000005667 ENSGALG00000003588 galGal3
Gasterosteus aculeatus 21599 ENSGACP00000022023 ENSGACG00000016681 irx5a gasAcu1
Gorilla gorilla 9612 ENSGGOP00000022093 101144938 ENSGGOG00000027776 IRX5 gorGor3
Homo sapiens 55104 ENSP00000378132 10265 ENSG00000176842 IRX5 hg19,GRCh37
Macropus eugenii 7660 ENSMEUP00000007647 ENSMEUG00000008376 IRX5 Meug_1.0
Microcebus murinus 2107 ENSMICP00000002108 ENSMICG00000002308 IRX5 micMur1
Monodelphis domestica 25863 ENSMODP00000016521 100014608 ENSMODG00000013202 IRX5 monDom5
Mus musculus 45956 ENSMUSP00000034184 54352 ENSMUSG00000031737 Irx5 mm9
Ochotona princeps 10442 ENSOPRP00000002753 ENSOPRG00000003007 IRX5 OchPri2.0
Oryctolagus cuniculus 7815 ENSOCUP00000002818 ENSOCUG00000003240 IRX5 oryCun2.0
Oryzias latipes 16331 ENSORLP00000017199 101173451 ENSORLG00000013711 irx5a oryLat2
Otolemur garnettii 3688 ENSOGAP00000003688 100964692 ENSOGAG00000004133 IRX5 otoGar1
Pan troglodytes 13157 ENSPTRP00000013857 454093 ENSPTRG00000008121 IRX5 panTro2
Pongo abelii 7552 ENSPPYP00000008307 100445153 ENSPPYG00000007355 IRX5 ponAbe2
Procavia capensis 3504 ENSPCAP00000003366 ENSPCAG00000003649 IRX5 proCap1
Pteropus vampyrus 7014 ENSPVAP00000005418 ENSPVAG00000005731 IRX5 pteVam1
Rattus norvegicus 11704 ENSRNOP00000015272 498918 ENSRNOG00000011180 Irx5 rn4
Rhesus macaque 32381 ENSMMUP00000022960 697968 ENSMMUG00000017440 IRX5 rheMac2
Tarsius syrichta 6537 ENSTSYP00000005841 ENSTSYG00000006383 IRX5 tarSyr1
Tetraodon nigroviridis 2922 ENSTNIP00000016612 ENSTNIG00000013613 IRX5 tetNig2
Tupaia belangeri 4785 ENSTBEP00000004791 ENSTBEG00000005553 tupBel1
Xenopus tropicalis 25078 ENSXETP00000006137 100038201 ENSXETG00000002816 irx5 xenTro2

multiple sequence alignment in CLUSTALW format


Oryzias_latipes|15671        ATGGCGTATCCTCAGGGTTACTTGTACCAGCCGTCCGCTTCTTTAGCCCTGTATTCATGC
Tetraodon_nigroviridis|13767 ATGGCGTATCCTCAGGGCTACTTGTACCAGCCGTCCGCTTCTCTAGCCCTGTATTCGTGT
Fugu_rubripes|10566          ATGGCGTATCCTCAGGGCTACTTGTACCAGCCGTCCGCTTCTCTCGCCCTGTATTCGTGT
Macropus_eugenii|8397        ATGTCCTACCCTCAGGGCTACTTGTACCAGCCGTCTGCCTCCCTGGCTCTCTATTCCTGC
Tarsius_syrichta|7137        ------------------------------------------------------------
Xenopus_tropicalis|18231     ATGTCCTATCCTCAGGGCTACTTATACCAACCATCTGCTTCTTTGGCTCTGTACTCCTGC
Danio_rerio|29182            ATGGCGTACCCTCAGGGCTACTTGTATCAGCCATCCGCCTCTTTGGCACTCTATTCGTGT
Gasterosteus_aculeatus|2476  ATGGCGTATCCGCAGGGCTACTTGTACCAGCCGTCCGCGTCTCTAGCCCTGTATTCGTGC
Dipodomys_ordii|7378         ATGTCCTACCCGCAGGGCTACTTGTACCAGCCGTCCGCTTCGCTGGCGCTCTACTCGTGC
Pteropus_vampyrus|7450       ---ATCTACCCGCGAGGG---GTGTATCATCCGTTCGTCTCGCTGAAACTCTATGAA---
Erinaceus_europaeus|17385    ATGTCCTACCCGCAGGGCTACTTGTACCAGCCGTCCGCCTCGCTGGCGCTCTACTCGTGC
Gallus_gallus|3990           ATGTCGTATCCTCAGGGCTACTTGTACCAGCCGTCTGCCTCCTTGGCTCTCTACTCGTGC
Procavia_capensis|3713       ------------------------------------------------------------
Oryctolagus_cuniculus|16251  ------------------------------------------------------------
Monodelphis_domestica|4284   ATGTCCTACCCTCAGGGCTACTTGTACCAGCCGTCTGCCTCCCTGGCGCTCTATTCCTGT
Ochotona_princeps|11968      ------------------------------------------------------------
Microcebus_murinus|2476      ---ATGTCCCCGCAGGGCTACTTTTACCAGCCCTCC---CCCCTGGCGCTCTACTCGTGC
Rattus_norvegicus|16850      ATGTCCTACCCGCAGGGCTACTTGTACCAGCCGTCCGCCTCGCTGGCGCTCTACTCGTGC
Mus_musculus|42416           ATGTCCTACCCGCAGGGCTACTTGTACCAGCCGTCCGCCTCGCTGGCGCTCTACTCGTGC
Cavia_porcellus|17746        ATGTCCTACCCGCAGGGCTACTTGTATCAGCCGTCCGCCTCGCTGGCGCTCTACTCGTGC
Otolemur_garnettii|4285      ------------------------------------------------CTCTACTCGTGC
Canis_familiaris|9948        ATGTCCTACCCGCAGGGCTACTTGTACCAGCCGTCCGCCTCGCTGGCGCTCTACTCGTGC
Rhesus_macaque|25023         ATGTCCTATCCGCAGGGCTACTTGTACCAGCCGTCCGCCTCGCTGGCGCTCTACTCGTGC
Gorilla_gorilla|11566        ATGTCCTATCCGCAGGGCTACTTGTACCAGCCGTCCGCCTCGCTGGCACTCTACTCGTGC
Homo_sapiens|31801           ATGTCCTATCCGCAGGGCTACTTGTACCAGCCGTCCGCCTCGCTGGCGCTCTACTCGTGC
Pongo_abelii|10647           ATGTCCTATCCGCAGGGCTACTTGTACCAGCCGTCCGCCTCGCTGGCGCTCTACTCGTGC
Pan_troglodytes|14422        ATGTCCTATCCGCAGGGCTACTTGTACCAGCCGTCCGCCTCGCTGGCGCTCTACTCGTGC
Callithrix_jacchus|8217      ATGTCCTACCCGCAGGGCTACTTGTACCAGCCGTCCGCCTCGCTGGCGCTCTACTCGTGC
Equus_caballus|18306         ------------------------------------------------------------
Bos_taurus|8576              ATGTCCTACCCGCAGGGCTACTTGTACCAGCCGTCCGCCTCGCTGGCGCTCTACTCTTGC
Tupaia_belangeri|5563        ATGTCCTACCCGCAGGGCTACTTGTACCAGCCGTCCGCCTCGCTGGCGCTCTACTCTTGC
Echinops_telfairi|2347       ATGTCCTACCCTCAGGGCTACTTGTACCAGCCGTCCGCCTCGCTAGCGCTCTACTCCTGC
                                                                                         

Oryzias_latipes|15671        CCTGCGTACAGCACCAGCGTCATATCGGGACCCAGAACTGAGGAACTTGGGAGATCCTCC
Tetraodon_nigroviridis|13767 CCAGCGTACAGCACCGGCGTCATATCAGGACCCAGGACCGAGGAACTTGGCCGATCCTCT
Fugu_rubripes|10566          CCAGCGTATAGCACCAGCGTCATATCAGGACCCAGGACCGAGGAACTTGGCCGATCCTCT
Macropus_eugenii|8397        CCGGCTTACAGCACCAGCGTCATCTCGGGACCTCGCACCGATGANNNNNNNNNNNNNNNN
Tarsius_syrichta|7137        ------------------------------------------------------------
Xenopus_tropicalis|18231     CCTGCTTACAGCACCACTGTCATCTCTGGACCCAGGACTGATGAGCTTGGGAGGTCCCCT
Danio_rerio|29182            CCTGCCTACAGTACAAGCGTGATTTCGGGACCCCGGACAGAGGAGCTAGGGAGATCTTCC
Gasterosteus_aculeatus|2476  CCCGCGTACAGCACCAGCGTGATATCGGGACCGAGGACCGAGGAACTTGGGAGATCCTCT
Dipodomys_ordii|7378         CCGGCGTACAGCACCAGCGTTATTTCGGGGCCCCGCACGGATGAGCTCGGCCGATCGTCT
Pteropus_vampyrus|7450       ---GCGTACAGCACCAGCGTCATGTCAGGCATCCGCACTGATGAGCTCAACCACTATTTG
Erinaceus_europaeus|17385    CCGGCTTACAGTACCAGCGTCATCTCGGGGCCCCGCACAGATGAGCTCGGCCGCTCGTCG
Gallus_gallus|3990           CCGGCGTACAGCACCAGCGTGATTTCCGGACCCAGAACCGATGAACTTGGGAGATCTTCT
Procavia_capensis|3713       ------------------------------------------------------------
Oryctolagus_cuniculus|16251  ------------------------------CCCCGCACGGATGAGCTCGAGTCGTCGTCT
Monodelphis_domestica|4284   CCAGCTTACAGCACCAGCGTCATCTCGGGACCCCGTACAGATGAACTTGGCCGATCTTCC
Ochotona_princeps|11968      ------------------------------------------------------------
Microcebus_murinus|2476      CCGGCGTACAGCCCCAGCGTCATTTCGGGGCCCCGCACGGATGAGCTCGGCCGCTCG---
Rattus_norvegicus|16850      CCCGCATACAGCACCAGCGTCATTTCGGGGCCCCGCACGGATGAGCTCGGCCGCTCTTCT
Mus_musculus|42416           CCCGCATACAGCACCAGCGTCATTTCGGGGCCCCGCACGGATGAGCTCGGCCGCTCTTCT
Cavia_porcellus|17746        CCGGCGTACAGCACCAGCGTCATCTCGGGGCCCCGCACGGATGAGCTTGGCCGCTCGTCC
Otolemur_garnettii|4285      CCAGCGTACAGCACCAGCGTCATTTCGGGACCCCGCACGGATGAGCTCGGCCGCTCGTCT
Canis_familiaris|9948        CCGGCGTACAGCACCAGCGTCATCTCGGGGCCCCGCACGGATGAGCTCGGCCGCTCGTCG
Rhesus_macaque|25023         CCGGCGTACAGCACCAGCGTCATTTCGGGGCCCCGCACGGATGAGCTCGGCCGCTCTTCT
Gorilla_gorilla|11566        CCGGCGTACAGCACCAGCGTCATTTCGGGGCCCCGCACGGATGAGCTCGGCCGCTCTTCT
Homo_sapiens|31801           CCGGCGTACAGCACCAGCGTCATTTCGGGGCCCCGCACGGATGAGCTCGGCCGCTCTTCT
Pongo_abelii|10647           CCGGCGTACAGCACCAGCGTCATTTCGGGGCCCCGCACGGATGAGCTCGGCCGCTCTTCT
Pan_troglodytes|14422        CCGGCGTACAGCACCAGCGTCATTTCGGGGCCCCGCACGGATGAGCTCGGCCGCTCTTCT
Callithrix_jacchus|8217      CCGGCGTACAGCACCAGCGTCATTTCAGGGCCCCGCACGGATGAGCTCGGCCGGTCGTCT
Equus_caballus|18306         ------TACAGCACCAGCGTCATCTCGGGGCCCCGCACGGATGAGCTCGGCCGCTCGTCG
Bos_taurus|8576              CCGGCGTACAGCACCAGCGTCATCTCGGGGCCCCGCACGGATGAGCTCGGCCGCTCGTCG
Tupaia_belangeri|5563        CCGGCATACAGCACCAGCGTCATTTCGGGGCCCCGCACGGATGAGCTCGGCCGCTCGTCT
Echinops_telfairi|2347       CCGGCGTACAGCACCAGCGTCATCTCGGGACCCCGCACCGATGAGCTAGGCCGTTCGTCG
                                                                                         

Oryzias_latipes|15671        TCGGGATCTGCGTTCGCGCCCTATGCCGGATCTACTGCGTTCAGCAGCGCCTCGCCAGGC
Tetraodon_nigroviridis|13767 TCGGGATCTGCTTTTGCGCCCTATGCTGGATCTACAGCGTTCACCAGCGCCTCGCCAGGT
Fugu_rubripes|10566          TCGGGATCTGCTTTTGCGCCCTATGCTGGATCTACTGCGTTCACCAGCGCCTCGCCAGGC
Macropus_eugenii|8397        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|7137        ------------------------------------------------------------
Xenopus_tropicalis|18231     TCTGGCTCTGCCTTCTCACCTTACGCTGGATCTACAGCTTTCACTGCCAGCTCTGCTGGC
Danio_rerio|29182            TCTGGCTCTGCTTTCGCTCCCTATGCCGGATCTACAGCGTTCACCAGCGCCTCGCCAGGC
Gasterosteus_aculeatus|2476  TCGGGATCTGCTTTTGCGCCTTACGCCGGATCTACCGCGTTCACCAGCGCCTCGCCGGGC
Dipodomys_ordii|7378         TCGGGCTCTGCGTTCTCGCCCTACGCTGGCTCCACTGCCTTCACGGCGCCCTCGCCGGGC
Pteropus_vampyrus|7450       TCGGGCTACAAGTTCTCGCCCTACGCTAGCTCCACCACAAACACTGCGCGCTCGCCGGGC
Erinaceus_europaeus|17385    TCGGGCTCCGCGTTCTCGCCCTACGCCGGCTCCACCGCCTTCACGGCGCCCTCGCCGGGC
Gallus_gallus|3990           TCGGGCTCCGCTTTTTCCCCTTATGCCGGATCTACCGCCTTCACCGCCCCGTCCCCGGGT
Procavia_capensis|3713       ------------------------------------------------------------
Oryctolagus_cuniculus|16251  TCCGACTCCGCGTTCTCGCCCTACGCCAGCTCCACTGCCTTCACGGCGCCCTCGCCGGGC
Monodelphis_domestica|4284   TCGGGCTCCGCTTTTTCTCCTTACGCTGGATCTACCGCCTTTACCGCTCCTTCCCCGGGT
Ochotona_princeps|11968      ------------------------------------------------------------
Microcebus_murinus|2476      TCTGGCTCCGCGTTCTCGCCCTACGCCGGCTCCACCGCCTTCACGGCG---TCGCCGGGC
Rattus_norvegicus|16850      TCGGGCTCCGCATTCTCGCCCTACGCTGGCTCCACTGCCTTCACGGCTCCCTCGCCGGGC
Mus_musculus|42416           TCGGGCTCCGCGTTCTCGCCCTACGCTGGCTCCACTGCCTTCACGGCTCCCTCGCCCGGC
Cavia_porcellus|17746        TCCGGCTCTGCGTTCTCCCCCTACGCCGGCTCCACCGCCTTCACGGCGCCTTCGCCGGGC
Otolemur_garnettii|4285      TCGGGCTCAGCATTCTCACCCTACGCTGGCTCCACTGCCTTCACGGCGCCCTCACCGGGC
Canis_familiaris|9948        TCGGGCTCCGCGTTCTCGCCCTACGCCGGCTCCACCGCCTTCACGGCGCCCTCGCCAGGC
Rhesus_macaque|25023         TCGGGCTCCGCGTTCTCGCCCTACGCTGGCTCGACTGCCTTCACGGCGCCCTCGCCGGGC
Gorilla_gorilla|11566        TCGGGCTCCGCGTTCTCGCCCTACGCTGGCTCGACTGCCTTCACGGCGCCCTCGCCGGGC
Homo_sapiens|31801           TCGGGCTCCGCGTTCTCGCCCTACGCTGGCTCGACTGCCTTCACGGCGCCCTCGCCGGGC
Pongo_abelii|10647           TCGGGCTCCGCGTTCTCTCCTTACGCTGGCTCGACTGCCTTCACGGCGCCCTCGCCGGGC
Pan_troglodytes|14422        TCGGGCTCCGCGTTCTCGCCCTACGCTGGCTCGACTGCCTTCACGGCGCCCTCGCCGGGC
Callithrix_jacchus|8217      TCGGGCTCCGCGTTCTCGCCCTACGCTGGCTCGACTGCCTTCACCGCGCCCTCGCCGGGA
Equus_caballus|18306         TCGGGCTCCGCGTTCTCGCCCTACGCCGGCTCCACCGCCTTCACGGCGCCCTCGCCGGGC
Bos_taurus|8576              TCGGGCTCCGCGTTCTCGCCCTACGCCGGCTCCACAGCCTTCACGGCGCCCTCGCCGGGC
Tupaia_belangeri|5563        TCGGGCTCCGCGTTCTCGCCCTACGCTGGCTCTACTGCCTTCACGGCGCCCTCGCCGGGC
Echinops_telfairi|2347       TCGGGCTCCGCGTTCTCGCCCTATGCTGGCTCCACTGCCTTTACGGCGCCCTCGCCGGGC
                                                                                         

Oryzias_latipes|15671        TACAACTCCCACTTACCGTACAGTGCAGAC------GCGGCGGCAGCTGCCACATTCACC
Tetraodon_nigroviridis|13767 TACAACTCCCATTTACCCTACAGTGCAGAC------GCGGCGGCTGCTGCCACATTCACC
Fugu_rubripes|10566          TACAACTCCCATTTACCCTACAGTGCAGAC------GCAGCGGCAGCTGCCACATTCACC
Macropus_eugenii|8397        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|7137        ------------------------------------------------------------
Xenopus_tropicalis|18231     TTCAACTCTCCCCTCCAGTACAGCGGGGACCCA------------GCTGCTGCCTTTACT
Danio_rerio|29182            TACAATTCCCATCTCCCGTACAGTGCTGAT------GCGGCCGCCGCTGCTACTTTCACC
Gasterosteus_aculeatus|2476  TACAACTCCCACTTGCCATACAGCGCGGAC------GCGGCCGCGGCTGCCACATTCACC
Dipodomys_ordii|7378         TACAACTCGCACCTCCAGTACGGCGCGGACCCCGCGGCTGCCGCCGCCGCCGCTTTCTCC
Pteropus_vampyrus|7450       TACGACTCACACATCCAATACGGCGCCGACCCCCCGGCGGCCGCGGCAGCCCCTTTCTCT
Erinaceus_europaeus|17385    TACAACTCGCACCTCCAGTACGGCGCCGACCCCGCGGCTGCCGCGGCGGCCGCCTTCTCT
Gallus_gallus|3990           TACAACTCGCACCTCCAGTACGGCACGGACCCGGCCGCCGCCGCCGCCGCCGCTTTCACC
Procavia_capensis|3713       ------------------------------------------------------------
Oryctolagus_cuniculus|16251  TACAACTCGCACCTCCAGTACGGCGCCGACCCCGCGGCTGCAGCCGCCGCCGCCTTCTCC
Monodelphis_domestica|4284   TACAACTCTCACCTCCAGTACGGCACGGACCCAGCTGCCGCAGCAGCCGCCGCCTTCACT
Ochotona_princeps|11968      ------------------------------------------------------------
Microcebus_murinus|2476      TACAACTCGCACCTCCAGTACGGCGCC---CCCACGGCCGCCGCCGCCGCCGCCTTCTCC
Rattus_norvegicus|16850      TACAACTCGCACCTCCAGTACGGTGCCGATCCCGCGGCTGCGGCCGCCGCCGCCTTC---
Mus_musculus|42416           TACAACTCGCACCTCCAGTACGGCGCCGACCCCGCGGCTGCGGCCGCCGCTGCCTTC---
Cavia_porcellus|17746        TACAACTCGCACCTCCAGTACGGCGCCGACCCCGCGGCAGCCGCCGCCGCAGCCTTCTCC
Otolemur_garnettii|4285      TACAACTCGCACCTCCAGTACGGCGCCGACCCCGCGGCCGCCGCCGCAGCCGCCTTCTCC
Canis_familiaris|9948        TACAACTCGCACCTCCAGTACGGGGCCGACCCCGCGGCAGCCGCCGCCGCCGCCTTCTCG
Rhesus_macaque|25023         TACAACTCGCACCTCCAGTACGGCGCCGACCCCGCGGCCGCAGCCGCCGCCGCCTTCTCC
Gorilla_gorilla|11566        TACAACTCGCACCTCCAGTACGGCGCCGACCCCGCGGCCGCCGCCGCCGCCGCCTTCTCC
Homo_sapiens|31801           TACAACTCGCACCTCCAGTACGGcgccgaccccgcggccgccgccgccgccgccTTCTCC
Pongo_abelii|10647           TACAACTCGCACCTCCAGTACGGCGCTGAccccgcggcggccgccgccgccgcTTTCTCC
Pan_troglodytes|14422        TACAACTCGCACCTCCAGTACGGcgccgaccccgcggccgccgccgccgccgccTTCTCC
Callithrix_jacchus|8217      TACAACTCTCACCTCCAGTACGGCGCCGACCCCGCGGCCGCAGCCGCCGCCGCCTTCTCG
Equus_caballus|18306         TACAACTCGCACCTCCAGTACGGcgccgaccccgcggccgccgccgccgccgccTTCTCT
Bos_taurus|8576              TACAACTCTCACCTCCAGTACGGCGCCGATCCCGCGGCGGCAGCCGCCGCCGCCTTCTCT
Tupaia_belangeri|5563        TACAACTCGCACCTCCAATACGGCGCTGACCCGGCCGCCGCCGCCGCCGCCGCCTTCTCC
Echinops_telfairi|2347       TACAACTCGCACCTCCAGTACGGGGCCGACCCCGCGGCGGCGGCGGCGGCCGCTTTCTCT
                                                                                         

Oryzias_latipes|15671        TCGTACGTGAGTTCTCCATATGACCACACCACTGGCATGGCCGGTTCAATAGGATACCAT
Tetraodon_nigroviridis|13767 TCGTATGTGAGTTCTCCTTACGATCACACCACCGGCATGGCCGGCTCGATAGGATATCAC
Fugu_rubripes|10566          TCGTATGTGAGTTCCCCTTATGATCACACGAGCGGTATGGCCGGGTCAATAGGATATCAC
Macropus_eugenii|8397        NNNNNNNNNGGCTCACCCTACGACCACACCCCGGGCATGGCGGGGTCCCTAGGATACCAT
Tarsius_syrichta|7137        ---------GGCTCTCCCTACGACCACGCACCCGGCATGGCGGGCTCCTTGGGGTACCAC
Xenopus_tropicalis|18231     TCCTATGTGGGCTCTCCGTATGATCACAGCGCTGGCATGGCTGGATCATTAGGATATCAC
Danio_rerio|29182            TCTTATGTGAGCTCACCTTATGACCACACGACAGGCATGGCCGGGTCTATAGGGTATCAT
Gasterosteus_aculeatus|2476  TCGTACGTGGGCTCTCCCTATGACCACACCACGGGCATGGCGGGCTCAATCGGATACCAT
Dipodomys_ordii|7378         TCGTACGTGGGTTCTCCCTACGATCACACACCCGGCATGGCGGGATCCTTGGGGTACCAC
Pteropus_vampyrus|7450       TCGTACGTGGGCTCTCCCTATGATCATACACCCGGCATGGCAGGTTCCTTGGGGTACCAC
Erinaceus_europaeus|17385    TCGTACGTGGGTTCACCCTATGATCATACACCTGGCATGGCAGGCTCCTTGGGGTATCAC
Gallus_gallus|3990           TCCTACGTGGGCTCTCCCTACGAGCACCCTCCGGCCATGGCGGGCTCCCTGGGCTACCAC
Procavia_capensis|3713       ---------GGCTCTCCCTACGACCACACACCGGGTTTGGCGGGCTCTTTGGGCTACCAT
Oryctolagus_cuniculus|16251  TCGTACGTGGGCTCTCCCTACGACCACACTCCCGGCATGGCGGGCTCCTTGGGCTACCAC
Monodelphis_domestica|4284   TCGTACGTGGGCTCACCCTATGACCACACCCCGGGAATGGCGGGGTCCCTAGGATACCAT
Ochotona_princeps|11968      ---------GGCTCTCCCTACGACCACACGCCCGGCATGGCCGGCTCCCTGGGCTATCAC
Microcebus_murinus|2476      TCGTACGTGGGGTCCCCCTACGACCACACCCCCGGCATGGCGGGCTCCTTGGGGTATCAC
Rattus_norvegicus|16850      TCGTACGTGGGCTCTCCCTATGACCACACTCCCGGTATGGCGGGTTCCTTGGGATATCAC
Mus_musculus|42416           TCTTACGTGGGCTCTCCCTACGACCACACTCCCGGTATGGCAGGTTCCTTGGGATATCAC
Cavia_porcellus|17746        TCGTACGTGGGCTCTCCCTATGACCACACACCCGGCATGGCGGGCTCCTTGGGGTACCAC
Otolemur_garnettii|4285      TCGTACGTGGGGTCTCCCTACGACCACACACCCGGCATGGCGGGCTCCTTGGGGTACCAC
Canis_familiaris|9948        TCGTACGTGGGCTCGCCCTACGACCATACACCGGGCATGGCCGGCTCCCTGGGGTACCAC
Rhesus_macaque|25023         TCGTACGTGGGCTCTCCCTACGACCACACACCCGGTATGGCGGGCTCCTTGGGGTACCAT
Gorilla_gorilla|11566        TCGTACGTGGGCTCTCCCTACGACCACACACCCGGCATGGCGGGCTCCTTGGGGTACCAT
Homo_sapiens|31801           TCGTACGTGGGCTCTCCCTACGACCACACACCCGGCATGGCGGGCTCCTTGGGGTACCAT
Pongo_abelii|10647           TCGTACGTGGGCTCTCCCTACGACCACACACCCGGCATGGCGGGCTCCTTGGGGTACCAT
Pan_troglodytes|14422        TCGTACGTGGGCTCTCCCTACGACCACACACCCGGCATGGCGGGCTCCCTGGGGTACCAT
Callithrix_jacchus|8217      TCGTATGTGGGCTCTCCCTACGACCACACACCCGGCATGGCGGGTTCCTTGGGGTACCAC
Equus_caballus|18306         TCGTACGTGGGCTCTCCCTACGACCATACACCGGGCATGGCAGGCTCCTTGGGGTACCAC
Bos_taurus|8576              TCGTACGTGGGCTCTCCCTACGACCATACACCGGGCATGGCAGGTTCCTTGGGGTACCAC
Tupaia_belangeri|5563        TCGTACGTGNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Echinops_telfairi|2347       TCGTACGTGGGCTCTCCTTATGACCACACACCAGGCATGGCGGGCTCCTTGGGGTACCAT
                                       . .     .  .           .   ...  .. .   . .. .     

Oryzias_latipes|15671        CCTTACGCAGCACCTTTGGGCACCTACCCCTACGGGGACCCTGCTTACCGCAAAAACGCG
Tetraodon_nigroviridis|13767 CCCTACGCGACACCTCTGGGCACCTACCCCTACGGTGACCCAGCATACCGTAAAAACGCA
Fugu_rubripes|10566          CCTTACGCGACACCTCTGGGCACCTACCCTTACGGTGACCCAGCATACCGTAAAAACGCA
Macropus_eugenii|8397        CCCTATGCTGCACCCTTGGGGTCCTATCCCTATGGGGATCCAGCCTACCGGAAAAACGCC
Tarsius_syrichta|7137        CCGTACGCGGCGCCCCTGGGCTCGTACCCGTACGGGGACCCCGCGTACCGGAAGAACGCG
Xenopus_tropicalis|18231     CCATATGCTGCTCCTTTGGGAACGTATCCTTATGGCGACCCAGCGTACAGGAAAAATGCC
Danio_rerio|29182            CCTTATGCTGCTCCCCTGGGCTCGTACCCGTATGGAGACCCAGCTTACCGCAAGAATGCT
Gasterosteus_aculeatus|2476  CCTTACGCAGCACCCTTGGGCTCCTACCCTTACGGTGACCCGGCGTATCGTAAAAACGCA
Dipodomys_ordii|7378         CCTTACGCGGCGCCCCTGGGGTCCTACCCATATGGGGACCCCGCGTACCGGAAGAACGCC
Pteropus_vampyrus|7450       CCGTACGCAGCGCCCCTGGGCTCGTACCCGTACGGGGACCCCGCGTACCGAAAGAACGCC
Erinaceus_europaeus|17385    CCCTATGCTGCACCCCTCGGCTCTTACCCATACGGGGACCCCGCATACCGGAAGAATGCC
Gallus_gallus|3990           CCGTACGCGGCGCCGCTCGGCTCCTACCCCTACGGGGATCCGGCGTACCGCAAGAACGCG
Procavia_capensis|3713       CCGTACGCGGCACCCCTGGGCTCATACCCGTATGGGGACCCCGCATACCGGAAGAACGCC
Oryctolagus_cuniculus|16251  CCGTACGCCGCGCCCCTGGGCTCGTACCCGTACGGGGATCCCGCGTACCGGAAGAACGCC
Monodelphis_domestica|4284   CCCTACGCTGCACCTTTAGGGTCCTATCCCTATGGGGATCCAGCCTATCGGAAAAACGCC
Ochotona_princeps|11968      CCATATGCAGCGCCCCTGGGCTCCTACCCATACGGGGATCCCGCATACCGGAAGAACGCC
Microcebus_murinus|2476      CCCTATGCTGCGCCCCTAGGGTCCTACCCATATGGGGACCCCGCATACCGGAAGAACGCC
Rattus_norvegicus|16850      CCTTACGCCGCACCTCTGGGCTCCTATCCTTATGGGGATCCCGCGTACCGGAAGAACGCC
Mus_musculus|42416           CCTTATGCAGCACCTCTGGGCTCCTATCCTTATGGGGACCCCGCGTACCGGAAGAATGCC
Cavia_porcellus|17746        CCATATGCAGCGCCTCTGGGCTCATACCCGTATGGGGACCCCGCATATCGGAAGAACGCC
Otolemur_garnettii|4285      CCCTATGCTGCGCCCCTGGGCTCCTATCCTTATGGGGACCCGGCATACCGGAAGAACGCC
Canis_familiaris|9948        CCATACGCGGCGCCCCTGGGCTCCTATCCCTACGGGGACCCCGCGTACCGCAAGAACGCC
Rhesus_macaque|25023         CCCTACGCGGCGCCCCTGGGCTCGTACCCTTACGGGGATCCAGCGTACCGGAAGAACGCC
Gorilla_gorilla|11566        CCTTACGCGGCGCCCCTGGGATCGTACCCTTACGGGGACCCAGCGTACCGGAAGAACGCC
Homo_sapiens|31801           CCTTACGCGGCGCCCCTGGGATCGTACCCTTACGGGGACCCAGCGTACCGGAAGAACGCC
Pongo_abelii|10647           CCTTACGCGGCGCCCCTGGGATCGTACCCTTACGGGGACCCAGCGTACCGGAAGAACGCC
Pan_troglodytes|14422        CCTTACGCGGCACCCCTGGGATCGTACCCTTACGGGGACCCAGCGTACCGGAAGAACGCC
Callithrix_jacchus|8217      CCCTACGCGGCGCCCCTGGGTTCGTACCCTTATGGGGACCCAGCGTACCGGAAGAATGCC
Equus_caballus|18306         CCATACGCGGCGCCCCTGGGCTCGTATCCCTAC---GACCCCGCGTACCGGAAGAACGCC
Bos_taurus|8576              CCGTACGCGGCGCCCCTGGGCTCGTACCCGTACGGGGACCCCGCGTACCGGAAGAACGCC
Tupaia_belangeri|5563        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Echinops_telfairi|2347       CCATACGCAGCGCCCCTGGGCTCTTACTCTTATGGGGACTCAGCATACTGGAAGAACGCC
                                .  .         . ..    .     .     .     .  .   .       .  

Oryzias_latipes|15671        ACCCGGGACGCCACCGCCACCCTCAAGGCCTGGCTCAACGAGCACCGCAAGAACCCCTAC
Tetraodon_nigroviridis|13767 ACCCGGGACGCCACGGCCACGCTGAAGGCCTGGCTCAACGAGCACCGCAAGAACCCCTAC
Fugu_rubripes|10566          ACCCGGGACGCCACCGCCACCCTTAAAGCATGGCTCAACGAGCACCGCAAAAACCCCTAC
Macropus_eugenii|8397        ACCCGGGACGCCACGGCAACGCTCAAGGCCTGGCTGAATGAGCACCGCAAGAACCCGTAC
Tarsius_syrichta|7137        ACGAGGGACGCCACCGCCACGCTCATGGCCTGGCTCATCGAGCACCGCAAGAACCCCTAC
Xenopus_tropicalis|18231     ACCAGAGATGCAACTGCCACTTTGAAGGCCTGGCTCAACGAACACAGGAAGAATCCTTAC
Danio_rerio|29182            ACCCGGGACGCCACAGCTACTTTGAAAGCTTGGCTTAACGAGCACCGGAAAAACCCGTAC
Gasterosteus_aculeatus|2476  ACGCGGGACGCCACCGCCACCCTGAAGGCCTGGCTCGGCGAGCACCGCAAGAACCCCTAC
Dipodomys_ordii|7378         ACACGGGACGCTACAGCTACCCTCAAGGCCTGGCTCAATGAGCACCAAAGGAAGCACAGA
Pteropus_vampyrus|7450       ACGCGAGACGCCACCGCTACACTCAAGGCCTGGCTCAACGAGCACCGCAAGAACCCCTAC
Erinaceus_europaeus|17385    ACACGAGACGCCACCGCCACGCTCAAGGCCTGGCTCAACGAGCACCGCAAGAACCCCTAC
Gallus_gallus|3990           ACGCGGGACGCCACGGCCACGCTCAAGGCCTGGCTCAACGAGCACCGCAAGAACCCGTAC
Procavia_capensis|3713       ACGCGAGATGCCACGGCCACGCTCAAGGCCTGGCTCAATGAGCACCGCATGAACCCGTAC
Oryctolagus_cuniculus|16251  ACGCGGGACGCCACCGCCACGCTCAAGGCCTGGCTCAACGAGCACCGCAAGAACCCCTAC
Monodelphis_domestica|4284   ACCCGGGACGCCACAGCAACGCTAAAGGCCTGGCTGAATGAGCACCGCAAGAACCCATAC
Ochotona_princeps|11968      ACGCGGGACGCCACCGCCACGCTCAAGGCCTGGCTCAACGAGCACCGCAAGAACCCCTAC
Microcebus_murinus|2476      ACCCGGGACGCCACTGCTACGCTCAAGGCCTGGCTCAACGAGCACCGCAAGAACCCCTAC
Rattus_norvegicus|16850      ACTCGGGACGCCACTGCCACTCTCAAGGCCTGGCTCAATGAGCACCGAAAGAACCCGTAT
Mus_musculus|42416           ACTCGGGACGCTACAGCCACTCTCAAGGCCTGGCTCAACGAGCACCGCAAGAACCCGTAC
Cavia_porcellus|17746        ACCAGGGATGCTACGGCCACGCTCAAGGCTTGGCTCAACGAGCACCGCAAAAACCCCTAC
Otolemur_garnettii|4285      ACACGGGACGCCACTGCTACTCTCAAGGCCTGGCTTAATGAGCATCGGAAGAACCCCTAC
Canis_familiaris|9948        ACGCGAGACGCCACCGCCACGCTCAAGGCCTGGCTGAACGAGCACCGCAAGAACCCCTAC
Rhesus_macaque|25023         ACAAGGGACGCCACGGCTACGCTCAAGGCCTGGCTCAACGAGCATCGCAAGAACCCCTAC
Gorilla_gorilla|11566        ACAAGGGACGCCACGGCTACGCTCAAGGCCTGGCTCAACGAGCACCGCAAGAACCCCTAC
Homo_sapiens|31801           ACAAGGGACGCCACGGCTACCCTCAAGGCCTGGCTCAACGAGCACCGCAAGAACCCCTAC
Pongo_abelii|10647           ACAAGGGACGCCACGGCTACGCTCAAGGCCTGGCTCAACGAGCACCGCAAGAACCCCTAC
Pan_troglodytes|14422        ACAAGGGACGCCACGGCTACGCTCAAGGCCTGGCTCAACGAGCACCGCAAGAACCCCTAC
Callithrix_jacchus|8217      ACTAGGGACGCCACCGCTACCCTCAAGGCCTGGCTCAATGAGCACCGCAAGAACCCCTAC
Equus_caballus|18306         ACGCGAGACGCCACCGCTACGCTCAAGGCCTGGCTCAACGAGCACCGCAAGAACCCCTAC
Bos_taurus|8576              ACGAGAGACGCCACAGCTACGCTCAAGGCCTGGCTCAACGAGCACCGCAAGAACCCCTAC
Tupaia_belangeri|5563        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Echinops_telfairi|2347       ACGAGGGACGCCACGGCCACTCTCAAGGCCTGGCTGAACGAGCACCGCAAGAACCCCTAC
                                 . .  .     .      .    .  ... .    .                    

Oryzias_latipes|15671        CCCACCAAGGGTGAGAAGATCATGCTGGCCATCATCACCAAAATGACCCTCACTCAGGTG
Tetraodon_nigroviridis|13767 CCGACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAGGTG
Fugu_rubripes|10566          CCGACCAAGGGGGAGAAGATCATGCTGGCCATCATCACCAAAATGACCCTCACCCAGGTG
Macropus_eugenii|8397        CCCACCAAAGGCGAGAAGATCATGTTGGCCATCATTACCAAGATGACCCTCACTCAGGTC
Tarsius_syrichta|7137        CCCACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAAGTG
Xenopus_tropicalis|18231     CCCACAAAGGGCGAGAAGATTATGTTGGCTATTATTACTAAGATGACCCTAACTCAAGTG
Danio_rerio|29182            CCCACCAAAGGCGAGAAGATCATGCTGGCCATCATCACTAAAATGACCCTCACTCAAGTG
Gasterosteus_aculeatus|2476  CCGACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAGGTG
Dipodomys_ordii|7378         AACGAAGAGAAGGAG------------------------AAGAAGAAGAAGAAGCAGATG
Pteropus_vampyrus|7450       CCCACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAGGTG
Erinaceus_europaeus|17385    CCCACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACTCTCACCCAGGTG
Gallus_gallus|3990           CCCAGCAAG---------------------------------------------------
Procavia_capensis|3713       CCCACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAGGTG
Oryctolagus_cuniculus|16251  CCCACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAGGTG
Monodelphis_domestica|4284   CCCACCAAGGGCGAGAAGATCATGTTGGCCATCATTACCAAGATGACCCTCACTCAGGTC
Ochotona_princeps|11968      CCCACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAGGTG
Microcebus_murinus|2476      CCCACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACGCAGGTG
Rattus_norvegicus|16850      CCCACTAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAAATGACCCTCACCCAGGTG
Mus_musculus|42416           CCCACCAAGGGAGAGAAGATCATGCTGGCCATTATCACCAAGATGACCCTCACCCAGGTG
Cavia_porcellus|17746        CCCACCAAGGGCGAAAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAGGTG
Otolemur_garnettii|4285      CCCACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAGGTG
Canis_familiaris|9948        CCCACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAGGTG
Rhesus_macaque|25023         CCCACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAGGTG
Gorilla_gorilla|11566        CCCACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAGGTG
Homo_sapiens|31801           CCCACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAGGTG
Pongo_abelii|10647           CCCACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAGGTG
Pan_troglodytes|14422        CCCACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAGGTG
Callithrix_jacchus|8217      CCTACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAGGTG
Equus_caballus|18306         CCCACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAGGTG
Bos_taurus|8576              CCCACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAGGTG
Tupaia_belangeri|5563        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Echinops_telfairi|2347       CCGACCAAGGGCGAGAAGATCATGCTGGGCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                                                                         

Oryzias_latipes|15671        TCCACCTGGTTCGCCAACGCCAGGAGGAGGCTAAAGAAGGAGAACAAGATGACCTGGACG
Tetraodon_nigroviridis|13767 TCCACCTGGTTCGCCAACGCCAGGAGGAGGTtaaagaaggagaacaagatgaCCTGGACC
Fugu_rubripes|10566          TCCACCTGGTTCGCCAACGCCAGGAGGAGGTTAAAGAAGGAGAACAAGATGACCTGGACC
Macropus_eugenii|8397        TCCACTTGGTTTGCCAACGCACGGAGGCGCCTCAAGAAGGAGAACAAAATGACCTGGACC
Tarsius_syrichta|7137        TCCACCTGGTTCGCCAACGCGCGCCGGCGCCTC---AAGGAGAACATTATGACGTGGACG
Xenopus_tropicalis|18231     TCCACCTGGTTTGCTAACGCAAGGAGGAGGCTAAAAAAAGAAAATAAAATGACATGGACT
Danio_rerio|29182            TCCACCTGGTTCGCCAACGCCAGGAGGAGGCTAAAAAAGGAGAACAAGATGACCTGGACC
Gasterosteus_aculeatus|2476  TCCACCTGGTTCGCCAACGCCAGGCGGAGGCTAAAGAAGGAGAACAAGATGACCTGGACC
Dipodomys_ordii|7378         TCCACCTGGTTCGCCAACGCGCGCCGGCGCCTCAAGAAGGAGAACAAGATGACGTGGACG
Pteropus_vampyrus|7450       TCCACCTGGTTCGCCAACGCGCGCCGGCGCCTGAAGAAGGAGAACAAGATGACGTGGACT
Erinaceus_europaeus|17385    TCCACCTGGGTCGCCAACGCGCGCCGGCGCCTCAAGAAAGAGAACAAGATGACCTGGACG
Gallus_gallus|3990           ------------------------------------------------------------
Procavia_capensis|3713       TCCACCTGGTTCGCCAATGCGCGCCGGCGCCTCAAGAAGGAAAACAAGATGACCTGGACG
Oryctolagus_cuniculus|16251  TCCACCTGGTTCGCCAACGCACGCCGGCGCCTCAAGAAGGAGAACAAGATGACGTGGACG
Monodelphis_domestica|4284   TCCACCTGGTTCGCCAACGCACGAAGGCGCCTCAAGAAGGAGAACAAGATGACCTGGACC
Ochotona_princeps|11968      TCCACCTGGTTCGCCAACGCGCGCCGGCGCCTCAAGAAGGAGAACAAGATGACGTGGACG
Microcebus_murinus|2476      TCCACCTGGTTCGCCAACGCGCGCCGGCGCCTCAAGAAGGAGAACAAGATGACATGGACG
Rattus_norvegicus|16850      TCCACCTGGTTCGCCAACGCGCGCCGGCGCCTCAAGAAAGAGAACAAGATGACGTGGACG
Mus_musculus|42416           TCCACCTGGTTTGCCAACGCGCGCCGGCGCCTCAAGAAAGAGAACAAGATGACGTGGACG
Cavia_porcellus|17746        TCTACCTGGTTCGCCAATGCGCGCCGGCGCCTCAAGAAGGAGAACAAGATGACGTGGACG
Otolemur_garnettii|4285      TCCACCTGGTTCGCCAATGCGCGCCGGCGCCTCAAGAAGGAGAATAAGATGACGTGGACG
Canis_familiaris|9948        TCCACCTGGTTCGCCAACGCGCGCCGGCGCCTCAAGAAGGAGAACAAGATGACGTGGACG
Rhesus_macaque|25023         TCCACCTGGTTCGCCAACGCGCGCCGGCGCCTCAAGAAAGAGAATAAAATGACGTGGACG
Gorilla_gorilla|11566        TCCACCTGGTTCGCCAACGCGCGCCGGCGCCTCAAGAAAGAGAATAAAATGACGTGGACG
Homo_sapiens|31801           TCCACCTGGTTCGCCAACGCGCGCCGGCGCCTCAAGAAAGAGAATAAAATGACGTGGACG
Pongo_abelii|10647           TCCACCTGGTTCGCCAACGCGCGCCGGCGCCTCAAGAAAGAGAATAAAATGACATGGACG
Pan_troglodytes|14422        TCCACCTGGTTCGCCAACGCGCGCCGGCGCCTCAAGAAAGAGAATAAAATGACGTGGACG
Callithrix_jacchus|8217      TCCACCTGGTTCGCCAACGCGCGCCGGCGCCTCAAGAAAGAGAACAAAATGACGTGGACG
Equus_caballus|18306         TCCACCTGGTTCGCCAACGCGCGCCGGCGCTTCAAGAAGGAGAACAAGATGACTTGGACG
Bos_taurus|8576              TCCACCTGGTTCGCTAACGCGCGCCGGCGCCTCAAGAAGGAGAACAAGATGACGTGGACG
Tupaia_belangeri|5563        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Echinops_telfairi|2347       NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                                                                         

Oryzias_latipes|15671        CCCCGGAACCGAAGCGAGGACGAGGAGGAAGACGAGAATATCGATCTGGAGAAAAATGAC
Tetraodon_nigroviridis|13767 CCCCGGAACCGCagcgaagacgaggaggaggacgagaatATCGACTTGGAGAAGAACGAC
Fugu_rubripes|10566          CCCCGGAACCgcagcgaggacgaggaggaggacgagaatATTGATTTGGAGAAAAACGAC
Macropus_eugenii|8397        CCACGGAACCGGAGCGAGGATGAGGAAGAAGAAGAAAACATCGACCTGGAGAAGAACGAT
Tarsius_syrichta|7137        CCTCGGAACCGCGGCGAGGACGAGGAGGATGAGGAGAACATTGACCTGGACAATAGCGAT
Xenopus_tropicalis|18231     CCGAGAAACAGGAGTGAGGATGAGGAGGATGACGAAAATATTGATCTGGAAAAAAATGAA
Danio_rerio|29182            CCACGGAACCGGAGTGAAGACGAGGAGGAGGACGAAAACATTGATCTAGAGAAAAACGAC
Gasterosteus_aculeatus|2476  CCCCGGAACCGAAGCGAGGACGAGGAGGAAGACGAGAATATCGATTTGGAGAAAAACGAT
Dipodomys_ordii|7378         CCGCGGAACCGCAGCGAGGACGAGGAGGAAGAGGAGAACATCGACCTGGAGAAGAACGAC
Pteropus_vampyrus|7450       CCGAGGAACCGCAGCGAGGATGAGGAAGAGGAGGAGAACATTGATCTGGAGAAGAACGAC
Erinaceus_europaeus|17385    CCG---AACCGCAGCGAGGAC---GAGGAAGAGGAGAACATCGACTTGGAG---AACGAC
Gallus_gallus|3990           ------------------------------------------------------------
Procavia_capensis|3713       CCGCGAAACCGCAGTGAGGATGAGGAGGAGGAAGAGAACATAGACCTGGAAAAGAATGAC
Oryctolagus_cuniculus|16251  CCGCGGAACCGCAGCGAGGACGAGGAGGAGGAGGAGAACATCGACCTGGAGAAGAACGAC
Monodelphis_domestica|4284   CCGCGGAACCGGAGCGAGGACGAGGAAGAAGAAGAAAACATCGACTTGGAGAAAAACGAT
Ochotona_princeps|11968      CCGCGGAACCGCAGTGAGGACGAGGAGGAGGAGGAGAACATTGACCTCGAGAAGAACGAC
Microcebus_murinus|2476      CCGCGGAACCGCAGCGAGGACGAGGAGGAAGAGGAGAACATTGACCTGGAGAAGAACGAC
Rattus_norvegicus|16850      CCACGGAACCGCAGCGAGGACGAGGAGGAGGAGGAGAACATTGATCTGGAAAAGAACGAC
Mus_musculus|42416           CCACGGAACCGCAGCGAGGACGAGGAGGAGGAGGAGAACATCGATCTGGAGAAGAACGAC
Cavia_porcellus|17746        CCGCGGAACCGCAGCGAGGATGAGGAGGAAGAGGAGAACATTGACCTGGAAAAGAATGAC
Otolemur_garnettii|4285      CCGCGGAACCGCAGCGAGGACGAGGAGGAAGAGGAGAACATTGACCTAGAGAAGAATGAC
Canis_familiaris|9948        CCGCGGAACCGCAGCGAGGACGAGGAGGAGGAGGAGAACATCGATCTGGAGAAGAACGAC
Rhesus_macaque|25023         CCGCGGAACCGCAGCGAGGACGAAGAAGAGGAGGAGAACATTGACCTGGAGAAGAACGAC
Gorilla_gorilla|11566        CCGCGGAACCGCAGCGAGGACGAGGAAGAGGAGGAGAACATTGACCTGGAGAAGAACGAC
Homo_sapiens|31801           CCGCGGAACCGCAGCGAGGACGAGGAAGAGGAGGAGAACATTGACCTGGAGAAGAACGAC
Pongo_abelii|10647           CCGCGGAACCGCAGCGAGGACGAGGAAGAGGAGGAGAACATAGACCTGGAGAAGAACGAC
Pan_troglodytes|14422        CCGCGGAACCGCAGCGAGGACGAGGAAGAGGAGGAGAACATTGACCTGGAGAAGAACGAC
Callithrix_jacchus|8217      CCGCGGAACCGCAGCGAGGACGAGGAAGAGGAAGAGAACATTGATCTGGAGAAGAACGAC
Equus_caballus|18306         CCGCGGAACCGCAGCGAGGACGAGGAAGAGGAGGAGAACATTGATCTGGAGAAGAACGAC
Bos_taurus|8576              CCGCGGAACCGCAGCGAGGACGAGGAGGAGGAAGAGAACATTGATCTGGAGAAGAACGAC
Tupaia_belangeri|5563        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Echinops_telfairi|2347       NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                                                                         

Oryzias_latipes|15671        GACGACGAGCCAAACAAGCCCTTAGATAAAGGAGACTCCACAGACACAGAA---GCAGGT
Tetraodon_nigroviridis|13767 GACGACGAGCCGAACAAGCCGACAGACAAGGGAGACTCGACAGACACAGAAGCAGATCAT
Fugu_rubripes|10566          GACGACGAGCCGAATAAGCCCACAGACAAGGGAGACTCGACAGACACAGAAGCAGATCAT
Macropus_eugenii|8397        GAGGATGAACCACAGAAGCCGGAAGATAAGGGAGAGGTTGAGGCCCCAGAA---ACAGGG
Tarsius_syrichta|7137        GAGGACGACCCCCATAAGCCCGTGAACTATGGCGACTCCGAGGGTCCCAAA---TTAGNN
Xenopus_tropicalis|18231     GAAGACGATCCAAGAAAACTTGAAGAGAAGGGGGACCAAGATGGAGATGCA---GGGGAT
Danio_rerio|29182            GACGACGAGCCAAACAAGCCCACGGACAAGGGAGACTCCACAGACACAGAGGCAGATCAC
Gasterosteus_aculeatus|2476  GACGATGAGCCAAACAAGCCCACGGACAAGGGAGACTCCACGGACACAGAAGGAATTATG
Dipodomys_ordii|7378         GAGGATGAGCCCCAGAAACCCGTGGACAAGAGTGACCTCGAAGGCTCGGAA---GCAGGA
Pteropus_vampyrus|7450       GAGGATGAGCCCCCCAAGCCCGAGGACAAGGGAGACCCTGAGGGCCCCGAA---GCAGGA
Erinaceus_europaeus|17385    GAAGACGAGCCCCAGAAGGAAGACGGCGATCACGGACCCGCAGCAGNNNNN---NNNNNN
Gallus_gallus|3990           ------------------------------------------------------------
Procavia_capensis|3713       GAGGACGAGCCTCATAAGCCCGAGGACAAGGGTGACCTCGAGGGCACCGAA---GCAGGA
Oryctolagus_cuniculus|16251  GAGGACGAGCCCCAGAAAGCCGAGGACAAGGGCGACCCCGAGGGCCCCGAA---GCAGGA
Monodelphis_domestica|4284   GAGGATGAACCACAAAAGCCGGAAGATAAGGGAGAGGCAGAGGCCCCAGAA---ACAGGG
Ochotona_princeps|11968      GAGGACGAGCCCCAGAAGGCCGAGGACAAGGGCGACCCTGAGGGTCCCGAA---GCAGGA
Microcebus_murinus|2476      GAGGATGAGCCCCAGAAGCCCGAGGACAAGGGCGACCCCGAGGGCCCTGAA---GCAGNN
Rattus_norvegicus|16850      GAGGACGAGCCACAGAAGCCCGAGGACAAGGGCGACCTCGAGGGCCCCGAA---GCAGGA
Mus_musculus|42416           GAGGACGAGCCACAGAAGCCCGAGGACAAGGGCGACCTCGAGGGCCCCGAA---TCAGGA
Cavia_porcellus|17746        GAGGATGAGCCCCAGAAGCCTGAGGATAAGAGCGACCCCGAGGGCACTGAA---GCAGGC
Otolemur_garnettii|4285      GAGGACGAGCCCCAGAAGCCCGAGGACAAGGGCGACGCTGAGGGCCCTGAA---GCAGGA
Canis_familiaris|9948        GAGGACGAGCCCCAGAAGCCCGAGGGCAAGGGCGACTCCGAGGGCCCCGAA---GCAGGA
Rhesus_macaque|25023         GAGGACGAGCCCCAGAAGCCCGAGGACAAGGGAGACCCCGAAGGCCCCGAA---GCA---
Gorilla_gorilla|11566        GAGGACGAGCCCCAGAAGCCCGAGGACAAGGGCGACCCCGAGGGCCCCGAA---GCAGGA
Homo_sapiens|31801           GAGGACGAGCCCCAGAAGCCCGAGGACAAGGGCGACCCCGAGGGCCCCGAA---GCAGGA
Pongo_abelii|10647           GAGGACGAGCCCCAGAAGCCCGAGGACAAGGGCGACCCCGAGGGCCCCGAA---GCAGGA
Pan_troglodytes|14422        GAGGACGAGCCCCAGAAGCCCGAGGACAAGGGCGACCCCGAGGGCCCCGAA---GCAGGA
Callithrix_jacchus|8217      GAGGACGAGCCCCAGAAACCCGAGGACAAGGGCGACCCCGAGGGCCCCGAA---GCAGGA
Equus_caballus|18306         GAGGACGAGCCCCAGAAGCCCGAGGACAAGGGCGACCCCGATGGT---------------
Bos_taurus|8576              GAGGATGAGCCCCAGAAGCCCGAAGACAAGGGCGACCCCGAGGGCCCCGAA---GCAGGA
Tupaia_belangeri|5563        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Echinops_telfairi|2347       NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                                                                         

Oryzias_latipes|15671        CGGTGTTCAGCGCTGGATTTTTCGAGCTTGGCTGAATGTCAGTTCTTTATTTCTGCTTTA
Tetraodon_nigroviridis|13767 AAACTTGTG---------------------------------------------------
Fugu_rubripes|10566          AAACTTCTG---------------------------------------------------
Macropus_eugenii|8397        GGCGAT------------------------------------------------------
Tarsius_syrichta|7137        NNNNNNNNN---------------------------------------------------
Xenopus_tropicalis|18231     CAAAAGAGG---------------------------------------------------
Danio_rerio|29182            AAACTCATC---------------------------------------------------
Gasterosteus_aculeatus|2476  CACAATTGTGTCCATGCACCCGATTCCATT------------------------------
Dipodomys_ordii|7378         GGAGTTGAG---------------------------------------------------
Pteropus_vampyrus|7450       GGAGCGGAA---------------------------------------------------
Erinaceus_europaeus|17385    NNNNNNNNN---------------------------------------------------
Gallus_gallus|3990           ------------------------------------------------------------
Procavia_capensis|3713       GGAGCTGAA---------------------------------------------------
Oryctolagus_cuniculus|16251  GGAGCAGAG---------------------------------------------------
Monodelphis_domestica|4284   GGA---GAG---------------------------------------------------
Ochotona_princeps|11968      GGAGCGGAG---------------------------------------------------
Microcebus_murinus|2476      NNNNNNNNN---------------------------------------------------
Rattus_norvegicus|16850      GGAACAGAG---------------------------------------------------
Mus_musculus|42416           GGAGCAGAG---------------------------------------------------
Cavia_porcellus|17746        GGAGCAGAG---------------------------------------------------
Otolemur_garnettii|4285      GGAACAGAA---------------------------------------------------
Canis_familiaris|9948        GGAGCGGAG---------------------------------------------------
Rhesus_macaque|25023         GGAGCTGAG---------------------------------------------------
Gorilla_gorilla|11566        GGAGCGGAG---------------------------------------------------
Homo_sapiens|31801           GGAGCTGAG---------------------------------------------------
Pongo_abelii|10647           GGAGCTGAG---------------------------------------------------
Pan_troglodytes|14422        GGAGCTGAG---------------------------------------------------
Callithrix_jacchus|8217      GGGGCTGAG---------------------------------------------------
Equus_caballus|18306         ------------------------------------------------------------
Bos_taurus|8576              GGAGCAGAG---------------------------------------------------
Tupaia_belangeri|5563        NNNNNNNNN---------------------------------------------------
Echinops_telfairi|2347       NNNNNNNNN---------------------------------------------------
                                                                                         

Oryzias_latipes|15671        GATCACAAACTGAACCCAGGGGACATAAGCTGCGATCGATTCAAAGAGGAGAGCCAC---
Tetraodon_nigroviridis|13767 ------------AACCCAGGGGACATGGGCTGCGACAGATTTAAGGAAGACACCCAC---
Fugu_rubripes|10566          ------------AACCCAGGGGACATGGGCTGTGACAGATTTAAGGAGGAGAACCAC---
Macropus_eugenii|8397        ------------CAGAAGGCGGCTCCTATATGCGAAAGGCTGGAGGGGCCTCACACCCCC
Tarsius_syrichta|7137        ------------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|18231     ------------AGCCCTAGTGCGGTGGATTTTGACAGGTTAGAAGGTGAAGTACGTCAG
Danio_rerio|29182            ------------AACCCAGGGGAAATACCATGCGACAGATTTAAAGACGAGACTCAT---
Gasterosteus_aculeatus|2476  ------------TCGCAATGCTGCTCACTTGCCTCGCGATTGCCCCAGCCCCCCCCCCCC
Dipodomys_ordii|7378         ------------GAGAAGGCGGCCGCAGGCTGCGAACGGCTGCAGGGGCCGCCCACCCCC
Pteropus_vampyrus|7450       ------------CCGAAGGCGGCTTCGGGCTGCGAGCGGCTGCAAGGGCCGCCCACTCCC
Erinaceus_europaeus|17385    ------------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Gallus_gallus|3990           ------------------------------------------------CCTCCCGCCGCC
Procavia_capensis|3713       ------------CAGAAGGTTTCTATCGGCTGC---CGGCTGCAGGGACCGCCCACCCCC
Oryctolagus_cuniculus|16251  ------------CAGAAGGCGGCTTCGGGCTGTGAGCGGCTGCAGGGGCCGCCCACCCCC
Monodelphis_domestica|4284   ------------CAGAAGGCAGCTCCTATTTGCGAAAGGCTTCAGGGGCCCCATACCCCC
Ochotona_princeps|11968      ------------CCAAAGGCGGGTTCGGGCTGCGAGCGGCTGCAGGGGCCGCCCACCCCC
Microcebus_murinus|2476      ------------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Rattus_norvegicus|16850      ------------CAGAAGGCGGCTGCGGGCTGCGAACGGCTGCAGGGGCCGCTCAGCCCC
Mus_musculus|42416           ------------CAGAAGGCGACTGCGGGCTGCGAACGGCTGCAGGGGCCGCTCAGCCCC
Cavia_porcellus|17746        ------------CAGAAGGCGGCTTCGGGCTGTGAAAGGCTGCAGGGGCCTCCCACTCCC
Otolemur_garnettii|4285      ------------CAGATGGCGGCTTCGGGCTGC---CGCCTGCAGGGGCCACCCACCCCC
Canis_familiaris|9948        ------------CAGAAGGCGGCTGCGGGCTGCGAACGGCTGCAGGGGCCGCCCACCCCC
Rhesus_macaque|25023         ------------CAGAAGGCGGCTTCGGGCTGCGAACGGCTTCAGGGACCACCCACCCCT
Gorilla_gorilla|11566        ------------CAGAAGGCGGCTTCGGGCTGCGAACGGCTTCAGGGACCACCCACCCCT
Homo_sapiens|31801           ------------CAGAAGGCGGCTTCGGGCTGCGAACGGCTTCAGGGACCACCCACCCCT
Pongo_abelii|10647           ------------CAGAAGGCGGCTTCGGGCTGCGAACGGCTTCAGGGACCACCCACCCCT
Pan_troglodytes|14422        ------------CAGAAGGCGGCTTCGGGCTGCGAACGGCTTCAGGGACCACCCACCCCT
Callithrix_jacchus|8217      ------------CAGAAGGCT---TCGGGCTGCGAACGGCTGCAGGGGCCACCTACCCCC
Equus_caballus|18306         ------------------------------------------------------------
Bos_taurus|8576              ------------CAAAAGGCGGTTTCGGGCTGCGAACGGCTGCAGGGGCCGCCCACCCCT
Tupaia_belangeri|5563        ------------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGCCGCCTACCCCC
Echinops_telfairi|2347       ------------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCG
                                                                                         

Oryzias_latipes|15671        ------------------------------------------GGAAAAGAGGTGGATCCT
Tetraodon_nigroviridis|13767 ------------------------------------------GGCAAAGACACGGACCCT
Fugu_rubripes|10566          ------------------------------------------GGCAAAGACACGGATCCT
Macropus_eugenii|8397        GCA---------------------------------------AGCAAAGAGGTCGAAGGA
Tarsius_syrichta|7137        NNN---------------------------------------NNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|18231     ------------------------------------------GGTAAGGAGCTGGACCAG
Danio_rerio|29182            ------------------------------------------TCTAAAGATCTTGATCCA
Gasterosteus_aculeatus|2476  CCCTCCAAAACCATATGTTACAGATTTAAAGAGGAGACCCATGGCAAAGACACGGATCCC
Dipodomys_ordii|7378         GCC---------------------------------------GGCAAGGAGACCGAAGGC
Pteropus_vampyrus|7450       GCC---------------------------------------GGCAAGGAGACCGAAGGC
Erinaceus_europaeus|17385    NNN---------------------------------------NNNNNNNNNNNNNNNNNN
Gallus_gallus|3990           GCC---------------------------------------------------------
Procavia_capensis|3713       GCC---------------------------------------GGCAAGGAGGCCGAGGGC
Oryctolagus_cuniculus|16251  GCC---------------------------------------GGCAAGGAGACCGAGGGC
Monodelphis_domestica|4284   GCA---------------------------------------AGCAAGGAAGCAGAAGGC
Ochotona_princeps|11968      GCC---------------------------------------GGCAAGGAGACCGAGGGC
Microcebus_murinus|2476      NNN---------------------------------------NNNNNNNNNNNNNNNNNN
Rattus_norvegicus|16850      GCC---------------------------------------GGCAAGGAAACTGAAGGC
Mus_musculus|42416           GCC---------------------------------------GGCAAGGAGACCGAAGGC
Cavia_porcellus|17746        GCC---------------------------------------GGCAAGGAGACTGAAGGC
Otolemur_garnettii|4285      GCC---------------------------------------GGGAAAGAGACTGAGTGC
Canis_familiaris|9948        GCC---------------------------------------GGCAAGGAGACGGAGGGC
Rhesus_macaque|25023         GCC---------------------------------------AGCAAGGAGACCGAGGGC
Gorilla_gorilla|11566        GCA---------------------------------------GGCAAGGAGACGGAGGGC
Homo_sapiens|31801           GCA---------------------------------------GGCAAGGAGACGGAGGGC
Pongo_abelii|10647           GCA---------------------------------------GGCAAGGAGACGGAGGGC
Pan_troglodytes|14422        GCA---------------------------------------GGCAAGGAGACGGAGGGC
Callithrix_jacchus|8217      GCC---------------------------------------GGCAAGGAGACGGAGGGC
Equus_caballus|18306         ------------------------------------------------------------
Bos_taurus|8576              GCC---------------------------------------GGCAAGGAGACCGAGGGC
Tupaia_belangeri|5563        GCC---------------------------------------GGCAAGGAAACCGAGGGC
Echinops_telfairi|2347       GCA---------------------------------------GCCAGGACGACGGAGGGC
                                                                                         

Oryzias_latipes|15671        CTTCTGAGCGACTCGGAGTTAAAGGAGCAG---GAGGAGCGGACTACAGAGCTGCTG---
Tetraodon_nigroviridis|13767 CTCCTCAGCGACTCCGAGTTCAAGGAACAG---GAAGAGCGGACTACAGAGCTGCTG---
Fugu_rubripes|10566          CTCCTCAGCGATTCCGACCTAAAGGAACAG---GAAGAACGGACTACAGAACTGCTG---
Macropus_eugenii|8397        AACCTGAGCGACTCGGATTTTAAAGAGTCC---CACGAGGGTCGGCTGGACGCTCTC---
Tarsius_syrichta|7137        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---
Xenopus_tropicalis|18231     ACAAGGAGCGATTCTGAACAGAACGAA------GTAGAGGAAAGAAATGATCTTCTGTCC
Danio_rerio|29182            CCTTTGACAGACTCGGAATTAAAAGAA------GCAGAGGAGCGGACGGATTTGCTC---
Gasterosteus_aculeatus|2476  CTTCTGAGCGACTCGGAGTTAAAAGACCCG---GAGGAGCGGACTACAGAGTTGCTG---
Dipodomys_ordii|7378         AGCCTCAGCGACTCGGATTTTAAAGAGGTGCCTTCCGAGGGGCGTCACGATGCGCAG---
Pteropus_vampyrus|7450       AGCCTCAGCGACTCCGATTTTAAGGAGCCGCCATCCGAGGGCCGTCTCGACGCGCTG---
Erinaceus_europaeus|17385    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---
Gallus_gallus|3990           ------------------------------------------------------------
Procavia_capensis|3713       GGCCTCAGCGACTCGGATTTTAAGGCGCCCACCTCCGAGGGCCGTCCTGACGTGCTG---
Oryctolagus_cuniculus|16251  AGCCTCAGCGACTCGGATTTTAAGGAGCAGCCCTGCGAGGGCCGCCACGACACCCTg---
Monodelphis_domestica|4284   AATCTGAGCGACTCGGATTTTAAAGAGTCC---CACGAGGGCCGGCTGGACGCTCTC---
Ochotona_princeps|11968      AGCCTCAGCGACTCGGATTTTAAGGAGCTGCCCTCTGAGGGCCGCCACGACACCCTA---
Microcebus_murinus|2476      NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---
Rattus_norvegicus|16850      AGCCTCAGCGACTCGGATTTTAAAGAGTCGCCCTCCGAAGGCCGCCACGATGACCTG---
Mus_musculus|42416           AGCCTCAGCGACTCGGATTTTAAGGAGTCGTCCTCCGAAGGCCGCCACGATGAGCTG---
Cavia_porcellus|17746        AGCCTCAGCGACTCCGATTTTAAGGAGCCGCCTTCGGAGGGCCGCCAAGACCCGCTG---
Otolemur_garnettii|4285      AGTCTCAGCGACATGTATTTTAAAGAGTCGCGCTCGGAGGTCCGCCCAAACGCTATT---
Canis_familiaris|9948        AGCCTCAGCGACTCGGATTTTAAGGAGCCGCCATCCGAGGGCCGTCTGGACGCGCTG---
Rhesus_macaque|25023         AGCCTCAGCGACTCGGATTTTAAGGAGCCGCCCTCGGAGGGCCGCCTCGACGCGTTG---
Gorilla_gorilla|11566        AGCCTCAGCGACTCGGATTTTAAGGAGCCGCCCTCGGAGGGCCGNNTCGACGCGCTG---
Homo_sapiens|31801           AGCCTCAGCGACTCGGATTTTAAGGAGCCGCCCTCGGAGGGCCGCCTCGACGCGCTG---
Pongo_abelii|10647           AGCCTCAGCGACTCGGATTTTAAGGAGCCGCCCTCGGAGGGCCGCCTCGAAGCGCTG---
Pan_troglodytes|14422        AGCCTCAGCGACTCGGATTTTAAGGAGCCGCCCTCGGAGGGCCGCCTCGACGCGCTG---
Callithrix_jacchus|8217      AGCCTCAGCGACTCGGATTTTAATGAGCAGCCCTCCGAAGCC---CTCGACGCGCTG---
Equus_caballus|18306         ------------------------------------------------------------
Bos_taurus|8576              AGCCTCAGCGACTCGGATTTTAAGGAGCCGCCATCCGAGGGCCGCCTCGACGCGCTg---
Tupaia_belangeri|5563        AGCCTCTGCGACTCAGATTTTAAGGAGCCGCCCTCGGAGGGCCGCCTCGACGCGCTG---
Echinops_telfairi|2347       AGCGTCAGAGACTCTGATTTTAAGATGCCCTCTTCAGAGAGCCATCTCGACACGCTG---
                                                                                         

Oryzias_latipes|15671        ------CCGGATGCCGCAAAACCGACCACTTCGTCTCCCTCGGCGGTG------------
Tetraodon_nigroviridis|13767 ------CCGGATTCCGCCAAAgccaccacctcctctcctcccgcgGTG------------
Fugu_rubripes|10566          ------CCGGATTCCGCCAAACCCACCACCTCGTCTCCCTCCGCGGTG------------
Macropus_eugenii|8397        ------CCAGGGGGTCCCAGAGCTGGCGGCCCTTCTCCCTCCGGCCCG---GTTGCAAGG
Tarsius_syrichta|7137        ------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|18231     AAAAACTCTGCTCCCCCCACCTCACCCCTGTGCCCTCCAGATCAGTCCCCGCAGGCCCAA
Danio_rerio|29182            ------GCCGAGCAAGCGAAACCCACCACATCCTCTCCCTCCGTTCTACAGAGAGGGAGT
Gasterosteus_aculeatus|2476  ------CCGGATTCCGCGAAACCGACCACGTCGTCTCCCTCGGCGCTG------------
Dipodomys_ordii|7378         ------CCCGGGGCCCCTCGCGCCGGCGGGCCCTCCCCAGCTGGGCCAGCGGCGGCGCGG
Pteropus_vampyrus|7450       ------CCCGGGCCCCCGCGTGCCAGCGGGCCCTCCCCGGTGGGGCCGGCCGTGGCGCGG
Erinaceus_europaeus|17385    ------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Gallus_gallus|3990           ------------------------------------------------------------
Procavia_capensis|3713       ------CCAGGGCCCCCGCGCCCCGGCGGATCCTCCCCAGCCGGGCCAGCTGCGGCGCGG
Oryctolagus_cuniculus|16251  ------cccgggcccccccgcgtcggcgggccctccccggctgggccggcggccgcgcgg
Monodelphis_domestica|4284   ------CCAGGGGGTCCCAGGGCTGGTGGCCCTTCTCCCACTGGCCAG---GTTGCAAGG
Ochotona_princeps|11968      ------CCCGTGCCACCCCGCGTCGGTGGGCCCTCTCCAGCCGGTCCCACGGCGGCGCGG
Microcebus_murinus|2476      ------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Rattus_norvegicus|16850      ------CCCAGGCCCCCGCGTGCAGGCGAGCCCTCCCCGGCTGGGCCCGCAACTGCGCGT
Mus_musculus|42416           ------CCCAGGCCCCCGCGCGCGGGCGAGTCCTCCCCGGCTGGGCCCGCAACCGCTCGT
Cavia_porcellus|17746        ------CCCGGGCCCCCTCGAGCCGGGGTGCCCTCCCCGGTCGGGCCTGCGGCGGCGCGG
Otolemur_garnettii|4285      ------TGCGGACCCCGCCGATTGTGGGAGTCCTCCCCGTATGGGCCAGGGAAGGCGCGG
Canis_familiaris|9948        ------CCCGGGCCCCCCCGCGCCGGCGGGCCCTCCCCGGCCGGGCCGGCGGCAGCGCGG
Rhesus_macaque|25023         ------CAgggcgccccccgcaccggcgggccctccccggctgggccagcggcggcgcgg
Gorilla_gorilla|11566        ------CAGGGCCCCCCCCGCACCGGCGGGCCCTCCCCAGCTGGGCCAGCGGCGGCGCGG
Homo_sapiens|31801           ------CAgggccccccccgcaccggcgggccctccccggctgggccagcggcggcgcgg
Pongo_abelii|10647           ------CAgggccccccccgcaccggcgggccctccccggctgggccagcggcggcgcgg
Pan_troglodytes|14422        ------CAgggccccccccgcaccggcgggccctccccggctgggccagcggcggcgcgg
Callithrix_jacchus|8217      ------CAG---CCCCCCCGCACCGGCGGGCCCTCCCCGGCTGGGCCAGCGGCAGCGCGG
Equus_caballus|18306         ------------------------------------------------------------
Bos_taurus|8576              ------cccgggcccccccgcgccggcgggctctccccggccgggcccgcggcagcgcgg
Tupaia_belangeri|5563        ------CCGGGCCCCCCCCGCGCGGGCGGGCCCTCCCCAGCTGGGCCAGCTGCGGCGCGG
Echinops_telfairi|2347       ------CCCGGGCTCCCCAGAGCTGGCGGATCCTCCCCAGCCAGGCCAGCGGCGGCGCGG
                                                                                         

Oryzias_latipes|15671        ---------------------------------------CCCCGGGGGAACCCAACGCCA
Tetraodon_nigroviridis|13767 ---------------------------------------CCCCGTGGGAACCAGGCTGTT
Fugu_rubripes|10566          ---------------------------------------CCCCGTGGGAACCAGGCCGTT
Macropus_eugenii|8397        TTGGGCGAGGAGTCCTCG---------CCACACTAT---CCCCCGGGAGCTCCAGCCCCA
Tarsius_syrichta|7137        NNNNNNNNNNNNNNNNNN---------NNNNNNNNN---NNNNNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|18231     GAAGATCAGAACTTGCATCGTCACACTGTTCACAACCACCACCACCAGTCAATCCAGCAA
Danio_rerio|29182            GATCTCATTACG---------------------------CAAGAAAAGCCCTCAGAACCG
Gasterosteus_aculeatus|2476  ---------------------------CCCCGAGGG---AACCAGGCCGCCGCCGCGCAG
Dipodomys_ordii|7378         CTGGCGGACGACCCAGCC---------TCTCACTAC---CCCACGGGCGCTCCGGGGCCC
Pteropus_vampyrus|7450       CTGGCCGACGACCCGGGC---------CCTCACTAC---CCCGCGGGCGCGCCGGCTCCG
Erinaceus_europaeus|17385    NNNNNNNNNNNNNNNNNN---------------------NNNNNNNNNNNNNNNNNNNNN
Gallus_gallus|3990           ------------------------------------------------------------
Procavia_capensis|3713       CTGGCCGAGGACCCGGTC---------CCTCACTAC---CCCTCTGGGGCTCCGGCGCCG
Oryctolagus_cuniculus|16251  ctggcggaggacccggcc---------cctcactac---ccggcgggcgcgccggcaccc
Monodelphis_domestica|4284   CTGGGCGAGGAGCCTTCA---------CCACACTACCATCCCCCAGGAGCTTCAGCCCCA
Ochotona_princeps|11968      CTGGCGGAGGACCCCGCNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|2476      NNNNNNNNNNNNNNNNNN---------NNNNNNNNN---NNNNNNNNNNNNNNNNNNNNN
Rattus_norvegicus|16850      CTGGCGGAGGATGCGGGT---------CCTCACTAC---CCTGCGGGTGCGCCGGCGCCC
Mus_musculus|42416           CTGGCGGAAGACGCGGGT---------CCTCACTAC---CCCGCGAGTGTGCCGGCTCCC
Cavia_porcellus|17746        CTCACGGAGGACCCGGCC---------CCTCACTAT---CCCGCGGGTGCGCCGCCACCC
Otolemur_garnettii|4285      NNNNNNNNNNNNNNNNNN---------NNNNNNNNN---NNNNNNNNNNNNNNNNNNNNN
Canis_familiaris|9948        CTGGCCGAGGACCCGGCC---------CCTCACTAC---CCCTCGGGCGCGCCGGCTCCG
Rhesus_macaque|25023         ctggcggaggacccggcc---------cctcactac---cccgcgggcgcgccggcgccg
Gorilla_gorilla|11566        CTGGCGGAGGACCCGGCC---------CCTCACTAC---CCCGCCGGAGCGCCGGCGCCC
Homo_sapiens|31801           cTGGCGGAGGACCCGGCC---------CCTCACTAc---cccgccggagcgccggcgccc
Pongo_abelii|10647           cTGGCGGAGGACCCGGCC---------CCTCACTAc---cccgccggagcgccggcgccc
Pan_troglodytes|14422        cTGGCGGAGGACCCGGCC---------CCTCACTAc---cccgccggagcgccggcgccc
Callithrix_jacchus|8217      CTGGCAGAGGACCCGGCC---------CCTCACTAC---CCTACGGGCGCGCCGGCATCC
Equus_caballus|18306         ------------------------------------------------------------
Bos_taurus|8576              cTGGCCGAGGACCCAGCC---------CCTCATTAC---CCCTCCGGCGCGCCGGCTCCG
Tupaia_belangeri|5563        CTGGCGGACGACTCAGCC---------CCTCACTAC---CCCGCAGGCACACCGGCGCCC
Echinops_telfairi|2347       CTAGCTGAGGACCCGGTC---------GCTCACTAC---CCCTCGGGCTTGCCTGCGCCC
                                                                                         

Oryzias_latipes|15671        CAAGACAAGCCGTCAGATTTGAGCCACGCG------------------------------
Tetraodon_nigroviridis|13767 GCGCAACAAGACAAGCCGTCAGATTTGAGTCACGCG------------------------
Fugu_rubripes|10566          GCGCAACAAGACAAGCAGTCCGATTTGAGTCACGCA------------------------
Macropus_eugenii|8397        CAC---------GCAGCTGGAGAGTTGCCC------------------------------
Tarsius_syrichta|7137        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------------------------
Xenopus_tropicalis|18231     CTACATCACCACAGTCACCAGTCTCATCCATTAGACCTGGTGCATAGGAACGCTCTTGTC
Danio_rerio|29182            GGCCACGCCGCGAGCACGGGAAAC------------------------------------
Gasterosteus_aculeatus|2476  CAAGACAAGCCGTCAGATTTGAGCCTGGCG------------------------------
Dipodomys_ordii|7378         GGTGCGCACCCGTCCTCGGGAGAGCTGCCC------------------------------
Pteropus_vampyrus|7450       GGCCCGCACCCAGCCGCGGGAGAGCTGCCC------------------------------
Erinaceus_europaeus|17385    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------------------------
Gallus_gallus|3990           ------------------------------------------------------------
Procavia_capensis|3713       GGGCCGCACCCAGCCGCGGGGGAGTTGCCC------------------------------
Oryctolagus_cuniculus|16251  ggcccgcacccggccgcgggAGAGTTGCCC------------------------------
Monodelphis_domestica|4284   CACCCA---------GCCGGAGAGTTGCCC------------------------------
Ochotona_princeps|11968      NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------------------------
Microcebus_murinus|2476      NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------------------------
Rattus_norvegicus|16850      GGCCCGCACCCATCAGCCGGAGAGTTGCCC------------------------------
Mus_musculus|42416           GGCCCGCACCCATCAGCCGGAGAGCTGCCC------------------------------
Cavia_porcellus|17746        GGCCCGCACCCCTCTGCGGGAGAGCTGCCC------------------------------
Otolemur_garnettii|4285      NNNNNNNNNNNNNNNNNNNNNNNNNTGCCC------------------------------
Canis_familiaris|9948        GGCCCGCACCCAGCCGCGGGCGAGCTGCCC------------------------------
Rhesus_macaque|25023         ggcccgcATCCAGCCGCGGGAGAGCTGCCC------------------------------
Gorilla_gorilla|11566        GGCCCGCATCCAGCCGCGGGAGAGCTGCCC------------------------------
Homo_sapiens|31801           ggcccgcATCCAGCCGCGGGCGAGGTGCCT------------------------------
Pongo_abelii|10647           ggcccgcATCCAGCCGCGGGAGAGCTGCCC------------------------------
Pan_troglodytes|14422        ggcccgcATCCAGCCGCGGGAGAGCTGCCC------------------------------
Callithrix_jacchus|8217      GGCCCGCATCCTGCCGCGGGAGAGCTGCCC------------------------------
Equus_caballus|18306         ------------------------------------------------------------
Bos_taurus|8576              GGCCCGCACCCAGCCGCGGGAGAGCTGCCC------------------------------
Tupaia_belangeri|5563        GGTCCGCACCCAGCCCCGGGAGAGCTGCCC------------------------------
Echinops_telfairi|2347       CGC---CACTCGACCACTGGAGAATTGCCC------------------------------
                                                                                         

Oryzias_latipes|15671        ---GCGAGCACGGTGACCGGCAACGTCACCTCTGTCATCCACTCG---------CCCCCC
Tetraodon_nigroviridis|13767 ---CCGAGCACAGTGACCAGCAACGTCACCTCCGTTATCCACTCG---------CCTCCT
Fugu_rubripes|10566          ---GCGACCACGGTGACCAGCAACGTCACTTCTGTCATCCATTCG---------CCCCCT
Macropus_eugenii|8397        ---TCTGGC---------CCCAGCGGGCCCTCGGTTATTCACTCG---------------
Tarsius_syrichta|7137        ---NNNNNN---------NNNNNNNNNNNNNNNNNNNNNNNNNNN---------NNNNNN
Xenopus_tropicalis|18231     CAACATGGCCCAGTCACCAACAATGCCACCTCAGTTATCCACTCC---------------
Danio_rerio|29182            ------------------AGCAACGTAACGTCTGTTATTCATTCT---------CCCCCC
Gasterosteus_aculeatus|2476  ---ACGGGCTCGGTGACCAGCAACGCGACCTCTGTTATCCACTCG---------CCCCCC
Dipodomys_ordii|7378         ---CCAGGC---------CCCGGCGGACCCTCGGTCATCCACTCG---------CCGCCT
Pteropus_vampyrus|7450       ---CCCGGT---------CCCGGCGGGCCCTCGGTCATACACTCG---------CCACCG
Erinaceus_europaeus|17385    ---NNNNNN---------NNNNNNNNNNNNNNNNNNNNNNNNNNN---------NNNNNN
Gallus_gallus|3990           ------------------------------TCCGTCATCCACTCG---------------
Procavia_capensis|3713       ---TCTGGC---------CTCGGCGGGCCCTCGGTCATCCACTCA---------CCGCCG
Oryctolagus_cuniculus|16251  ---CCGGGT---------CCCGGCGGGCCCTCGGTCATCCACTcgccgccgccgccaccg
Monodelphis_domestica|4284   ---TCCGGC---------CCCAGCGGGCCCTCGGTTATTCATTCT---------------
Ochotona_princeps|11968      ---NNNNNN---------NNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNN
Microcebus_murinus|2476      ---NNNNNN---------NNNNNNNNNNNNNNNNNNNNNNNNNNN---------NNNNNN
Rattus_norvegicus|16850      ---CCCGGC---------TCGGGCGGATCCTCGGTCATCCACTCA---CCACCGCCACCT
Mus_musculus|42416           ---CCCGGC---------TCGGGCGGATCCTCGGTCATCCACTCG---CCACCGCCACCT
Cavia_porcellus|17746        ---CCCGGT---------CCCGGCGGGCCCTCGGTCATCCACTCG---------CCGCCA
Otolemur_garnettii|4285      ---CCCGGT---------CCC---GGCCCCTCGGTTATCCACTCG---------CCGCCG
Canis_familiaris|9948        ---CCCGGT---------CCCGGCGGGCCCTCGGTCATACACTCT---------CCGCCA
Rhesus_macaque|25023         ---CCGGGT---------CCCGGCGGGCCCTCGGTTATCCATTCG---------CCGCCT
Gorilla_gorilla|11566        ---CCGGGT---------CCCGGCGGGCCCTCGGTTATCCATTCG---------CCGCCT
Homo_sapiens|31801           ---CCGGGT---------CCCGGCGGGCCCTCGGTTATCCATTCG---------CCGCCT
Pongo_abelii|10647           ---CCGGGT---------CCCGGCGGGCCCTCGGTTATCCATTCG---------CCGCCT
Pan_troglodytes|14422        ---CCGGGT---------CCCGGCGGGCCCTCGGTTATCCATTCG---------CCGCCT
Callithrix_jacchus|8217      ---CCGGGT---------CCCGGCGGGCCCTCGGTTATCCATTCA---------CCGCCT
Equus_caballus|18306         ------------------------------------------------------------
Bos_taurus|8576              ---CCCGGT---------CCCGGAGGGCCCTCGGTCATACACTCG---------CCGCCA
Tupaia_belangeri|5563        ---CCGGGG---------CCCTGCGGGCCCTCGGTCATCCACTCT---------CCGCCG
Echinops_telfairi|2347       ---CCCGGC---------CAAGGCGGGCCCTCTGTCATCCACTCG---------CCGCCG
                                                                                         

Oryzias_latipes|15671        TCGGCTCCC------------------AAACCCAAACTGTGGTCCCTTGCGGAGATCGCC
Tetraodon_nigroviridis|13767 TCGGCCCCC------------------AAACCCAAACTGTGGTCCCTGGCCGAGATCGCC
Fugu_rubripes|10566          TCGGCACCT------------------AAACCTAAACTGTGGTCCCTGGCGGAGATCGCC
Macropus_eugenii|8397        ------CCGCCGCAGGCAGTACTAGCCAAGCCCAAATTGTGGTCATTAGCTGAGATTGCC
Tarsius_syrichta|7137        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|18231     ---------CCACCAGCTTCCACCTCAAAGCCTAAACTCTGGTCACTGGCAGAGATAGCA
Danio_rerio|29182            TCGGCGCCC------------------AAACCCAAACTCTGGTCTCTGGCCGAGATCGCC
Gasterosteus_aculeatus|2476  TCGGCCCCG------------------AAACCAAAACTCTGGTCCCTGGCGGAGATCGCC
Dipodomys_ordii|7378         CCACCGCCGCAGCCAGTGGTGCTTGCCAAGCCCAAACTGTGGTCTCTGGCAGAGATCGCC
Pteropus_vampyrus|7450       CCGCCGCCGCCGCAGGCGGTTCTCGCCAAGCCCAAACTGTGGTCTCTGGCAGAGATCGCC
Erinaceus_europaeus|17385    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Gallus_gallus|3990           ------CCGCAGCAGGCGGCCCTCGCCAAGCCCAAGCTCTGGTCGCTGGCCGAGATCGCC
Procavia_capensis|3713       CCGCCGCCGCCACAGGCAGTGCTCACGAAGCCCAAACTATGGTCTCTGGCAGAGATCGCC
Oryctolagus_cuniculus|16251  ccgccgccgccgcccgccgTGCTCGCCAAGCCCAAACTGTGGTCTCTGGCCGAGATCGCC
Monodelphis_domestica|4284   ------CCGCCACAGGCGGTACTAGCCAAGCCCAAACTGTGGTCATTAGCAGAGATAGCC
Ochotona_princeps|11968      NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|2476      NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Rattus_norvegicus|16850      CCGCCACCGCCTCCGGCCGTGCTAGCCAAGCCCAAACTGTGGTCTCTGGCAGAGATAGCC
Mus_musculus|42416           CCGCCACCGCCTCCGGCCGTGCTAGCCAAGCCCAAACTGTGGTCTCTGGCCGAGATCGCC
Cavia_porcellus|17746        CCGCCTCCGCCGCCGGCGGTGCTCGCCAAGCCCAAACTGTGGTCTCTGGCCGAGATCGCC
Otolemur_garnettii|4285      CCACCGCCACCGGCAGCGGTGCTCGCCAAGCCCAAATTGTGGTCTCTGGCGGAGATCGCC
Canis_familiaris|9948        CCGCCGCCGCCACAGGCGGTGCTCGCCAAGCCCAAACTGTGGTCTCTGGCAGAGATCGCC
Rhesus_macaque|25023         CCGCCGCCGCCTCCGGCGGTGCTCGCCAAGCCCAAATTGTGGTCTCTGGCAGAGATCGCC
Gorilla_gorilla|11566        CCGCCGCCGCCTCCTGCGGTGCTCGCCAAGCCCAAACTGTGGTCTTTGGCAGAGATCGCC
Homo_sapiens|31801           CCGCCGCCGCCTCCTGCGGTGCTCGCCAAGCCCAAACTGTGGTCTTTGGCAGAGATCGCC
Pongo_abelii|10647           CCGCCGCCGCCTCCTGCGGTGCTCGCCAAGCCCAAACTGTGGTCTTTGGCAGAGATCGCC
Pan_troglodytes|14422        CCGCCGCCGCCTCCTGCGGTGCTCGCCAAGCCCAAACTGTGGTCTTTGGCAGAGATCGCC
Callithrix_jacchus|8217      CCGCCGCCGCCTCCGGCAGTGCTCGCCAAGCCCAAACTGTGGTCTCTGGCAGAGATCGCC
Equus_caballus|18306         ------------------------------------------------------------
Bos_taurus|8576              CCGCCGCCGCCGCAGGCGGTGCTCGCCAAGCCCAAACTGTGGTCTCTGGCGGAGATCGCC
Tupaia_belangeri|5563        CCACCGCCGCCGCCTGCGGTGCTTGTCAAGCCCAAACTGTGGTCTCTGGCAGAGATCGCC
Echinops_telfairi|2347       CCGCCGCCGCCGCAAGCGGTGCTCACCAAGCCCAAACTGTGGTCTCTGGCAGAGATCGCC
                                                                                         

Oryzias_latipes|15671        ACGTCCTCAGACAGGTGTAAAGGCAGCGGCGACGCGCCG---------------CCGCCG
Tetraodon_nigroviridis|13767 ACGTCCTCGGACAGGTGTAAGAGCAGCAGCGACGCGTCG---------------CCGTCC
Fugu_rubripes|10566          ACGTCCTCAGACAGGTGTAAGAGCAGCAGCGACGCGTCACAGTCC---------------
Macropus_eugenii|8397        ACCTCTTCAGACAAGTCCAAGGAAGGCGGCGGCGGAGGTGGTGAGGGCCCT---CCCCCA
Tarsius_syrichta|7137        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|18231     ACTTCTTCGGACAAAGTCAAAGAAAGCAGCGATGCTGCTGCA------------------
Danio_rerio|29182            ACTTCTTCGGACAGGTGCAAAGGGAGCAGTGAGGCTTCACAGGCCGCG------------
Gasterosteus_aculeatus|2476  ACCTCCACAGACAGGTGTAAGATCGCGGCGATGGGCACCAACGCGTCT------------
Dipodomys_ordii|7378         ACATCCTCGGACAAGGTCAAGGACGGGGGCGGCGGGAACGAGGGTTCTCCATGCCCACCG
Pteropus_vampyrus|7450       ACATCCTCGGACAAGGTCAAGGACGGGGGCGGCGGGAGCGAGGGCTCTCCATGCCCACCG
Erinaceus_europaeus|17385    NNNNNNNNNNACAAAGTCAAGGATGGGGGCAGTAAAGACGTGGGCTCTCCGGGTCCGCCG
Gallus_gallus|3990           ACCTCGGCGGACAGGGCGAGGGAG---GCGGGCGGCGAAACGGCGGCCCCCGGCCCCGCC
Procavia_capensis|3713       ACATCTTCGGACAAGGTCAAGGACGGGGGCGGCGGGAACGAGGGCTCCCCGTGCCCTCCA
Oryctolagus_cuniculus|16251  ACATCCTCGGACAAGGTCAAGGAcgggggcggcgggggcgagggctcgccgtgcccgccg
Monodelphis_domestica|4284   ACCTCTTCGGACAAGTCCAAGGAAGGCGGCGGCGGAGGCGGTGAGGGCCCT---CCCCCA
Ochotona_princeps|11968      NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGCCACCG
Microcebus_murinus|2476      NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Rattus_norvegicus|16850      ACATCCTCGGACAAGGTCAAGGACGGGGGCGGAGGGAGCGAGGGCTCTCCGTGCCCACCG
Mus_musculus|42416           ACATCCTCGGACAAGGTCAAGGACGGGGGCGGAGGGAGCGAGGGCTCTCCATGCCCACCG
Cavia_porcellus|17746        ACATCCTCGGACAAAGTCAAGGACGGGGGCGGCGGG---GAGGGATCGCCGTGCCCGCCG
Otolemur_garnettii|4285      ACATCCTCGGACAAGGTCAAGGAC---GGGGGCGGGAGCGAGGGCTCTCCGTGCCCACCG
Canis_familiaris|9948        ACATCCTCGGACAAGGTCAAGGACGGGGGCGGCGGGAGCGAAGGCTCTCCCTGCCCACCG
Rhesus_macaque|25023         ACATCCTCGGACAAGGTCAAGGACGGGGGTGGCGGGAGCGAGGGCTCTCCATGCCCACCG
Gorilla_gorilla|11566        ACATCGTCGGACAAGGTCAAGGACGGGGGCGGCGGGAGCGAGGGCTCTGCATGCCCACCG
Homo_sapiens|31801           ACATCGTCGGACAAGGTCAAGGACGGGGGCGGCGGGAACGAGGGCTCTCCATGCCCACCG
Pongo_abelii|10647           ACATCCTCGGACAAGGTCAAGGACGGGGGCGGCGGGAGCGAGGGCTCTCCATGCCCACCG
Pan_troglodytes|14422        ACATCGTCGGACAAGGTCAAGGACGGGGGCGGCGGGAGCGAGGGCTCTCCATGCCCACCG
Callithrix_jacchus|8217      ACATCCTCGGACAAGGTCAAGGACGGGGGCGGCGGGAGCGAAGGCTCTCCATGCCCACCG
Equus_caballus|18306         ------------------------------------------------------------
Bos_taurus|8576              ACATCCTCGGACAAGGTCAAGGACGGGGGCGGCGGGAACGAGGGCTCTCCGTGCCCACCG
Tupaia_belangeri|5563        ACATCCTCGGACAAGGTCAAGGACGGGGGCGCAGGGAGCGAGGGCTCTCCGTGCCCACCG
Echinops_telfairi|2347       ACATCCTCGGACAAGGTCAAGGACGGGGTCGGAGGGAGCGAGGGCTCTCCGTGCCCTCCG
                                                                                         

Oryzias_latipes|15671        TGTCCCGGTTTGCCTCAGAGCGCAGTGATGGGCACCAGCGCGTCA---------------
Tetraodon_nigroviridis|13767 TGCCCCGGGTTGCCCCAGAGCGCAGTCATGGGCACCAACCCGTCT---------------
Fugu_rubripes|10566          TGCCCCGGTTTGCCTCAGAGCGCAGTCATGGGCTCCAACCCGTCT---------------
Macropus_eugenii|8397        GGGCAAGGGCCCACAGCCGGGCAAACTCTGGCTGGCAGCCGGTCGTCTCCCTCT------
Tarsius_syrichta|7137        NNNCCTGGGCCCATGGCCGGCCAAGCCCTGGGAGGCAGCCGCGCCTCACCGGCCCCGGCG
Xenopus_tropicalis|18231     ------------GTTGCAGGGACCACTCCAGCCCAGTCTATGGTTGTTAGTGCCTCTTCT
Danio_rerio|29182            ------------------------GGTCTGAGTCAAAGCACAGTCATTGCCAGCGCTGCC
Gasterosteus_aculeatus|2476  ------------------------------------------------------------
Dipodomys_ordii|7378         TGCCCGGGGCCCGTAGCCGGGCAAGTCCTAGGAGGCAGCCGCGCGTCGCCATCCCCGGCG
Pteropus_vampyrus|7450       TGCCCCGGGCCCGTATCGGGGCAAGCTCTAGGAGGCAGCCGCGCGTCGCCGGCCCCGGCA
Erinaceus_europaeus|17385    TGCCCCGGGCCGGTGGCC---CAGGCTCTAGGAGGCAGCCGCGCGTCTCCAGCCCCGGCG
Gallus_gallus|3990           GTGCTGGGA---------------------GGCGGCGGCCCCCCGCGCCCCTCTCCGCCG
Procavia_capensis|3713       TGTCCGGGGCCGGTAGCTGGGCAAGCCCTAGGAGGCAGTCGCGCGTCGCCAGCCCCAGCG
Oryctolagus_cuniculus|16251  tggcccgggcccgTAGCCGGGCAAGGCCTGGGAGGCAGCCGCGCATcgccggccccggcg
Monodelphis_domestica|4284   GGGCAAGGGCCCACTGCCGGGCAAACCCTGCCTGGCAGCCGCTCGTCT------CCCACC
Ochotona_princeps|11968      TGCCCCGGGCCGGTAGGCGGGCCAGCCCTGGCGTGCAGCCGTGCGTCACCGGCCCCAACA
Microcebus_murinus|2476      NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Rattus_norvegicus|16850      TGCCCCGGGCCCATAGGCGGGCAAACCCTTGGAGGCAGCCGCGCTTCTCCTGCTCCGGCG
Mus_musculus|42416           TGCCCAGGGCCCATGGGCGGGCAAACGCTTGGAGGCAGCCGCGCGTCTCCTGCCCCAGCG
Cavia_porcellus|17746        TGCCCCGGCCCC---GCGGGGCAAGCGCTGGGAGGGAGTCGCGCGTCGCCCGCCCCGGCG
Otolemur_garnettii|4285      TGTGCCGGGCCCATAGCCGGTCAAGCCCTAGGAGGTAGCCGTGCGTCGCCGGCCCCAGCG
Canis_familiaris|9948        TGCCCCGGGCCGGTGGCGGGGCAGGCCCTGGGAGGCAGCCGCGCATCGCCGGCCCCGGCG
Rhesus_macaque|25023         TGTCCCGGGCCCATAGCTGGGCAAGCCCTAGGAGGCAGCCGTGCGTCGCCGACCCCGGCG
Gorilla_gorilla|11566        TGTCCCGGGCCCATCGCCGGGCAAGCCCTAGGAGGCAGCCGTGCGTCGCCGGCCCCGGCG
Homo_sapiens|31801           TGTCCCGGGCCCATAGCCGGGCAAGCCCTAGGAGGCAGCCGGGCGTCGCCGGCCCCGGCG
Pongo_abelii|10647           TGTCCCGGGCCCATAGCCGGGCAAGCCCTAGGAGGCAGCCGTGCGTCGCCGGCCCCGGCG
Pan_troglodytes|14422        TGTCCCGGGCCCATAGCCGGGCAAGCCCTAGGAGGCAGCCGTGCGTCGCCGGCCCCGGCG
Callithrix_jacchus|8217      TGCTCCGGGCCCATAGCTGGGCAAGCCCTAGGAGGGAGCCGTGCGTCGCCGGCCCCGGCG
Equus_caballus|18306         ------------------------------------------------------------
Bos_taurus|8576              TGCCCCGGGCCCGTAGCCGGGCAAGCCCTAGGAGGCAGCCGCGCGTCGCCAGCCCCGGCG
Tupaia_belangeri|5563        TGCCCCGGGCCTGTAGCCGGGCAAGCCCTAGGAGGCAGCCGCGCGTCGCCGGCCCCGGCG
Echinops_telfairi|2347       TGTCCCGGGCCTGTAGCAGGGCAAGCCCTGGTAGGCAGTCGAGCGTCGCCGGCCCCAGCA
                                                                                         

Oryzias_latipes|15671        ---CCTTCCCGGTCC---TCCCCCCAGTGCCCTCTTCCCAACAGCACGGTCCTATCCAGG
Tetraodon_nigroviridis|13767 ---CCATCGCGGTCC---TCCCCTCAGTGCCCGCTCCCCAACAGCACGGTCCTTTCCAGG
Fugu_rubripes|10566          ---CCATCTCGGTCC---TCCCCTCAGTGCCCGCTCCCCAACACCACGGTCCTTTCCAGG
Macropus_eugenii|8397        ---CCAGCGCGTTCGCCCTCCGCTCAGTGCCCATTCCCGGGCGGTGCAGTTCTGTCCCGG
Tarsius_syrichta|7137        ---CCGTCGCGCTCGCCCTCGGCGCATTGTCATTTTCCGGGCGGGACGGTGCTGTCCCGA
Xenopus_tropicalis|18231     ---CCATCCAGATCACCTTCGGCACAATGCCATTTCCCCAGCAACACCGTTCTGTCTCGT
Danio_rerio|29182            TCGCCGACCCGGTCC---TCCCCTCAGTGCCCTCTCCCTAATAACACTGTTCTATCTCGG
Gasterosteus_aculeatus|2476  ---CCATCGCGGTCC---TCCCCTCAGTGCCCGCTCCCCAACAGCACGGTGCTATCCAGG
Dipodomys_ordii|7378         ---CCGTCGCGTTCGCCCTCGGCGCAGTGTCCTTTTCCCGGCGGGACGGTGCTGTCCCGG
Pteropus_vampyrus|7450       ---CCATCGCGCTCGCCCTCGGCGCAGTGTCCCTTTCCAGGCGGGACGGTGTTGTCCCGG
Erinaceus_europaeus|17385    ---CCCTCTCGCTCGCCCTCGGCGCAGTGCCCCTTTCCAGGCGGGACGGTGTTGTCCCGG
Gallus_gallus|3990           ---CGGCCCCGCTCGCCGTCCGCGCAGTGCCCCTTCCCCAACGGGGCGGTCCTGCCGCGG
Procavia_capensis|3713       ---CCATCGCGCTCGCCCTCCGCGCAGTGCGCCTTTCCCGGCGGGACCGTGCTGTCCCGG
Oryctolagus_cuniculus|16251  ccgccgccgcgcTCGCCCTCGGCGCAGTGTCCGTTCCCGGGCGGCGCGGTGCTGTCCCGG
Monodelphis_domestica|4284   ---CCGGCGCGCTCGCCCTCCGCTCAGTGCCCATTCCCGGGCGGTGCAGTTCTGTCCCGG
Ochotona_princeps|11968      ---CCATCGCGCTCGCCCTCGGCGCAGTGTCCTTTCCCGGGCGGCACAGTGCTGTCCCGG
Microcebus_murinus|2476      ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCCCGG
Rattus_norvegicus|16850      ---CCCGCACGCTCACCCTCGGCGCAGTGTCCCTTTCCTGGCGGGACCGTGCTGTCCCGG
Mus_musculus|42416           ---CCCGCACGCTCACCCTCCGCGCAGTGTCCCTTTCCGGGCGGGACGGTGCTGTCCCGG
Cavia_porcellus|17746        ---CCTTCGCGCTCGCCCTCGGCGCAGTGTCCTTTCCCAGGCGGGACGGTGCTGTCCCGG
Otolemur_garnettii|4285      ---CCCTCGCGCTCGCCCTCGGCGCAGTGTCCTTTTCCGAGCGGGACCGTGCTGTCCCGG
Canis_familiaris|9948        ---CCAGCGCGCTCGCCCTCGGCGCAGTGTCCCTTTCCAGGCGGGACGGTGCTGTCCCGG
Rhesus_macaque|25023         ---CCATCGCGCTCGCCCTCGGCGCAGTGTCCTTTTCCAGGCGGGACGGTGCTGTCCCGG
Gorilla_gorilla|11566        ---CCGTCACGCTCGCCCTCGGCGCAGTGTCCTTTTCCAGGCGGGACGGTGCTGTCCCGG
Homo_sapiens|31801           ---CCGTCACGCTCGCCCTCGGCGCAGTGTCCTTTTCCAGGCGGGACGGTGCTGTCCCGG
Pongo_abelii|10647           ---CCGTCGCGCTCGCCGTCGGCGCAGTGTCCTTTTCCAGGCGGGACGGTGCTGTCCCGG
Pan_troglodytes|14422        ---CCGTCACGCTCGCCCTCGGCGCAGTGTCCTTTTCCAGGCGGGACGGTGCTGTCCCGG
Callithrix_jacchus|8217      ---CCGTCGCGCTCGCCCTCGGCGCAGTGTCCTTTTCCGGGCGGTACAGTGCTGTCCCGG
Equus_caballus|18306         ------------------------------------------------------------
Bos_taurus|8576              ---CCATCGCGCTCGCCCTCGGCGCAGTGTCCCTTCCCAGGCGGGACGGTGCTGTCCCGG
Tupaia_belangeri|5563        ---CCGTCGCGCTCGCCCTCTGGGCAGTGTCCTTTCCCGGGCGGGACGGTGCTGTCCCGG
Echinops_telfairi|2347       ---CCGTCCCGCTCGCCGTCTGGGCAGTGCCCCTTTCCTGGCGGGACGGTGCTGTCCAGG
                                                                                         

Oryzias_latipes|15671        CCTCTGTACTACACCTCCCCTTTCTACCCCGGCTACACGAACTATGGGGGCAGTTTTGGA
Tetraodon_nigroviridis|13767 CCTTTGTATTACACCTCCCCTTTCTACCCCGGCTACACGAACTACGGTGGCAGTTTTGGA
Fugu_rubripes|10566          CCTTTGTACTACACCTCCCCTTTCTACCCCGGCTACACGAACTATGGTGGCAGTTTTGGA
Macropus_eugenii|8397        CCTCTCTACTACACTGCCCCTTTCTATCCCGGCTACACGAACTAT---GGCTCCTTTGGC
Tarsius_syrichta|7137        CCCCTCTACTACACCGCGCCCTTCTATCCCGGCTACACGAACTAT---GGCTCCTTCGGA
Xenopus_tropicalis|18231     CCCCTTTATTACAGCAATCCCTTTTACCCTGGTTATACGAACTAT---GGCACTTTCAGT
Danio_rerio|29182            CCTATTTACTACACGTCCCCTTTTTACCCAGGCTACACGAACTAT---AGCACTTTCGGA
Gasterosteus_aculeatus|2476  CCTCTGTACTACACCTCCCCTTTCTACCCGGGCTACACGAACTATGGGGGCAGTTTTGGA
Dipodomys_ordii|7378         CCTCTTTACTACACGGCGCCCTTCTATCCCGGCTACACGAACTAT---GGCTCCTTTGGA
Pteropus_vampyrus|7450       CCTCTCTACTACACCGCGCCCTTCTATCCCGGCTACACGAACTAT---GGCTCCTTCGGA
Erinaceus_europaeus|17385    CCTCTCTACTACACCGCGCCCTTCTATCCCGGCTACACGAACTAT---GGCTCCTTCGGA
Gallus_gallus|3990           CCGCTCTACTACACGGCGCCCTTCTACCCCGGCTACACGAACTAC---GGCTCCTTCGGG
Procavia_capensis|3713       CCTCTCTACTACACCGCGCCCTTCTATCCGGGCTACACGAACTAT---GGCTCCTTCGGA
Oryctolagus_cuniculus|16251  CCCCTCTACTACACCGCGCCCTTCTATCCCGGCTACACGAACTAT---GGCTCCTTCGGA
Monodelphis_domestica|4284   CCTCTCTACTACACTGCCCCTTTCTATCCCGGCTACACGAACTAT---GGCTCCTTTGGC
Ochotona_princeps|11968      CCTCTATACTACACCGCGCCCTTCTATCCCGGCTACACGAACTAT---GGCTCCTTCGGA
Microcebus_murinus|2476      CCTCTCTACTAC---GCGCCCTTCTATCCCGGCTACACGAACTAT---GGCTCCTTCGGA
Rattus_norvegicus|16850      CCTCTCTACTACACGGCGCCCTTCTATCCGGGCTACACGAACTAT---GGCTCCTTCGGA
Mus_musculus|42416           CCTCTTTATTACACGGCGCCCTTCTATCCGGGCTACACGAACTAT---GGCTCCTTCGGA
Cavia_porcellus|17746        CCCCTCTACTACACTGCACCCTTCTATCCCGGCTACACGAACTAT---GGATCCTTCGGA
Otolemur_garnettii|4285      CCTCTCTACTACACGGCGCCCTTCTATCCCGGCTATACGAACTAT---GGCTCCTTCGGA
Canis_familiaris|9948        CCTCTCTACTACACGGCGCCCTTCTATCCCGGCTACACGAACTAT---GGCTCCTTTGGA
Rhesus_macaque|25023         CCTCTCTACTACACCGCGCCCTTCTATCCCGGCTACACGAACTAT---GGCTCCTTCGGA
Gorilla_gorilla|11566        CCTCTCTACTACACCGCGCCCTTCTATCCCGGCTACACGAACTAT---GGCTCCTTCGGA
Homo_sapiens|31801           CCTCTCTACTACACCGCGCCCTTCTATCCCGGCTACACGAACTAT---GGCTCCTTCGGA
Pongo_abelii|10647           CCTCTCTACTACACCGCGCCCTTCTATCCCGGCTACACGAACTAT---GGCTCTTTCGGA
Pan_troglodytes|14422        CCTCTCTACTACACCGCGCCCTTCTATCCCGGCTACACGAACTAT---GGCTCCTTCGGA
Callithrix_jacchus|8217      CCTCTTTATTACACTGCGCCCTTCTATCCCGGCTACACGAACTAT---GGCTCCTTCGGA
Equus_caballus|18306         ------------------------------------------------------------
Bos_taurus|8576              CCTCTCTACTACACGGCGCCCTTCTATCCTGGCTACACGAACTAT---GGCTCCTTCGGA
Tupaia_belangeri|5563        CCTCTCTACTATACCGCGCCCTTCTATCCCGGCTACACGAACTAT---GGTTCCTTCGGA
Echinops_telfairi|2347       CCGCTCTACTACACGGCGCCCTTCTATCCGGGCTACACGAACTAC---GGCTCCTTTGGA
                                                                                         

Oryzias_latipes|15671        CACCTTCACAGTAACCACGGCTCGGTA------------ACCACGAGCTCCACGGCACAT
Tetraodon_nigroviridis|13767 CACCTCCACAGTACCCACGGCTCAGTA------------ACCACGGGCTCCACGGCGCAT
Fugu_rubripes|10566          CACCTTCACAGTAACCACGGCTCGGTA------------ACCACGGGCTCCACGGCACAT
Macropus_eugenii|8397        CACCTGCATGGCCATCCAGGGCCGGGA---CCGAGTCCTGCCCCAGCCCCTGGCCCGCAT
Tarsius_syrichta|7137        CACCTTCATGGCCACCCGGGTCCTGGC---CCAGGCGCCACAACCGGTCCGGGCTCTCAT
Xenopus_tropicalis|18231     CACCTTCACAGCCACCATGGACCTAGCACAACTAGCCCAACGGTTAACAGCACCCATCAT
Danio_rerio|29182            CACCTCCACAGCAGTCATGGCACCAAC---------------ACCAGCTCAACGGCACAT
Gasterosteus_aculeatus|2476  CATCTTCACGGTAACCATGGCTCGGTA------------ACCACGGGCTCCACGGCACAT
Dipodomys_ordii|7378         CACCTCCATGGCCACCCCGGGCCTGGG---CCAGGCCCCACAACCGGTCCAGGCTCTCAT
Pteropus_vampyrus|7450       CACCTTCATGGCCACCCGGGGCCTGGG---------------------------------
Erinaceus_europaeus|17385    CACCTTCATGGCCACCCAGGGCCGGGG---CCGGGTCCCACAACCGGTCCGGGCTCGCAT
Gallus_gallus|3990           GCCCTGCACGGGCACCCCGCCGGCGGG---CCC---------GCCGCGCCCGGCGCCGCC
Procavia_capensis|3713       CATCTTCATGGCCACCCCGGGCCCGGG---CCGGGCCCCACTGCCGGTCCGGGCTCGCAT
Oryctolagus_cuniculus|16251  CACCTCCATGGCCACCCGGGGCCTGGG---CCAGGCCCCGCCACCGGCCCGGGCTCGCAT
Monodelphis_domestica|4284   CACCTGCACGGCCACCCTGGGCCGGGG---CCGAGTCCTGCCCCGGGTCCCGGCCCGCAT
Ochotona_princeps|11968      CACCTTCATGGCCATCCAGGGACCGGG---GCAGGCGCCACCAGCGCCCCGGGCTCCCAT
Microcebus_murinus|2476      CACCTCCATGGCCACCCCGGGCCCGGG---CCAGGCCCCACAACCGGTCCGGGCGCTCAT
Rattus_norvegicus|16850      CATCTTCACGGCCACCCAGGGCCAGGG---CCAGGCCCTACAGCGGGTCCTGGCTCTCAT
Mus_musculus|42416           CATCTTCACGGCCACCCAGGGCCAGGG---CCAAGCCCTACAGCGGGTCCTGGCTCTCAT
Cavia_porcellus|17746        CACCTTCATGGCCACCCG---CCCGGG---CCAGGCCCCACTACGGGTCCTGGCTCTCAT
Otolemur_garnettii|4285      CACCTCCACGGCCACCCGGGACCCGGG---ACAGGCCCCACAACCGGTCCGGGCTCTCAT
Canis_familiaris|9948        CACCTTCACGGCCACCCAGGGCCAGGG---CCGGGCCCCACAACCGGTCCGGGCTCGCAT
Rhesus_macaque|25023         CACCTTCATGGCCACCCAGGGCCCGGG---CCAGGGCCCACAACCGGTCCGGGGTCTCAT
Gorilla_gorilla|11566        CACCTTCATGGCCACCCGGGGCCCGGG---CCAGGCCCCGCAACCGGTCCGGGGTCTCAT
Homo_sapiens|31801           CACCTTCATGGCCACCCGGGGCCCGGG---CCAGGCCCCACAACCGGTCCGGGGTCTCAT
Pongo_abelii|10647           CACCTTCATGGCCACCCGGGGCCCGGG---CCAGGCCCCACAACCGGTCCGGGGTCTCAT
Pan_troglodytes|14422        CACCTTCATGGCCACCCGGGGCCCGGG---CCAGGCCCCACAACCGGTCCGGGGTCTCAT
Callithrix_jacchus|8217      CACCTTCATGGCCACCCGGGGCCTGGG---CCAGGCCCCACAACCGGTCCGGGGTCTCAT
Equus_caballus|18306         ------------------------------------------------------------
Bos_taurus|8576              CACCTTCACGGCCACCCGGGGCCCGGG---CCAGGCCCCACCACGGGTCCGGGCTCGCAT
Tupaia_belangeri|5563        CACCTTCACGGCCACCCAGGGCCAGGG---CCAGGGCCCACCACCGGCCCGGGTTCTCAT
Echinops_telfairi|2347       CACCTTCATGGCCACCCAGGGCCCGGG---CCAGGCCCC---ACCGGCCCAGGCTCGCAT
                                                                                         

Oryzias_latipes|15671        TTCAATGGATTAAACCAGACTGTGTTAAATAGAGCTGAGGCTTTGGTAAGGGAGAGCCAG
Tetraodon_nigroviridis|13767 TTCAATGGATTAAACCAGACTGTGTTAAATAGAGCAGAGGCTTTGGTGAGGGAGAGCCAA
Fugu_rubripes|10566          TTCAATGGATTAAACCAGACTGTGTTAAATAGAGCAGAGGCTTTGGtaagagagagccag
Macropus_eugenii|8397        TTCAATGGATTAAACCAGACCGTGTTGAACCGAGCGGACGCTTTGGCTAAAGAAACGAAA
Tarsius_syrichta|7137        TTCAATGGATTAAACCAGACCGTGTTGAATCGAGCGGACGCTTTGGCTAAAGACCCGAAA
Xenopus_tropicalis|18231     TTCAGTGGAATAAACCAGACTGTATTAAACAGAGCCGAGGCTTTGGCCAAAGAGTGCAAA
Danio_rerio|29182            TTCAATGGATTAAGCCAGACTGTTTTAAACAGAGCCGAGGCTCTGGTAAGAGAGAGCAAA
Gasterosteus_aculeatus|2476  TTCAATGGATTAAACCAGACTGTGTTGAATAGAGCAGAGGCTTTGGTAAGAGAGAGCCAG
Dipodomys_ordii|7378         TTCAATGGATTAAACCAGACCGTGTTGAACCGAGCGGACACTTTGGCTAAAGACCCGAAA
Pteropus_vampyrus|7450       ------------------------------------------------------------
Erinaceus_europaeus|17385    TTCAATGGATTAAACCAGACCGTGTTGAACCGAGCGGACGCTTTGGCTAAAGACCCGAAA
Gallus_gallus|3990           TTCAATGGATTAAACCAGACTGTGCTGAGCCGGGCCGAGGGGCTGGGGAAGGAGCCCAAG
Procavia_capensis|3713       TTCAATGGATTAAATCAGACCGTGTTGAACCGAGCGGATGCTCTGGCGAAAGACCCGAAA
Oryctolagus_cuniculus|16251  TTCAATGGATTAAACCAGACGGTGTTGAACCGAGCGGACGCTTTGGCTAAGGACCCGAAA
Monodelphis_domestica|4284   TTCAATGGATTAAACCAGACCGTGTTGAACCGAGCGGACGCTTTGGCTAAAGAAACGAAA
Ochotona_princeps|11968      TTTAATGGATTAAACCAGACGGTGTTGAACCGAGCGGACACTTTGGCTAAAGACCCGAAA
Microcebus_murinus|2476      TTCAATGGATTAAACCAGACCGTGTTGAACCGAGCGGACGCTTTGGCTAAAGACCCGAAA
Rattus_norvegicus|16850      TTCAATGGATTAAACCAGACGGTGTTGAATCGTGCGGACGTTTTGGCTAAAGACCCGAAA
Mus_musculus|42416           TTCAATGGATTAAACCAGACGGTGTTGAATCGTGCGGACGTTTTGGCTAAAGACCCGAAA
Cavia_porcellus|17746        TTCAATGGATTAAACCAGACCGTGTTGAATCGAGCGGACGCTTTGGCTAAAGACCCGAAA
Otolemur_garnettii|4285      TTCAATGGATTAAACCAGACCGTGCTGAACCGAGCGGACGCTTTGGCTAAAGACCCGAAA
Canis_familiaris|9948        TTCAATGGATTAAACCAGACCGTGTTGAACCGAGCGGACGCTTTGGCTAAAGACCCGAAA
Rhesus_macaque|25023         TTCAATGGATTAAACCAGACCGTGTTGAACCGAGCGGACGCTTTGGCTAAAGACCCGAAA
Gorilla_gorilla|11566        TTCAATGGATTAAACCAGACCGTGTTGAACCGAGCGGACGCTTTGGCTAAAGACCCGAAA
Homo_sapiens|31801           TTCAATGGATTAAACCAGACCGTGTTGAACCGAGCGGACGCTTTGGCTAAAGACCCGAAA
Pongo_abelii|10647           TTCAATGGATTAAACCAGACCGTGTTGAACCGAGCGGACGCTTTGGCTAAAGACCCGAAA
Pan_troglodytes|14422        TTCAATGGATTAAACCAGACCGTGTTGAACCGAGCGGACGCTTTGGCTAAAGACCCGAAA
Callithrix_jacchus|8217      TTCAATGGATTAAACCAGACCGTGTTGAACCGAGCGGACGCTTTGGCTAAAGACCCGAAA
Equus_caballus|18306         ------------------------------------------------------------
Bos_taurus|8576              TTCAATGGATTAAACCAGACCGTGTTGAATCGAGCGGACGCTTTGGCTAAAGACCCGAAA
Tupaia_belangeri|5563        TTCAATGGATTAAATCAAACCGTGTTGAACCGAGCGGACGCTTTGGCTAAAGACCCGAAA
Echinops_telfairi|2347       TTCAATGGATTAAATCAGACGGTGTTGAACCGAGCAGATGCTTTGGCCAAAGACCCGAAA
                                                                                         

Oryzias_latipes|15671        AAAGTCAGAGGCCAAACGCAGATAGATCTTTGTAAAGACTCCCCTTAC---GAACTAAAG
Tetraodon_nigroviridis|13767 AGAGTCAGAGGCCAAACGCAGGTAGATCTTTGTAAAGACTTCCCTTAT---GAACTAAAG
Fugu_rubripes|10566          agagtcAGAGGCCAAACGCAGGTAGATCTTTGTAAAGACTCCCCTTAT---GAACTAAAG
Macropus_eugenii|8397        ATGCTCAGAAGCCAATCACAGCTAGACCTGTGCAAAGACTCTCCCTTT---GAACTGAAG
Tarsius_syrichta|7137        ATGTTGCGGAGCCAGTCCCAGCTAGACCTGTGCAAAGACTCTCCCTAT---GAACTGAAG
Xenopus_tropicalis|18231     ---CTTAGAAGCCAGTCACAAGCTGACCTAAACAAAGACACGCCTTAT---GAAATGAAG
Danio_rerio|29182            ---GTAAGAAGCCAAACACAGGTAGATCTTTGTAAAGACTCACCTTAT---GAGCTAAAG
Gasterosteus_aculeatus|2476  AAAGTCAGAAGCCAAACGCAGGATGAAGCAAATTCTGACAGCAGATATTTTCAGATAAAT
Dipodomys_ordii|7378         ATGTTGAGGAACCCGTCTCAACTA---CTGTGCAAAGACTCTCCGTAT---GAA---AAG
Pteropus_vampyrus|7450       ------------------------------------------------------------
Erinaceus_europaeus|17385    ATGTTGCGAAGCCAGTCCCAGCTAGACCTGTGCAAAGACTCTCCCTAT---GAATTGAAG
Gallus_gallus|3990           GCGGCCAGGAGCCAGCCCCAGGCAGAGCTCGGCAAGGACTCGCCGTAC---GAACTGAAG
Procavia_capensis|3713       ATGTTACGGAGCCAGTCCCAGCTAGACCTGTGCAAAGACTCTCCCTAT---GAATTGAAG
Oryctolagus_cuniculus|16251  GTGTTGCGGAGCGCGTCGCAGCTAGACCTGTGCAAAGACTCTGCCTAT---GAACTGAAG
Monodelphis_domestica|4284   ATGCTCAGAAGCCAATCACAGCTAGACCTGTGCAAAGACTCTCCCTTT---GAACTGAAG
Ochotona_princeps|11968      ATGTTGCGGAGCCCGTCGCAGCTAGACCTGTGCAAAGACTCCCCCTAT---GAATTGAAG
Microcebus_murinus|2476      ATGTTGCGGAGCCAGTCTCAGCTAGACCTGTGCAAAGACTCTCCCTAT---GAATTGAAG
Rattus_norvegicus|16850      ATGTTGCGGAGCCAGTCTCAGCTAGACCTGTGCAAAGACTCCCCCTAT---GAATTGAAG
Mus_musculus|42416           ATGTTGCGGAGCCAGTCTCAGCTAGACCTGTGCAAAGACTCCCCCTAT---GAGTTGAAG
Cavia_porcellus|17746        ATGTTGCGGAGCCAGTCTCAGCTAGACCTCTGCAAAGACTCTCCCTAT---GAATTGAAG
Otolemur_garnettii|4285      ATGTTGAGGAGCCAGTCTCAGCTAGACCCGTGCAAAGACTCTCCCTAT---GAATTGAAG
Canis_familiaris|9948        ATGTTGCGGAGCCAGTCTCAACTAGACCTGTGCAAAGACTCTCCCTAT---GAATTGAAG
Rhesus_macaque|25023         ATGTTGCGGAGCCAGTCTCAGCTAGACCTGTGCAAAGACTCTCCCTAT---GAATTGAAG
Gorilla_gorilla|11566        ATGTTGCGGAGCCAGTCTCAGCTAGACCTGTGCAAAGACTCTCCCTAT---GAATTGAAG
Homo_sapiens|31801           ATGTTGCGGAGCCAGTCTCAGCTAGACCTGTGCAAAGACTCTCCCTAT---GAATTGAAG
Pongo_abelii|10647           ATGTTGCGGAGCCAGTCTCAGCTAGACCTGTGCAAAGACTCTCCCTAT---GAATTGAAG
Pan_troglodytes|14422        ATGTTGCGGAGCCAGTCTCAGCTAGACCTGTGCAAAGACTCTCCCTAT---GAATTGAAG
Callithrix_jacchus|8217      GTGTTGCGGAGCCAGTCTCAGCTAGACCTGTGCAAAGACTCTCCCTAT---GAATTGAAG
Equus_caballus|18306         ------------------------------------------------------------
Bos_taurus|8576              ATGTTGCGGAGCCAGTCCCAGCTAGACCTGTGCAAAGACTCTCCCTAT---GAATTGAAG
Tupaia_belangeri|5563        ATGTTGCGGAGCCCGTCTCAGCTAGACCTGTGCAAAGACTCTCCCTAT---GAATTGAAG
Echinops_telfairi|2347       ATGTTGCGGAGCCAGTCCCAGCTAGACCTGTGCAAAGACTCTCCCTAT---GAATTGAAG
                                                                                         

Oryzias_latipes|15671        AAAGCTTATTACACACTTTTTTGTCAGATCAGCGTCAGGCCTCGAAGT------------
Tetraodon_nigroviridis|13767 AAAGGTAtgtcaaacatt------------------------------------------
Fugu_rubripes|10566          AAAGGTATGTCAAACATT------------------------------------------
Macropus_eugenii|8397        AAAGGTATGTCCGACTTT------------------------------------------
Tarsius_syrichta|7137        AAAGGTATGTCCGACATT------------------------------------------
Xenopus_tropicalis|18231     AAAGGTATGTCTAGCATT------------------------------------------
Danio_rerio|29182            AAAGGTATGTCAAACATT------------------------------------------
Gasterosteus_aculeatus|2476  TATGGAAGAAAAAAAATGCCTGTGCAGCGATTATTTTTGGTAGGTGTCACACTTGCTCCT
Dipodomys_ordii|7378         AAAGGTTCGGAC------------------------------------------------
Pteropus_vampyrus|7450       ------------------------------------------------------------
Erinaceus_europaeus|17385    AAAGGTATGTCCGACATT------------------------------------------
Gallus_gallus|3990           AAAGGTATGTCCAGCATT------------------------------------------
Procavia_capensis|3713       AAAGGTATGTCCGACATT------------------------------------------
Oryctolagus_cuniculus|16251  AAAGGTATGTCGGACATT------------------------------------------
Monodelphis_domestica|4284   AAAGGTATGTCCGACATT------------------------------------------
Ochotona_princeps|11968      AAAGGTATGTCCGACATT------------------------------------------
Microcebus_murinus|2476      AAAGGTATGTCCGACATT------------------------------------------
Rattus_norvegicus|16850      AAAGGTATGTCCGACATT------------------------------------------
Mus_musculus|42416           AAAGGTATGTCCGACATT------------------------------------------
Cavia_porcellus|17746        AAAGGTATGTCCGACATT------------------------------------------
Otolemur_garnettii|4285      AAAGGTATGTCCGACATT------------------------------------------
Canis_familiaris|9948        AAAGGTATGTCCGACATT------------------------------------------
Rhesus_macaque|25023         AAAGGTATGTCCGACATT------------------------------------------
Gorilla_gorilla|11566        AAAGGTATGTCCGACATT------------------------------------------
Homo_sapiens|31801           AAAGGTATGTCCGACATT------------------------------------------
Pongo_abelii|10647           AAAGGTATGTCCGACATT------------------------------------------
Pan_troglodytes|14422        AAAGGTATGTCCGACATT------------------------------------------
Callithrix_jacchus|8217      AAAGGTATGTCCGACATT------------------------------------------
Equus_caballus|18306         ------------------------------------------------------------
Bos_taurus|8576              AAAGGTATGTCCGACATT------------------------------------------
Tupaia_belangeri|5563        ---GGTATGTCCGACATT------------------------------------------
Echinops_telfairi|2347       AAAGGTATGTCGGACATT------------------------------------------
                                                                                         

Oryzias_latipes|15671        ---
Tetraodon_nigroviridis|13767 taa
Fugu_rubripes|10566          TAA
Macropus_eugenii|8397        TAA
Tarsius_syrichta|7137        TAA
Xenopus_tropicalis|18231     TAA
Danio_rerio|29182            TAA
Gasterosteus_aculeatus|2476  ---
Dipodomys_ordii|7378         TAA
Pteropus_vampyrus|7450       ---
Erinaceus_europaeus|17385    TAA
Gallus_gallus|3990           TAA
Procavia_capensis|3713       TAA
Oryctolagus_cuniculus|16251  ---
Monodelphis_domestica|4284   TAA
Ochotona_princeps|11968      TAA
Microcebus_murinus|2476      TAA
Rattus_norvegicus|16850      TAA
Mus_musculus|42416           TAA
Cavia_porcellus|17746        TAA
Otolemur_garnettii|4285      TAA
Canis_familiaris|9948        ---
Rhesus_macaque|25023         TAA
Gorilla_gorilla|11566        TAA
Homo_sapiens|31801           TAA
Pongo_abelii|10647           TAA
Pan_troglodytes|14422        TAA
Callithrix_jacchus|8217      TAA
Equus_caballus|18306         ---
Bos_taurus|8576              TAA
Tupaia_belangeri|5563        TAA
Echinops_telfairi|2347       TAA
                                

multiple sequence alignment in CLUSTALW format


Oryzias_latipes|16331        MAYPQGYLYQPSASLALYSCPAYSTSVISGPRTEELGRSSSGSAFAPYAGSTAFSSASPG
Tetraodon_nigroviridis|2922  MAYPQGYLYQPSASLALYSCPAYSTGVISGPRTEELGRSSSGSAFAPYAGSTAFTSASPG
Fugu_rubripes|25317          MAYPQGYLYQPSASLALYSCPAYSTSVISGPRTEELGRSSSGSAFAPYAGSTAFTSASPG
Macropus_eugenii|7660        MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDXXXXXXXXXXXXXXXXXXXXXXXXXX
Tarsius_syrichta|6537        ------------------------------------------------------------
Xenopus_tropicalis|25078     MSYPQGYLYQPSASLALYSCPAYSTTVISGPRTDELGRSPSGSAFSPYAGSTAFTASSAG
Danio_rerio|13841            MAYPQGYLYQPSASLALYSCPAYSTSVISGPRTEELGRSSSGSAFAPYAGSTAFTSASPG
Gasterosteus_aculeatus|21599 MAYPQGYLYQPSASLALYSCPAYSTSVISGPRTEELGRSSSGSAFAPYAGSTAFTSASPG
Dipodomys_ordii|6932         MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
Pteropus_vampyrus|7014       -IYPRG-VYHPFVSLKLYE--AYSTSVMSGIRTDELNHYLSGYKFSPYASSTTNTARSPG
Erinaceus_europaeus|14285    MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
Gallus_gallus|6061           MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
Procavia_capensis|3504       ------------------------------------------------------------
Oryctolagus_cuniculus|7815   ------------------------------PRTDELESSSSDSAFSPYASSTAFTAPSPG
Monodelphis_domestica|25863  MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
Ochotona_princeps|10442      ------------------------------------------------------------
Microcebus_murinus|2107      -MSPQGYFYQPS-PLALYSCPAYSPSVISGPRTDELGRS-SGSAFSPYAGSTAFTA-SPG
Rattus_norvegicus|11704      MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
Mus_musculus|45956           MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
Cavia_porcellus|13953        MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
Otolemur_garnettii|3688      ----------------LYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
Canis_familiaris|14959       MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
Rhesus_macaque|32381         MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
Gorilla_gorilla|9612         MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
Homo_sapiens|55104           MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
Pongo_abelii|7552            MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
Pan_troglodytes|13157        MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
Callithrix_jacchus|1166      MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
Equus_caballus|20984         ----------------------YSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
Bos_taurus|13591             MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
Tupaia_belangeri|4785        MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
Echinops_telfairi|1861       MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
                                                                                         

Oryzias_latipes|16331        YNSHLPYSAD--AAAAATFTSYVSSPYDHTTGMAGSIGYHPYAAPLGTYPYGDPAYRKNA
Tetraodon_nigroviridis|2922  YNSHLPYSAD--AAAAATFTSYVSSPYDHTTGMAGSIGYHPYATPLGTYPYGDPAYRKNA
Fugu_rubripes|25317          YNSHLPYSAD--AAAAATFTSYVSSPYDHTSGMAGSIGYHPYATPLGTYPYGDPAYRKNA
Macropus_eugenii|7660        XXXXXXXXXXXXXXXXXXXXXXXGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Tarsius_syrichta|6537        -----------------------GSPYDHAPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Xenopus_tropicalis|25078     FNSPLQYSGDP----AAAFTSYVGSPYDHSAGMAGSLGYHPYAAPLGTYPYGDPAYRKNA
Danio_rerio|13841            YNSHLPYSAD--AAAAATFTSYVSSPYDHTTGMAGSIGYHPYAAPLGSYPYGDPAYRKNA
Gasterosteus_aculeatus|21599 YNSHLPYSAD--AAAAATFTSYVGSPYDHTTGMAGSIGYHPYAAPLGSYPYGDPAYRKNA
Dipodomys_ordii|6932         YNSHLQYGADPAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Pteropus_vampyrus|7014       YDSHIQYGADPPAAAAAPFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Erinaceus_europaeus|14285    YNSHLQYGADPAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Gallus_gallus|6061           YNSHLQYGTDPAAAAAAAFTSYVGSPYEHPPAMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Procavia_capensis|3504       -----------------------GSPYDHTPGLAGSLGYHPYAAPLGSYPYGDPAYRKNA
Oryctolagus_cuniculus|7815   YNSHLQYGADPAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Monodelphis_domestica|25863  YNSHLQYGTDPAAAAAAAFTSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Ochotona_princeps|10442      -----------------------GSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Microcebus_murinus|2107      YNSHLQYGA-PTAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Rattus_norvegicus|11704      YNSHLQYGADPAAAAAAAF-SYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Mus_musculus|45956           YNSHLQYGADPAAAAAAAF-SYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Cavia_porcellus|13953        YNSHLQYGADPAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Otolemur_garnettii|3688      YNSHLQYGADPAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Canis_familiaris|14959       YNSHLQYGADPAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Rhesus_macaque|32381         YNSHLQYGADPAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Gorilla_gorilla|9612         YNSHLQYGADPAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Homo_sapiens|55104           YNSHLQYGADPAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Pongo_abelii|7552            YNSHLQYGADPAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Pan_troglodytes|13157        YNSHLQYGADPAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Callithrix_jacchus|1166      YNSHLQYGADPAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Equus_caballus|20984         YNSHLQYGADPAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPY-DPAYRKNA
Bos_taurus|13591             YNSHLQYGADPAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA
Tupaia_belangeri|4785        YNSHLQYGADPAAAAAAAFSSYVXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Echinops_telfairi|1861       YNSHLQYGADPAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYSYGDSAYWKNA
                                                                                         

Oryzias_latipes|16331        TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Tetraodon_nigroviridis|2922  TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Fugu_rubripes|25317          TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Macropus_eugenii|7660        TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Tarsius_syrichta|6537        TRDATATLMAWLIEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRL-KENIMTWT
Xenopus_tropicalis|25078     TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Danio_rerio|13841            TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Gasterosteus_aculeatus|21599 TRDATATLKAWLGEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Dipodomys_ordii|6932         TRDATATLKAWLNEHQRKHRNEEKE--------KKKKKQMSTWFANARRRLKKENKMTWT
Pteropus_vampyrus|7014       TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Erinaceus_europaeus|14285    TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWVANARRRLKKENKMTWT
Gallus_gallus|6061           TRDATATLKAWLNEHRKNPYPSK-------------------------------------
Procavia_capensis|3504       TRDATATLKAWLNEHRMNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Oryctolagus_cuniculus|7815   TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Monodelphis_domestica|25863  TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Ochotona_princeps|10442      TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Microcebus_murinus|2107      TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Rattus_norvegicus|11704      TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Mus_musculus|45956           TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Cavia_porcellus|13953        TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Otolemur_garnettii|3688      TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Canis_familiaris|14959       TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Rhesus_macaque|32381         TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Gorilla_gorilla|9612         TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Homo_sapiens|55104           TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Pongo_abelii|7552            TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Pan_troglodytes|13157        TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Callithrix_jacchus|1166      TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Equus_caballus|20984         TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRFKKENKMTWT
Bos_taurus|13591             TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT
Tupaia_belangeri|4785        XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Echinops_telfairi|1861       TRDATATLKAWLNEHRKNPYPTKGEKIMLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                                                                                         

Oryzias_latipes|16331        PRNRSEDEEEDENIDLEKNDDDEPNKPLDKGDSTDTE-AGRCSALDFSSLAECQFFISAL
Tetraodon_nigroviridis|2922  PRNRSEDEEEDENIDLEKNDDDEPNKPTDKGDSTDTEADHKLV-----------------
Fugu_rubripes|25317          PRNRSEDEEEDENIDLEKNDDDEPNKPTDKGDSTDTEADHKLL-----------------
Macropus_eugenii|7660        PRNRSEDEEEEENIDLEKNDEDEPQKPEDKGEVEAPE-TGGD------------------
Tarsius_syrichta|6537        PRNRGEDEEDEENIDLDNSDEDDPHKPVNYGDSEGPK-LXXXX-----------------
Xenopus_tropicalis|25078     PRNRSEDEEDDENIDLEKNEEDDPRKLEEKGDQDGDA-GDQKR-----------------
Danio_rerio|13841            PRNRSEDEEEDENIDLEKNDDDEPNKPTDKGDSTDTEADHKLI-----------------
Gasterosteus_aculeatus|21599 PRNRSEDEEEDENIDLEKNDDDEPNKPTDKGDSTDTEGIMHNCVHAPDSI----------
Dipodomys_ordii|6932         PRNRSEDEEEEENIDLEKNDEDEPQKPVDKSDLEGSE-AGGVE-----------------
Pteropus_vampyrus|7014       PRNRSEDEEEEENIDLEKNDEDEPPKPEDKGDPEGPE-AGGAE-----------------
Erinaceus_europaeus|14285    P-NRSED-EEEENIDLE-NDEDEPQKEDGDHGPAAXX-XXXXX-----------------
Gallus_gallus|6061           ------------------------------------------------------------
Procavia_capensis|3504       PRNRSEDEEEEENIDLEKNDEDEPHKPEDKGDLEGTE-AGGAE-----------------
Oryctolagus_cuniculus|7815   PRNRSEDEEEEENIDLEKNDEDEPQKAEDKGDPEGPE-AGGAE-----------------
Monodelphis_domestica|25863  PRNRSEDEEEEENIDLEKNDEDEPQKPEDKGEAEAPE-TGG-E-----------------
Ochotona_princeps|10442      PRNRSEDEEEEENIDLEKNDEDEPQKAEDKGDPEGPE-AGGAE-----------------
Microcebus_murinus|2107      PRNRSEDEEEEENIDLEKNDEDEPQKPEDKGDPEGPE-AXXXX-----------------
Rattus_norvegicus|11704      PRNRSEDEEEEENIDLEKNDEDEPQKPEDKGDLEGPE-AGGTE-----------------
Mus_musculus|45956           PRNRSEDEEEEENIDLEKNDEDEPQKPEDKGDLEGPE-SGGAE-----------------
Cavia_porcellus|13953        PRNRSEDEEEEENIDLEKNDEDEPQKPEDKSDPEGTE-AGGAE-----------------
Otolemur_garnettii|3688      PRNRSEDEEEEENIDLEKNDEDEPQKPEDKGDAEGPE-AGGTE-----------------
Canis_familiaris|14959       PRNRSEDEEEEENIDLEKNDEDEPQKPEGKGDSEGPE-AGGAE-----------------
Rhesus_macaque|32381         PRNRSEDEEEEENIDLEKNDEDEPQKPEDKGDPEGPE-A-GAE-----------------
Gorilla_gorilla|9612         PRNRSEDEEEEENIDLEKNDEDEPQKPEDKGDPEGPE-AGGAE-----------------
Homo_sapiens|55104           PRNRSEDEEEEENIDLEKNDEDEPQKPEDKGDPEGPE-AGGAE-----------------
Pongo_abelii|7552            PRNRSEDEEEEENIDLEKNDEDEPQKPEDKGDPEGPE-AGGAE-----------------
Pan_troglodytes|13157        PRNRSEDEEEEENIDLEKNDEDEPQKPEDKGDPEGPE-AGGAE-----------------
Callithrix_jacchus|1166      PRNRSEDEEEEENIDLEKNDEDEPQKPEDKGDPEGPE-AGGAE-----------------
Equus_caballus|20984         PRNRSEDEEEEENIDLEKNDEDEPQKPEDKGDPDG-------------------------
Bos_taurus|13591             PRNRSEDEEEEENIDLEKNDEDEPQKPEDKGDPEGPE-AGGAE-----------------
Tupaia_belangeri|4785        XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----------------
Echinops_telfairi|1861       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----------------
                                                                                         

Oryzias_latipes|16331        DHKLNPGDISCDRFKEESH---------------GKEVDPLLSDSELKEQ-EERTTELL-
Tetraodon_nigroviridis|2922  ----NPGDMGCDRFKEDTH---------------GKDTDPLLSDSEFKEQ-EERTTELL-
Fugu_rubripes|25317          ----NPGDMGCDRFKEENH---------------GKDTDPLLSDSDLKEQ-EERTTELL-
Macropus_eugenii|7660        ----QKAAPICERLEGPHTPA-------------SKEVEGNLSDSDFKES-HEGRLDAL-
Tarsius_syrichta|6537        ----XXXXXXXXXXXXXXXXX-------------XXXXXXXXXXXXXXXXXXXXXXXXX-
Xenopus_tropicalis|25078     ----SPSAVDFDRLEGEVRQ--------------GKELDQTRSDSEQNE--VEERNDLLS
Danio_rerio|13841            ----NPGEIPCDRFKDETH---------------SKDLDPPLTDSELKE--AEERTDLL-
Gasterosteus_aculeatus|21599 ----SQCCSLASRLPQPPPPPSKTICYRFKEETHGKDTDPLLSDSELKDP-EERTTELL-
Dipodomys_ordii|6932         ----EKAAAGCERLQGPPTPA-------------GKETEGSLSDSDFKEVPSEGRHDAQ-
Pteropus_vampyrus|7014       ----PKAASGCERLQGPPTPA-------------GKETEGSLSDSDFKEPPSEGRLDAL-
Erinaceus_europaeus|14285    ----XXXXXXXXXXXXXXXXX-------------XXXXXXXXXXXXXXXXXXXXXXXXX-
Gallus_gallus|6061           ----------------PPAAA---------------------------------------
Procavia_capensis|3504       ----QKVSIGC-RLQGPPTPA-------------GKEAEGGLSDSDFKAPTSEGRPDVL-
Oryctolagus_cuniculus|7815   ----QKAASGCERLQGPPTPA-------------GKETEGSLSDSDFKEQPCEGRHDTL-
Monodelphis_domestica|25863  ----QKAAPICERLQGPHTPA-------------SKEAEGNLSDSDFKES-HEGRLDAL-
Ochotona_princeps|10442      ----PKAGSGCERLQGPPTPA-------------GKETEGSLSDSDFKELPSEGRHDTL-
Microcebus_murinus|2107      ----XXXXXXXXXXXXXXXXX-------------XXXXXXXXXXXXXXXXXXXXXXXXX-
Rattus_norvegicus|11704      ----QKAAAGCERLQGPLSPA-------------GKETEGSLSDSDFKESPSEGRHDDL-
Mus_musculus|45956           ----QKATAGCERLQGPLSPA-------------GKETEGSLSDSDFKESSSEGRHDEL-
Cavia_porcellus|13953        ----QKAASGCERLQGPPTPA-------------GKETEGSLSDSDFKEPPSEGRQDPL-
Otolemur_garnettii|3688      ----QMAASGC-RLQGPPTPA-------------GKETECSLSDMYFKESRSEVRPNAI-
Canis_familiaris|14959       ----QKAAAGCERLQGPPTPA-------------GKETEGSLSDSDFKEPPSEGRLDAL-
Rhesus_macaque|32381         ----QKAASGCERLQGPPTPA-------------SKETEGSLSDSDFKEPPSEGRLDAL-
Gorilla_gorilla|9612         ----QKAASGCERLQGPPTPA-------------GKETEGSLSDSDFKEPPSEGRXDAL-
Homo_sapiens|55104           ----QKAASGCERLQGPPTPA-------------GKETEGSLSDSDFKEPPSEGRLDAL-
Pongo_abelii|7552            ----QKAASGCERLQGPPTPA-------------GKETEGSLSDSDFKEPPSEGRLEAL-
Pan_troglodytes|13157        ----QKAASGCERLQGPPTPA-------------GKETEGSLSDSDFKEPPSEGRLDAL-
Callithrix_jacchus|1166      ----QKA-SGCERLQGPPTPA-------------GKETEGSLSDSDFNEQPSEA-LDAL-
Equus_caballus|20984         ------------------------------------------------------------
Bos_taurus|13591             ----QKAVSGCERLQGPPTPA-------------GKETEGSLSDSDFKEPPSEGRLDAL-
Tupaia_belangeri|4785        ----XXXXXXXXXXXXPPTPA-------------GKETEGSLCDSDFKEPPSEGRLDAL-
Echinops_telfairi|1861       ----XXXXXXXXXXXXXPPPA-------------ARTTEGSVRDSDFKMPSSESHLDTL-
                                                                                         

Oryzias_latipes|16331        --PDAAKPTTSSPSAV-----------------PRGNPTPQDKPSDLSHA----------
Tetraodon_nigroviridis|2922  --PDSAKATTSSPPAV-----------------PRGNQAVAQQDKPSDLSHA--------
Fugu_rubripes|25317          --PDSAKPTTSSPSAV-----------------PRGNQAVAQQDKQSDLSHA--------
Macropus_eugenii|7660        --PGGPRAGGPSPSGP-VARLGEESS---PHY-PPGAPAPH---AAGELP----------
Tarsius_syrichta|6537        --XXXXXXXXXXXXXXXXXXXXXXXX---XXX-XXXXXXXXXXXXXXXXX----------
Xenopus_tropicalis|25078     KNSAPPTSPLCPPDQSPQAQEDQNLHRHTVHNHHHQSIQQLHHHSHQSHPLDLVHRNALV
Danio_rerio|13841            --AEQAKPTTSSPSVLQRGSDLIT---------QEKPSEPGHAASTGN------------
Gasterosteus_aculeatus|21599 --PDSAKPTTSSPSAL-------------PRG-NQAAAAQQDKPSDLSLA----------
Dipodomys_ordii|6932         --PGAPRAGGPSPAGPAAARLADDPA---SHY-PTGAPGPGAHPSSGELP----------
Pteropus_vampyrus|7014       --PGPPRASGPSPVGPAVARLADDPG---PHY-PAGAPAPGPHPAAGELP----------
Erinaceus_europaeus|14285    --XXXXXXXXXXXXXXXXXXXXXXXX-------XXXXXXXXXXXXXXXXX----------
Gallus_gallus|6061           ------------------------------------------------------------
Procavia_capensis|3504       --PGPPRPGGSSPAGPAAARLAEDPV---PHY-PSGAPAPGPHPAAGELP----------
Oryctolagus_cuniculus|7815   --PGPPRVGGPSPAGPAAARLAEDPA---PHY-PAGAPAPGPHPAAGELP----------
Monodelphis_domestica|25863  --PGGPRAGGPSPTGQ-VARLGEEPS---PHYHPPGASAPHP---AGELP----------
Ochotona_princeps|10442      --PVPPRVGGPSPAGPTAARLAEDPAXXXXXX-XXXXXXXXXXXXXXXXX----------
Microcebus_murinus|2107      --XXXXXXXXXXXXXXXXXXXXXXXX---XXX-XXXXXXXXXXXXXXXXX----------
Rattus_norvegicus|11704      --PRPPRAGEPSPAGPATARLAEDAG---PHY-PAGAPAPGPHPSAGELP----------
Mus_musculus|45956           --PRPPRAGESSPAGPATARLAEDAG---PHY-PASVPAPGPHPSAGELP----------
Cavia_porcellus|13953        --PGPPRAGVPSPVGPAAARLTEDPA---PHY-PAGAPPPGPHPSAGELP----------
Otolemur_garnettii|3688      --CGPRRLWESSPYGPGKARXXXXXX---XXX-XXXXXXXXXXXXXXXXP----------
Canis_familiaris|14959       --PGPPRAGGPSPAGPAAARLAEDPA---PHY-PSGAPAPGPHPAAGELP----------
Rhesus_macaque|32381         --QGAPRTGGPSPAGPAAARLAEDPA---PHY-PAGAPAPGPHPAAGELP----------
Gorilla_gorilla|9612         --QGPPRTGGPSPAGPAAARLAEDPA---PHY-PAGAPAPGPHPAAGELP----------
Homo_sapiens|55104           --QGPPRTGGPSPAGPAAARLAEDPA---PHY-PAGAPAPGPHPAAGEVP----------
Pongo_abelii|7552            --QGPPRTGGPSPAGPAAARLAEDPA---PHY-PAGAPAPGPHPAAGELP----------
Pan_troglodytes|13157        --QGPPRTGGPSPAGPAAARLAEDPA---PHY-PAGAPAPGPHPAAGELP----------
Callithrix_jacchus|1166      --Q-PPRTGGPSPAGPAAARLAEDPA---PHY-PTGAPASGPHPAAGELP----------
Equus_caballus|20984         ------------------------------------------------------------
Bos_taurus|13591             --PGPPRAGGLSPAGPAAARLAEDPA---PHY-PSGAPAPGPHPAAGELP----------
Tupaia_belangeri|4785        --PGPPRAGGPSPAGPAAARLADDSA---PHY-PAGTPAPGPHPAPGELP----------
Echinops_telfairi|1861       --PGLPRAGGSSPARPAAARLAEDPV---AHY-PSGLPAPR-HSTTGELP----------
                                                                                         

Oryzias_latipes|16331        -ASTVTGNVTSVIHS---PPSAP------KPKLWSLAEIATSSDRCKGSGDAP-----PP
Tetraodon_nigroviridis|2922  -PSTVTSNVTSVIHS---PPSAP------KPKLWSLAEIATSSDRCKSSSDAS-----PS
Fugu_rubripes|25317          -ATTVTSNVTSVIHS---PPSAP------KPKLWSLAEIATSSDRCKSSSDASQS-----
Macropus_eugenii|7660        -SG---PSGPSVIHS-------PPQAVLAKPKLWSLAEIATSSDKSKEGGGGGGEGP-PP
Tarsius_syrichta|6537        -XX---XXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Xenopus_tropicalis|25078     QHGPVTNNATSVIHS--------PPASTSKPKLWSLAEIATSSDKVKESSDAAA------
Danio_rerio|13841            ------SNVTSVIHS---PPSAP------KPKLWSLAEIATSSDRCKGSSEASQAA----
Gasterosteus_aculeatus|21599 -TGSVTSNATSVIHS---PPSAP------KPKLWSLAEIATSTDRCKIAAMGTNAS----
Dipodomys_ordii|6932         -PG---PGGPSVIHS---PPPPPQPVVLAKPKLWSLAEIATSSDKVKDGGGGNEGSPCPP
Pteropus_vampyrus|7014       -PG---PGGPSVIHS---PPPPPPQAVLAKPKLWSLAEIATSSDKVKDGGGGSEGSPCPP
Erinaceus_europaeus|14285    -XX---XXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXXKVKDGGSKDVGSPGPP
Gallus_gallus|6061           ----------SVIHS-------PQQAALAKPKLWSLAEIATSADRARE-AGGETAAPGPA
Procavia_capensis|3504       -SG---LGGPSVIHS---PPPPPPQAVLTKPKLWSLAEIATSSDKVKDGGGGNEGSPCPP
Oryctolagus_cuniculus|7815   -PG---PGGPSVIHSPPPPPPPPPPAVLAKPKLWSLAEIATSSDKVKDGGGGGEGSPCPP
Monodelphis_domestica|25863  -SG---PSGPSVIHS-------PPQAVLAKPKLWSLAEIATSSDKSKEGGGGGGEGP-PP
Ochotona_princeps|10442      -XX---XXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPP
Microcebus_murinus|2107      -XX---XXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Rattus_norvegicus|11704      -PG---SGGSSVIHS-PPPPPPPPPAVLAKPKLWSLAEIATSSDKVKDGGGGSEGSPCPP
Mus_musculus|45956           -PG---SGGSSVIHS-PPPPPPPPPAVLAKPKLWSLAEIATSSDKVKDGGGGSEGSPCPP
Cavia_porcellus|13953        -PG---PGGPSVIHS---PPPPPPPAVLAKPKLWSLAEIATSSDKVKDGGGG-EGSPCPP
Otolemur_garnettii|3688      -PG---P-GPSVIHS---PPPPPPAAVLAKPKLWSLAEIATSSDKVKD-GGGSEGSPCPP
Canis_familiaris|14959       -PG---PGGPSVIHS---PPPPPPQAVLAKPKLWSLAEIATSSDKVKDGGGGSEGSPCPP
Rhesus_macaque|32381         -PG---PGGPSVIHS---PPPPPPPAVLAKPKLWSLAEIATSSDKVKDGGGGSEGSPCPP
Gorilla_gorilla|9612         -PG---PGGPSVIHS---PPPPPPPAVLAKPKLWSLAEIATSSDKVKDGGGGSEGSACPP
Homo_sapiens|55104           -PG---PGGPSVIHS---PPPPPPPAVLAKPKLWSLAEIATSSDKVKDGGGGNEGSPCPP
Pongo_abelii|7552            -PG---PGGPSVIHS---PPPPPPPAVLAKPKLWSLAEIATSSDKVKDGGGGSEGSPCPP
Pan_troglodytes|13157        -PG---PGGPSVIHS---PPPPPPPAVLAKPKLWSLAEIATSSDKVKDGGGGSEGSPCPP
Callithrix_jacchus|1166      -PG---PGGPSVIHS---PPPPPPPAVLAKPKLWSLAEIATSSDKVKDGGGGSEGSPCPP
Equus_caballus|20984         ------------------------------------------------------------
Bos_taurus|13591             -PG---PGGPSVIHS---PPPPPPQAVLAKPKLWSLAEIATSSDKVKDGGGGNEGSPCPP
Tupaia_belangeri|4785        -PG---PCGPSVIHS---PPPPPPPAVLVKPKLWSLAEIATSSDKVKDGGAGSEGSPCPP
Echinops_telfairi|1861       -PG---QGGPSVIHS---PPPPPPQAVLTKPKLWSLAEIATSSDKVKDGVGGSEGSPCPP
                                                                                         

Oryzias_latipes|16331        CPGLPQSAVMGTSAS------PSRS-SPQCPLPNSTVLSRPLYYTSPFYPGYTNYGGSFG
Tetraodon_nigroviridis|2922  CPGLPQSAVMGTNPS------PSRS-SPQCPLPNSTVLSRPLYYTSPFYPGYTNYGGSFG
Fugu_rubripes|25317          CPGLPQSAVMGSNPS------PSRS-SPQCPLPNTTVLSRPLYYTSPFYPGYTNYGGSFG
Macropus_eugenii|7660        GQGPTAGQTLAGSRSSPS---PARSPSAQCPFPGGAVLSRPLYYTAPFYPGYTNY-GSFG
Tarsius_syrichta|6537        XPGPMAGQALGGSRASPAPA-PSRSPSAHCHFPGGTVLSRPLYYTAPFYPGYTNY-GSFG
Xenopus_tropicalis|25078     ----VAGTTPAQSMVVSASS-PSRSPSAQCHFPSNTVLSRPLYYSNPFYPGYTNY-GTFS
Danio_rerio|13841            --------GLSQSTVIASAASPTRS-SPQCPLPNNTVLSRPIYYTSPFYPGYTNY-STFG
Gasterosteus_aculeatus|21599 ---------------------PSRS-SPQCPLPNSTVLSRPLYYTSPFYPGYTNYGGSFG
Dipodomys_ordii|6932         CPGPVAGQVLGGSRASPSPA-PSRSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNY-GSFG
Pteropus_vampyrus|7014       CPGPVSGQALGGSRASPAPA-PSRSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNY-GSFG
Erinaceus_europaeus|14285    CPGPVA-QALGGSRASPAPA-PSRSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNY-GSFG
Gallus_gallus|6061           VLG-------GGGPPRPSPP-RPRSPSAQCPFPNGAVLPRPLYYTAPFYPGYTNY-GSFG
Procavia_capensis|3504       CPGPVAGQALGGSRASPAPA-PSRSPSAQCAFPGGTVLSRPLYYTAPFYPGYTNY-GSFG
Oryctolagus_cuniculus|7815   WPGPVAGQGLGGSRASPAPAPPPRSPSAQCPFPGGAVLSRPLYYTAPFYPGYTNY-GSFG
Monodelphis_domestica|25863  GQGPTAGQTLPGSRSS--PT-PARSPSAQCPFPGGAVLSRPLYYTAPFYPGYTNY-GSFG
Ochotona_princeps|10442      CPGPVGGPALACSRASPAPT-PSRSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNY-GSFG
Microcebus_murinus|2107      XXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXSRPLYY-APFYPGYTNY-GSFG
Rattus_norvegicus|11704      CPGPIGGQTLGGSRASPAPA-PARSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNY-GSFG
Mus_musculus|45956           CPGPMGGQTLGGSRASPAPA-PARSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNY-GSFG
Cavia_porcellus|13953        CPGP-AGQALGGSRASPAPA-PSRSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNY-GSFG
Otolemur_garnettii|3688      CAGPIAGQALGGSRASPAPA-PSRSPSAQCPFPSGTVLSRPLYYTAPFYPGYTNY-GSFG
Canis_familiaris|14959       CPGPVAGQALGGSRASPAPA-PARSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNY-GSFG
Rhesus_macaque|32381         CPGPIAGQALGGSRASPTPA-PSRSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNY-GSFG
Gorilla_gorilla|9612         CPGPIAGQALGGSRASPAPA-PSRSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNY-GSFG
Homo_sapiens|55104           CPGPIAGQALGGSRASPAPA-PSRSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNY-GSFG
Pongo_abelii|7552            CPGPIAGQALGGSRASPAPA-PSRSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNY-GSFG
Pan_troglodytes|13157        CPGPIAGQALGGSRASPAPA-PSRSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNY-GSFG
Callithrix_jacchus|1166      CSGPIAGQALGGSRASPAPA-PSRSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNY-GSFG
Equus_caballus|20984         ------------------------------------------------------------
Bos_taurus|13591             CPGPVAGQALGGSRASPAPA-PSRSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNY-GSFG
Tupaia_belangeri|4785        CPGPVAGQALGGSRASPAPA-PSRSPSGQCPFPGGTVLSRPLYYTAPFYPGYTNY-GSFG
Echinops_telfairi|1861       CPGPVAGQALVGSRASPAPA-PSRSPSGQCPFPGGTVLSRPLYYTAPFYPGYTNY-GSFG
                                                                                         

Oryzias_latipes|16331        HLHSNHGSV----TTSSTAHFNGLNQTVLNRAEALVRESQKVRGQTQIDLCKDSPY-ELK
Tetraodon_nigroviridis|2922  HLHSTHGSV----TTGSTAHFNGLNQTVLNRAEALVRESQRVRGQTQVDLCKDFPY-ELK
Fugu_rubripes|25317          HLHSNHGSV----TTGSTAHFNGLNQTVLNRAEALVRESQRVRGQTQVDLCKDSPY-ELK
Macropus_eugenii|7660        HLHGHPGPG-PSPAPAPGPHFNGLNQTVLNRADALAKETKMLRSQSQLDLCKDSPF-ELK
Tarsius_syrichta|6537        HLHGHPGPG-PGATTGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQLDLCKDSPY-ELK
Xenopus_tropicalis|25078     HLHSHHGPSTTSPTVNSTHHFSGINQTVLNRAEALAKECK-LRSQSQADLNKDTPY-EMK
Danio_rerio|13841            HLHSSHGTN-----TSSTAHFNGLSQTVLNRAEALVRESK-VRSQTQVDLCKDSPY-ELK
Gasterosteus_aculeatus|21599 HLHGNHGSV----TTGSTAHFNGLNQTVLNRAEALVRESQKVRSQTQDEANSDSRYFQIN
Dipodomys_ordii|6932         HLHGHPGPG-PGPTTGPGSHFNGLNQTVLNRADTLAKDPKMLRNPSQL-LCKDSPY-E-K
Pteropus_vampyrus|7014       HLHGHPGPG---------------------------------------------------
Erinaceus_europaeus|14285    HLHGHPGPG-PGPTTGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQLDLCKDSPY-ELK
Gallus_gallus|6061           ALHGHPAGG-P---AAPGAAFNGLNQTVLSRAEGLGKEPKAARSQPQAELGKDSPY-ELK
Procavia_capensis|3504       HLHGHPGPG-PGPTAGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQLDLCKDSPY-ELK
Oryctolagus_cuniculus|7815   HLHGHPGPG-PGPATGPGSHFNGLNQTVLNRADALAKDPKVLRSASQLDLCKDSAY-ELK
Monodelphis_domestica|25863  HLHGHPGPG-PSPAPGPGPHFNGLNQTVLNRADALAKETKMLRSQSQLDLCKDSPF-ELK
Ochotona_princeps|10442      HLHGHPGTG-AGATSAPGSHFNGLNQTVLNRADTLAKDPKMLRSPSQLDLCKDSPY-ELK
Microcebus_murinus|2107      HLHGHPGPG-PGPTTGPGAHFNGLNQTVLNRADALAKDPKMLRSQSQLDLCKDSPY-ELK
Rattus_norvegicus|11704      HLHGHPGPG-PGPTAGPGSHFNGLNQTVLNRADVLAKDPKMLRSQSQLDLCKDSPY-ELK
Mus_musculus|45956           HLHGHPGPG-PSPTAGPGSHFNGLNQTVLNRADVLAKDPKMLRSQSQLDLCKDSPY-ELK
Cavia_porcellus|13953        HLHGHP-PG-PGPTTGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQLDLCKDSPY-ELK
Otolemur_garnettii|3688      HLHGHPGPG-TGPTTGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQLDPCKDSPY-ELK
Canis_familiaris|14959       HLHGHPGPG-PGPTTGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQLDLCKDSPY-ELK
Rhesus_macaque|32381         HLHGHPGPG-PGPTTGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQLDLCKDSPY-ELK
Gorilla_gorilla|9612         HLHGHPGPG-PGPATGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQLDLCKDSPY-ELK
Homo_sapiens|55104           HLHGHPGPG-PGPTTGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQLDLCKDSPY-ELK
Pongo_abelii|7552            HLHGHPGPG-PGPTTGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQLDLCKDSPY-ELK
Pan_troglodytes|13157        HLHGHPGPG-PGPTTGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQLDLCKDSPY-ELK
Callithrix_jacchus|1166      HLHGHPGPG-PGPTTGPGSHFNGLNQTVLNRADALAKDPKVLRSQSQLDLCKDSPY-ELK
Equus_caballus|20984         ------------------------------------------------------------
Bos_taurus|13591             HLHGHPGPG-PGPTTGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQLDLCKDSPY-ELK
Tupaia_belangeri|4785        HLHGHPGPG-PGPTTGPGSHFNGLNQTVLNRADALAKDPKMLRSPSQLDLCKDSPY-ELK
Echinops_telfairi|1861       HLHGHPGPG-PGP-TGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQLDLCKDSPY-ELK
                                                                                         

Oryzias_latipes|16331        KAYYTLFCQISVRPRS----
Tetraodon_nigroviridis|2922  KGMSNI--------------
Fugu_rubripes|25317          KGMSNI--------------
Macropus_eugenii|7660        KGMSDF--------------
Tarsius_syrichta|6537        KGMSDI--------------
Xenopus_tropicalis|25078     KGMSSI--------------
Danio_rerio|13841            KGMSNI--------------
Gasterosteus_aculeatus|21599 YGRKKMPVQRLFLVGVTLAP
Dipodomys_ordii|6932         KGSD----------------
Pteropus_vampyrus|7014       --------------------
Erinaceus_europaeus|14285    KGMSDI--------------
Gallus_gallus|6061           KGMSSI--------------
Procavia_capensis|3504       KGMSDI--------------
Oryctolagus_cuniculus|7815   KGMSDI--------------
Monodelphis_domestica|25863  KGMSDI--------------
Ochotona_princeps|10442      KGMSDI--------------
Microcebus_murinus|2107      KGMSDI--------------
Rattus_norvegicus|11704      KGMSDI--------------
Mus_musculus|45956           KGMSDI--------------
Cavia_porcellus|13953        KGMSDI--------------
Otolemur_garnettii|3688      KGMSDI--------------
Canis_familiaris|14959       KGMSDI--------------
Rhesus_macaque|32381         KGMSDI--------------
Gorilla_gorilla|9612         KGMSDI--------------
Homo_sapiens|55104           KGMSDI--------------
Pongo_abelii|7552            KGMSDI--------------
Pan_troglodytes|13157        KGMSDI--------------
Callithrix_jacchus|1166      KGMSDI--------------
Equus_caballus|20984         --------------------
Bos_taurus|13591             KGMSDI--------------
Tupaia_belangeri|4785        -GMSDI--------------
Echinops_telfairi|1861       KGMSDI--------------