Orthologs Set ID: EOG4006CG


Orthology Database
OrthoDB4
Gene Symbol(s)
RXRBB

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Fugu rubripes 14778 295, 529, 690, 820, 947, 989, 1081, 1187
Gasterosteus aculeatus 27916 141, 295, 475, 529, 690, 820, 947, 989, 1081, 1187
Oryzias latipes 6993 141, 295, 529, 690, 820, 947, 989, 1081, 1187
Tetraodon nigroviridis 16088 141, 295, 529, 690, 820, 947, 989, 1081, 1187

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Fugu rubripes 14778 ENSTRUT00000040804 101064914 ENSTRUG00000015903 RXRBETA fr2
Gasterosteus aculeatus 27916 ENSGACT00000010595 ENSGACG00000007982 rxrbb gasAcu1
Oryzias latipes 6993 ENSORLT00000008819 100125506 ENSORLG00000007020 rxrbb oryLat2
Tetraodon nigroviridis 16088 ENSTNIT00000021853 ENSTNIG00000018446 rxrbb tetNig2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Fugu rubripes 40662 ENSTRUP00000040662 101064914 ENSTRUG00000015903 RXRBETA fr2
Gasterosteus aculeatus 10156 ENSGACP00000010573 ENSGACG00000007982 rxrbb gasAcu1
Oryzias latipes 8261 ENSORLP00000008818 100125506 ENSORLG00000007020 rxrbb oryLat2
Tetraodon nigroviridis 4229 ENSTNIP00000021618 ENSTNIG00000018446 rxrbb tetNig2

multiple sequence alignment in CLUSTALW format


Oryzias_latipes|6993         ATGTCCTCACAGCTCCCTAACAGATCAGCCTCCAACAGTCCCACCAATCTCTTGGGTTCT
Gasterosteus_aculeatus|27916 ATGTCCTCACAGCAACCAGACAGTTCAGCCTCCAACAGCCCCACCAACATCTTGGGTTCT
Tetraodon_nigroviridis|16088 ---aacagGAAAGATGCACGTAATTCAGTCCTTTTTAGCTCCACCAACATTTTGGGATCT
Fugu_rubripes|14778          ------------------------------------------------------------
                                                                                         

Oryzias_latipes|6993         CCTTTTTCGGTGATCAGTTCTTCTCTTAGCCCATCCGTGGTCTCTTCTTCTCTGGGATTT
Gasterosteus_aculeatus|27916 CCCTTCTCCGTCATCAGTCCTTCACTCAACTCCCCGGTGGTCTCCCCCTCGCTCGGATTC
Tetraodon_nigroviridis|16088 CCTGTCACAGTTTTCAGCTCCTCGCTTAAATCGCCTGCCTTGACCTCTTCG---GGATTC
Fugu_rubripes|14778          ------------------------------------------------------------
                                                                                         

Oryzias_latipes|6993         GGACCCATCAGCAGCAATCAGATCTCTTCTTCAGCCCCAACATCAGGGATGCATTCAGTC
Gasterosteus_aculeatus|27916 GGACCCATCAGCAACAGTCAGATCTCTTCTTCAGCACCTACATCAGGGATGCACTCAATC
Tetraodon_nigroviridis|16088 ggatccatcagcagcagccagatttcttCATCCACGCCAGCGTCAGGGATGCACTCAATT
Fugu_rubripes|14778          ------------------------------------------------ATGCACTCAATT
                                                                             ***** ***.* 

Oryzias_latipes|6993         AGCAGCTCAGAGGATATCAAACCACCTTTTGGTCTGAGGCCCATGCAGTCTCACAGCCCA
Gasterosteus_aculeatus|27916 AGCAGCTCTGAAGATATCAAGCCTCCTTTTGGCCTGAGGCCTATGCCAGCTCACAGTCCT
Tetraodon_nigroviridis|16088 AGCAGCTCAGAAGATATCAAGCCTCCCTTCGGCTTGAGGCCTGTGCCAGCTCACAGTCCC
Fugu_rubripes|14778          AGCAGCTCGGAAGATATCAAGCCTCCCTTCGGCTTGAGGCCCGTGCCGGCTCACAGCCCC
                             ******** **.********.**:** ** **  ******* .***.. ******* ** 

Oryzias_latipes|6993         GGCATAATGCTGTCTCAAAAACgactgtgtgtgatctgtgggGACCGCTCCTCTGGCAAA
Gasterosteus_aculeatus|27916 GGAATAATGTTGTCTCAGAAACGCATGTGTGTCATCTGTGGAGACCGCTCTTCTGGCAAG
Tetraodon_nigroviridis|16088 ggactgatgatgtctcagaAACGCATGTGTGTTATTTGTGGAGACCGTTCTTCTGggAAA
Fugu_rubripes|14778          GGCCTGATGATGTCTCAGAAGCGCATGTGTGTCATTTGCGGGGACCGTTCTTCTGGGAAA
                             **..*.*** *******.**.**..******* ** ** **.***** ** ***** **.

Oryzias_latipes|6993         CACTACGGCGTGTACAGCTGTGAGGGGTGcaaaggctttttcaaacgAACTGTGCGCAAG
Gasterosteus_aculeatus|27916 CACTACGGAGTGTACAGCTGTGAGGGTTGCAAAGGTTTCTTCAAACGAACTGTGCGCAAA
Tetraodon_nigroviridis|16088 CACTACGGCGTGTACAGCTGTGAGGGCTGTAAAGGTTTCTTTAAAAGAACCGTGCGCAAA
Fugu_rubripes|14778          CACTACGGCGTTTACAGCTGCGAGGGCTGTAAAGGTTTCTTTAAAAGGACTGTGCGCAAA
                             ********.** ******** ***** ** ***** ** ** ***.*.** ********.

Oryzias_latipes|6993         GACTTGAGCTACACCTGCCGGGACAACAAAGAGTGCCTGGTCGACAAACGCCAGCGCAAC
Gasterosteus_aculeatus|27916 GACCTTAGCTATACCTGCAGAGATAACAAAGAGTGCCTGGTCGACAAACGCCAGCGCAAT
Tetraodon_nigroviridis|16088 GACCTGAGCTACACCTGCAGGGACAACAAAGAGTGTCTGGTGGACAAACGCCAGCGCAAC
Fugu_rubripes|14778          GACCTGAGCTACACCTGCAGGGACAACAAAGAGTGTCTGGTGGACAAACGCCAGCGCAAC
                             *** * ***** ******.*.** *********** ***** ***************** 

Oryzias_latipes|6993         CGCTGCCAGTACTGCCGCTATCAGAAGTGCCTGGCCATGGGCATGAAGAGGGAA------
Gasterosteus_aculeatus|27916 CGCTGCCAGTACTGCCGCTACCAGAAGTGCCTGGCCATGGGCATGAAGAGGGAAGTGATC
Tetraodon_nigroviridis|16088 CGCTGCCAGTACTGCCGCTATCAGAAGTGCCTGGCCATGGGCATGAAGAGGGAA------
Fugu_rubripes|14778          CGCTGCCAGTACTGCCGCTATCAGAAGTGCCTGGCCATGGGCATGAAGAGGGAA------
                             ******************** *********************************      

Oryzias_latipes|6993         ------------------------------------------------GcgGTTCAGGAG
Gasterosteus_aculeatus|27916 AAACATGTAAAGTGGATAAAAGAAGATGGAAAAGATGAGGGATGGATGACGGTCCAGGAG
Tetraodon_nigroviridis|16088 ------------------------------------------------GCGGTCCAGGAG
Fugu_rubripes|14778          ------------------------------------------------GCAGTCCAGGAG
                                                                             .*.** ******

Oryzias_latipes|6993         GAACGGCAGAGGAACAGAGAGCGTGAGGGGGAGCTGGAGTTCAGCGTTGGGGTGAATGAT
Gasterosteus_aculeatus|27916 GAGCGCCAGAGGAACCGAGAGCGCGAAGGAGAGCTGGAGTTCAGCGTCGGAGTAAATGAG
Tetraodon_nigroviridis|16088 GAGCGCCAGAGGAACAGAGAGCGCGAAGGGGAGCTGGAGTTCAGCGTCAGCGTGAACGAG
Fugu_rubripes|14778          GAGCGCCAGAGGAACCGAGAGCGCGAAGGGGAGCTGGAGTTCAGCGTCAGCGTGAACGAG
                             **.** *********.******* **.**.***************** .* **.** ** 

Oryzias_latipes|6993         GAGATGCCTGTGGAAAAGATCCTGGAGGCCGAGACGGCCGTGGAGCAGAAGACCGAGCTT
Gasterosteus_aculeatus|27916 GAGATGCCCGTCGAGAAGATTTTAGAGGCAGAAACTGCTGTGGAGCAGAAGACCGAGCTT
Tetraodon_nigroviridis|16088 GAGATGCCCGTGGAGAAGATCTTGGCGGCAGAGACGGCCGTGGAGCAGAAAACTGAGCTA
Fugu_rubripes|14778          GAGATGCCCGTGGAGAAGATCTTGGCGGCGGAGACGGCCGTGGAGCAGAAAACCGAGCTG
                             ******** ** **.*****  *.*.*** **.** ** ***********.** ***** 

Oryzias_latipes|6993         CACTCTGACGGAGGATCTGCAGGAAACTCCCCCCATGATGCTGTTTCCAACCTCTGTCAG
Gasterosteus_aculeatus|27916 CACTCTGATGGTGGTTCTGCAGGCAACTCTCCCCATGATGCAGTTACCAACATCTGTCTG
Tetraodon_nigroviridis|16088 CACTCTGACGGCGTTTCCTCCGGCAACTCTCCTCATGATGCAGTGTCCAACATCTGCCAG
Fugu_rubripes|14778          CACTCCGACGGCGTTTCCGCTGGCAACTCTCCTCACGATGCCGTGTCCAACATCTGCCAG
                             ***** ** ** * :**  * **.***** ** ** ***** ** :*****.**** *:*

Oryzias_latipes|6993         ACTGCAGACAAACAGCTGTTTGCTTTGGTGGAATGGGCAAAAAGAATCCCTCATTTCTCT
Gasterosteus_aculeatus|27916 ACTGCGGACAAACAGCTGTTTGCCTTGGTGGAGTGGGCGAAGAGAATCCCTCATTTCTCC
Tetraodon_nigroviridis|16088 ACCGCAGACAAACAGCTGTTTGCTTTAGTGGAGTGGGCAAAGAGAATCCCTCACTTCTCT
Fugu_rubripes|14778          ACTGCAGACAAGCAGCTGTTTGCTTTAGTGGAGTGGGCGAAGAGAATCCCTCACTTCTCC
                             ** **.*****.*********** **.*****.*****.**.*********** ***** 

Oryzias_latipes|6993         GAGCTGCCGCTTGATGATCAGGTCATCCTTCTGCGTGCAGGGTGGAACGAGCTCCTGATT
Gasterosteus_aculeatus|27916 GAGCTGCCCCTTGATGACCAGGTCATCCTCTTGCGTGCAGGGTGGAATGAGCTCCTCATT
Tetraodon_nigroviridis|16088 GAACTACCACTGGAGGACCAGGTCATTCTCCTCCGCGCAGGCTGGAACGAGCTGCTCATC
Fugu_rubripes|14778          GAACTACCACTAGAGGACCAGGTCATCCTCCTCCGTGCAGGCTGGAACGAGCTGCTCATC
                             **.**.** ** ** ** ******** **  * ** ***** ***** ***** ** ** 

Oryzias_latipes|6993         GCCTCGTTTTCCCATCGATCCATCCCTCTGAAAGACGGAGGTTCTCTGGCATCTGAGCTG
Gasterosteus_aculeatus|27916 GCCTCGTTCTCCCACCGCTCCATTGGTTTGAAGGACGGAGTTCTCCTGGCCTCTGAGCTG
Tetraodon_nigroviridis|16088 GCGTCATTCTCCCACCGCTCCATCAATTCCAAAGATGGAGTCCTGCTGGCGTCTGAGCTC
Fugu_rubripes|14778          GCGTCATTCTCCCACCGCTCCATCAACTCCAAAGACGGCGTCCTGCTGGCCTCGGAGCTG
                             ** **.** ***** **.*****       **.** **.*     ***** ** ***** 

Oryzias_latipes|6993         CAGCGCGACGGCTCCCACGCTGCTGGAGTTGGAGCCATTTTTGATAGGGAGAGTGTGCAG
Gasterosteus_aculeatus|27916 CAGCGCGACAATGCACAGAGTGCAGGAGTTGGAGCCATTTTTGACAGGGAGAGTGTGCAG
Tetraodon_nigroviridis|16088 CAGCGGGACAGCGCGAACAGCGCGGGAGTGGGCGCCATCTTTGACAGGGAGAATGTGCAG
Fugu_rubripes|14778          CAGCGGGACAGCGCCAACAGCGCGGGAGTGGGAGCCATCTTCGACAGGGAGAACGTGCAG
                             ***** ***..  * .* .  ** ***** **.***** ** ** *******. ******

Oryzias_latipes|6993         AGTGCAGAAGTCGGCGCCATATTTGACAGgGTTCTTACTGAGCTCGTCAACAAAATGAGA
Gasterosteus_aculeatus|27916 AGTGCCGAGGTCGGCGCCATATTTGACAGGGTTCTTACGGAGCTCGTCAATAAAATGAGA
Tetraodon_nigroviridis|16088 AGTGCAGAAGTCGGGGCCATCTTTGACAGGGTCCTGACCGAGCTCGTCAATAAAATGAGA
Fugu_rubripes|14778          AGCGCAGAGGTCGGGGCCATCTTTGACAGGGTCCTGACCGAGCTCGTCAATAAAATGAGA
                             ** **.**.***** *****.*********** ** ** *********** *********

Oryzias_latipes|6993         GACATGCAAATGGACAAAACTGAGCTTGGCTGCCTTCGAGCTATTGTTCTGTTTAATCCA
Gasterosteus_aculeatus|27916 GATATGCAAATGGACAAAACAGAGCTGGGCTGCCTCCGAGCCATCGTACTGTTCAACCCA
Tetraodon_nigroviridis|16088 GACATGCAAATGGACAAGACGGAGCTCGGCTGCCTGCGAGCCATCGTCCTCTTCAACCCA
Fugu_rubripes|14778          GATATGCAAATGGACAAGACGGAGCTCGGCTGCCTGCGAGCCATCGTCCTCTTCAACCCA
                             ** **************.** ***** ******** ***** ** ** ** ** ** ***

Oryzias_latipes|6993         GATGCTAAAGGGCTCTCTAACACAAGTGAGGTGGAGCTCCTCAGAGAAAAGGTCTATGCA
Gasterosteus_aculeatus|27916 GATGCTAAAGGGCTTTCAAACACCGGTGAGGTAGAGCTCCTCAGAGAAAAGGTCTATGCA
Tetraodon_nigroviridis|16088 GATGCAAAAGGACTTTCCAAATCCAGtgaggtggagctgctcagagagaaGGTCTATGCC
Fugu_rubripes|14778          GATGCAAAAGGACTTTCCAAATCCAGCGAGGTGGAGCTGCTCCGAGAGAAGGTCTACGCG
                             *****:*****.** ** **.:*..* *****.***** ***.****.******** ** 

Oryzias_latipes|6993         TCATTGGAAGCTTACTGCAAACAAAAGTATCCAGAGCAGCAGGGAAGGTTTGCTAAGCTC
Gasterosteus_aculeatus|27916 TCATTGGAGGCGTACTGCAAACAGAAATACCCAGAGCAGCAGGGAAGGTTTGCTAAGCTC
Tetraodon_nigroviridis|16088 TCGCTGGAGGCCTACTGCAAACAGAGAtacccagagcagcagggaagGTTCGCCAAGCTC
Fugu_rubripes|14778          TCGCTGGAGGCCTACTGCAAACAGAGATACCCGGAGCAGCAGGGAAGATTCGCCAAGCTC
                             **. ****.** ***********.*..** **.**************.** ** ******

Oryzias_latipes|6993         CTCCTCCGACTGCCAGCACTGCGATCCATTGGCTTGAAGTGCTTGGAGCACCTCTTTTTC
Gasterosteus_aculeatus|27916 CTCCTTCGGCTGCCGGCGCTGCGATCCATCGGCTTGAAGTGCTTGGAGCATCTTTTCTTT
Tetraodon_nigroviridis|16088 CTCCTGCGGCTGCCGGCCCTGCGATCCATCGGCTTGAAGTGCTTGGAGCACCTGTTCTTC
Fugu_rubripes|14778          CTCCTCCGCCTGCCGGCGCTGCGCTCCATCGGCTTGAAGTGCTTGGAGCACCTGTTCTTC
                             ***** ** *****.** *****.***** ******************** ** ** ** 

Oryzias_latipes|6993         TTCAAGCTGATTGGTGACACACCTATTGACACTTTCCTCATGGAAATGCTTGAAGCTCCC
Gasterosteus_aculeatus|27916 TTCAAGCTGATCGGCGACACACCTATTGACACTTTCCTCATGGAAATGCTAGAAGCTCCC
Tetraodon_nigroviridis|16088 TTCAAGCTGATCGGTGACACACCTATCGACACTTTCCTCATGGAAATGCTTGAAGCTCCC
Fugu_rubripes|14778          TTTAAGCTGATCGGTGACACACCTATCGACACTTTCCTCATGGAAATGCTTGAAGCCCCC
                             ** ******** ** *********** ***********************:***** ***

Oryzias_latipes|6993         CATCAGTTGTCTTAG
Gasterosteus_aculeatus|27916 CATCAGTTGTCATAG
Tetraodon_nigroviridis|16088 CATCATTTGTCTTAG
Fugu_rubripes|14778          CATCATTTGTCTTAG
                             ***** *****:***

multiple sequence alignment in CLUSTALW format


Oryzias_latipes|8261         MSSQLPNRSASNSPTNLLGSPFSVISSSLSPSVVSSSLGFGPISSNQISSSAPTSGMHSV
Gasterosteus_aculeatus|10156 MSSQQPDSSASNSPTNILGSPFSVISPSLNSPVVSPSLGFGPISNSQISSSAPTSGMHSI
Tetraodon_nigroviridis|4229  -NRKDARNSVLFSSTNILGSPVTVFSSSLKSPALTSS-GFGSISSSQISSSTPASGMHSI
Fugu_rubripes|40662          --------------------------------------------------------MHSI
                                                                                     ***:

Oryzias_latipes|8261         SSSEDIKPPFGLRPMQSHSPGIMLSQKRLCVICGDRSSGKHYGVYSCEGCKGFFKRTVRK
Gasterosteus_aculeatus|10156 SSSEDIKPPFGLRPMPAHSPGIMLSQKRMCVICGDRSSGKHYGVYSCEGCKGFFKRTVRK
Tetraodon_nigroviridis|4229  SSSEDIKPPFGLRPVPAHSPGLMMSQKRMCVICGDRSSGKHYGVYSCEGCKGFFKRTVRK
Fugu_rubripes|40662          SSSEDIKPPFGLRPVPAHSPGLMMSQKRMCVICGDRSSGKHYGVYSCEGCKGFFKRTVRK
                             **************: :****:*:****:*******************************

Oryzias_latipes|8261         DLSYTCRDNKECLVDKRQRNRCQYCRYQKCLAMGMKRE------------------AVQE
Gasterosteus_aculeatus|10156 DLSYTCRDNKECLVDKRQRNRCQYCRYQKCLAMGMKREVIKHVKWIKEDGKDEGWMTVQE
Tetraodon_nigroviridis|4229  DLSYTCRDNKECLVDKRQRNRCQYCRYQKCLAMGMKRE------------------AVQE
Fugu_rubripes|40662          DLSYTCRDNKECLVDKRQRNRCQYCRYQKCLAMGMKRE------------------AVQE
                             **************************************                  :***

Oryzias_latipes|8261         ERQRNREREGELEFSVGVNDEMPVEKILEAETAVEQKTELHSDGGSAGNSPHDAVSNLCQ
Gasterosteus_aculeatus|10156 ERQRNREREGELEFSVGVNEEMPVEKILEAETAVEQKTELHSDGGSAGNSPHDAVTNICL
Tetraodon_nigroviridis|4229  ERQRNREREGELEFSVSVNEEMPVEKILAAETAVEQKTELHSDGVSSGNSPHDAVSNICQ
Fugu_rubripes|40662          ERQRNREREGELEFSVSVNEEMPVEKILAAETAVEQKTELHSDGVSAGNSPHDAVSNICQ
                             ****************.**:******** *************** *:********:*:* 

Oryzias_latipes|8261         TADKQLFALVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIPLKDGGSLASEL
Gasterosteus_aculeatus|10156 TADKQLFALVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIGLKDGVLLASEL
Tetraodon_nigroviridis|4229  TADKQLFALVEWAKRIPHFSELPLEDQVILLRAGWNELLIASFSHRSINSKDGVLLASEL
Fugu_rubripes|40662          TADKQLFALVEWAKRIPHFSELPLEDQVILLRAGWNELLIASFSHRSINSKDGVLLASEL
                             ************************:***********************  ***  *****

Oryzias_latipes|8261         QRDGSHAAGVGAIFDRESVQSAEVGAIFDRVLTELVNKMRDMQMDKTELGCLRAIVLFNP
Gasterosteus_aculeatus|10156 QRDNAQSAGVGAIFDRESVQSAEVGAIFDRVLTELVNKMRDMQMDKTELGCLRAIVLFNP
Tetraodon_nigroviridis|4229  QRDSANSAGVGAIFDRENVQSAEVGAIFDRVLTELVNKMRDMQMDKTELGCLRAIVLFNP
Fugu_rubripes|40662          QRDSANSAGVGAIFDRENVQSAEVGAIFDRVLTELVNKMRDMQMDKTELGCLRAIVLFNP
                             ***.:::**********.******************************************

Oryzias_latipes|8261         DAKGLSNTSEVELLREKVYASLEAYCKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFF
Gasterosteus_aculeatus|10156 DAKGLSNTGEVELLREKVYASLEAYCKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFF
Tetraodon_nigroviridis|4229  DAKGLSKSSEVELLREKVYASLEAYCKQRYPEQQGRFAKLLLRLPALRSIGLKCLEHLFF
Fugu_rubripes|40662          DAKGLSKSSEVELLREKVYASLEAYCKQRYPEQQGRFAKLLLRLPALRSIGLKCLEHLFF
                             ******::.*******************:*******************************

Oryzias_latipes|8261         FKLIGDTPIDTFLMEMLEAPHQLS
Gasterosteus_aculeatus|10156 FKLIGDTPIDTFLMEMLEAPHQLS
Tetraodon_nigroviridis|4229  FKLIGDTPIDTFLMEMLEAPHHLS
Fugu_rubripes|40662          FKLIGDTPIDTFLMEMLEAPHHLS
                             *********************:**