Orthologs Set ID: EOG4006CH


Orthology Database
OrthoDB4
Gene Symbol(s)
GM12015,GK19735,GD15827

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Drosophila melanogaster 21724
Drosophila sechellia 2865 386
Drosophila simulans 15598
Drosophila willistoni 9448
Drosophila yakuba 12048

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Drosophila melanogaster 21724 FBtr0073973, NM_167420 318104 FBgn0052591 CG32591 dm3
Drosophila sechellia 2865 FBtr0195000 6619578 FBgn0166956 GM12015 droSec1
Drosophila simulans 15598 FBtr0215737 6725973 FBgn0187485 GD15827 droSim1
Drosophila willistoni 9448 FBtr0250386 6641239 FBgn0221733 GK19735 r1.3
Drosophila yakuba 12048 FBtr0262598 6524769 FBgn0233628 GE16080 droYak2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Drosophila melanogaster 20093 FBpp0073790 318104 FBgn0052591 CG32591 dm3
Drosophila sechellia 2026 FBpp0193492 6619578 FBgn0166956 GM12015 droSec1
Drosophila simulans 5993 FBpp0214229 6725973 FBgn0187485 GD15827 droSim1
Drosophila willistoni 9547 FBpp0248878 6641239 FBgn0221733 GK19735 r1.3
Drosophila yakuba 6466 FBpp0261090 6524769 FBgn0233628 GE16080 droYak2

multiple sequence alignment in CLUSTALW format


Drosophila_willistoni|9448    ---ATGTCTTTGAATCGCGTCAATCGTAATGGACGTGACTTTCTGCAGGAGAACAAACAG
Drosophila_yakuba|12048       ATGTCCACACTGCGGCGATCACATGGCGGTGGTCGTGATTTTCTGCAAGAGAACAAGCTA
Drosophila_melanogaster|21724 ATGTCCGCACTACGGCGATCACATGGCGGAGGTCGTGATTTTCTGCAGGAGAACAAGCAA
Drosophila_sechellia|2865     ATGTCCGCACTACGGCGATCACATGGCGAAGGTCGTGATTTTCTGCAGGAGAACAAGCTA
Drosophila_simulans|15598     ATGTCCGAACTACGGCGATCACATGGCGGAGGTCGTGACTTTCTGCAAGAGAACAAGCAA
                                 :   .: *... **.  ..** * ..:**:***** ********.********.*:.

Drosophila_willistoni|9448    AAAGTGGCCCACTGGGAGACCAATGGACGACTGACGGCCGCTGCAGCTGCCAAGCGGGTG
Drosophila_yakuba|12048       AATGTGACCAGGATGGAGACCAATGGCCGGTGTCTAGCTGCGGCCAATGCCCGTCGTGTG
Drosophila_melanogaster|21724 AATGTGTCTAGAATGGAGACCAATGGCAGATGTATAGCGGCGGCCAATGCCCGTCGTGTT
Drosophila_sechellia|2865     AATGTGTCCAGGATGGAGACCAATGGTAGGTGTATAGCTGCGGCCAATGCCCGTCGTGTG
Drosophila_simulans|15598     AATGTGTCCAGGATGGAGACCAATGGTAGGTGTATAGCTGCGGCCAATGCCCGTCGTGTG
                              **:*** * .. : ************ .*.   . .** ** **...****.. ** ** 

Drosophila_willistoni|9448    AATCTCTGGCGTCCTGTGGTGCTGCACTATTCCTCAGGACTGCGTCCTTTTGGCCAGCGT
Drosophila_yakuba|12048       CCCCTGTGGCGTCCAGTGGTGCTCCACTATTCGGAGAAGGTGCGTCCCCATGTCTACAGT
Drosophila_melanogaster|21724 CCCCTGTGGCGTCCAGTGGTCCTCCACTATCCGGAGAAGTTGCGTCCCCATGTCTACAAT
Drosophila_sechellia|2865     CCCCTGTGGCGTCCAGTGGTCCTGCACTACACGGAGAAGTTGCGTCCCCATGCCTACAAT
Drosophila_simulans|15598     CCCCTGTGGCGTCCAGTGGTCCTGCACTACACGGAGAAGTTGCGTCCCCATGCCTACAAT
                              .. ** ********:***** ** *****  *  ..... *******  :** * * ..*

Drosophila_willistoni|9448    ACT---AACACACGTACACGCAACTCTGTGCCATTACATGAATCGGGTAAGATGCATTCG
Drosophila_yakuba|12048       ACTAACCAGCGTCGTGCACGCCCGCTACACGGTGCCCATGAGTCTCCGCGTCTGCGAAGC
Drosophila_melanogaster|21724 ATT---CAGCGTCGTACACGCCCGCTGCACGGAGCCCATGAGTCTCCTCGCCTGCGAAGC
Drosophila_sechellia|2865     GTC---CAACGTCGTCCACGCCAGTTACACGGAGCTCATGAGTCTCCCCGCTTGCGAGGC
Drosophila_simulans|15598     GTC---CAACGTCGTCCACGCCAGTTACACGGAGCCCATGAGTCTCCCCGCCTGCGGGGC
                              .     .* . :*** *****..     :   :   *****.**    ..  ***.    

Drosophila_willistoni|9448    GGATTGGCCCAGCCCTATGGTTTCCATCAGGAGGAGCGTCCAGTGCGTCCATTGACTCGT
Drosophila_yakuba|12048       GGTCTTGCCCAGCCATATGGATTCCAAAACGAGATGCGCCGCCGGTTGCCACCAAATCCG
Drosophila_melanogaster|21724 GGTCTTGCCCAGCCGTATGGCTTTCACAACGAGATGCGCCGCAGGATGCCACCAAATCCC
Drosophila_sechellia|2865     GGTCTTGCCCAGCCGTATGGATTTCACAACGAGATGCGCCGCCGGATGCCACCAAATTCC
Drosophila_simulans|15598     GGTCTTGCCCAGCCGTATGGCTTTCACAACGAGATGCGCCGCCGGATGCCACCAAATTCC
                              **: * ******** ***** ** ** .* ***.:*** * .  *   ***  .*.*   

Drosophila_willistoni|9448    GCAGCCAGACACATGGCCAAGCAGCAAAAGGGAATGGGGGACGAGAAGGGGCGCCAAGGC
Drosophila_yakuba|12048       TGTGGTTGCGATGTGCCCACACGTAAGACGGAGGAGCGTAAGGAGCAGGAGCGCCTCCAG
Drosophila_melanogaster|21724 TGTGGTTGCGATTTGACCACACGTAAAACGGTGGAACGTAAGGAGCAGGAGCGCCTACAG
Drosophila_sechellia|2865     ATG---------------------------------------------------------
Drosophila_simulans|15598     TGTGGTTGCGATTCGACCACGCGTAAATCGGAGGAACGTAAGGAGCAGGAGCGCCTACAG
                                                                                          

Drosophila_willistoni|9448    GGTGGC---------GATTCCAGTCGTATGGCCAAGCAAACACAAACCCAGACCCAATCC
Drosophila_yakuba|12048       GGCGGTTGGGAGGATCAGCAAGTGAAGTTGCCAAGGAAATGCTGCACCGGTTGCAACTGC
Drosophila_melanogaster|21724 GGCGGTTGGGAG------GATCAGCAAGTGCCAAGGAAATGCTGCTCCGGTTGCACCTGC
Drosophila_sechellia|2865     ------TGGTTGCGATTTGACCACACGGTCACCAGGCAA---------------------
Drosophila_simulans|15598     GGCGGTTGGGAG------GATCAGCAAAAGCAAAGGAAATGCTGCTCCGGTTGCACCTGC
                                                 .    .   :  ..*.*.**                     

Drosophila_willistoni|9448    CAGACGGGA------------GAAATCAGGGATTCGCGTTTGGCAAAGAAATCTCTGCCC
Drosophila_yakuba|12048       CTTCACGGCTATCCCAATACCAATCCATCTGATCAGAGTAACAAGGTGGAGGCGGTGTCA
Drosophila_melanogaster|21724 CATCACGGCTATCCGACTAATAAGCCATCTGATCAGGATCACCAGGCAAAGGAGGTGTCA
Drosophila_sechellia|2865     ------------------------------------------------AGGGCGGTGCCG
Drosophila_simulans|15598     CATCACGGCTATCCGACTAATACACCATCTGATCAGGGTGACCAGGCAAAGGCGGTGCCG
                                                                              ... .  ** * 

Drosophila_willistoni|9448    AAAAGTGATCACCAGCATGTAGGACAATTG---------GACCAAGTCGAGCAGCCACCG
Drosophila_yakuba|12048       CAG------------------------------------CATCAAGGTCAACAGTCGGAA
Drosophila_melanogaster|21724 CAGCAT---CAGGGTCACCACGGCCAAGCAGTTGCTCCACATCAGGGTCAACAATCGGAA
Drosophila_sechellia|2865     CAGCAT---GAGGGTCAGCACGGCCAAGCAGTTGCTCCACATCAGGGCCAACAATCGGAA
Drosophila_simulans|15598     CAGCCTGGTGAGGGTCACCACGGCCAAGCAGTTGCTCCACATCAGGGCCAACAATCGGAA
                              .*.                                     * **.*   *.**. *. ..

Drosophila_willistoni|9448    ACGTCGTTGGCGGTGCCGAAACAGACTGGCGAT---GATGAAGATGATGCCCTATCGGTC
Drosophila_yakuba|12048       ATGGATGGCCCAATGCCAACCAAACAGGGCGAAGGTGATCAGGCGGATCGCGTTTCGGTA
Drosophila_melanogaster|21724 ACGGATGGCCAAATCCAACCAAAACATGGCGAAGGTGATCAGGCCGATCGCATTTCGGTA
Drosophila_sechellia|2865     ACGGATGGCCAAATCCAACCCAAACATGGCGAAGGTGATGAGGCCGATCGCATTTCGGTA
Drosophila_simulans|15598     ACGGATGGCCAAATCCAACCAAAACATGGCGAAGGTGATCAGGCCGATCGCATTTCGGTA
                              * * .     ...* *......*... *****:   *** *.*. ***  * *:*****.

Drosophila_willistoni|9448    TACTCGTTGAGA------------------TCTAAGGCATCGCAACGCTCGAACATATCA
Drosophila_yakuba|12048       TGCTCTCGCATG---------------------------TCCCGAGTATCCCGGGCATCC
Drosophila_melanogaster|21724 TGCTCCCGCATGTCCCAAGAATCCCGGGCATCTCGGGCATCTCGGGCATCTCGGGCGTCT
Drosophila_sechellia|2865     TGCTCCCGCATG------------------TCTCGAGCATCCCGGGCATCTCAGGCGTCT
Drosophila_simulans|15598     TGCTCCCGCATG------------------TCTGGAGCATCCCGGGCATCTCAGGCATCA
                              *.***    * .                           ** *..  .** .. . .** 

Drosophila_willistoni|9448    AAAATTTCGAAAAAATCCTCTCTACATTTGGCA---GGGGAAGGCGGCGATGAG---GAG
Drosophila_yakuba|12048       CAGGCGTCTCGTCGATCCCAGGCAAAGTCCACCCAGGGCGAGGGAACCAACGATCCGGAG
Drosophila_melanogaster|21724 CGGGCGTCTCGTCGCTCCGAGGCACAGTCAACACAGGGCCAGGGAAACAACGATCCCGAG
Drosophila_sechellia|2865     CTGGCGTCTTGTCGTTCCCAGGCAAAGTCAACACAGGCCCAGGAGAACAACGAACCCGAG
Drosophila_simulans|15598     CAGGCGTCTCGTCGCTCCCAGGCAAAGTCTACACAGGCCCAGGAGAACAACGAACCCGAG
                              . ..  **  .:.. *** .   *.* *  .*.   *   *.*. . *.* **    ***

Drosophila_willistoni|9448    GCTCCCCTAAGTGCTCGCAGTAACGCCTCATTGAAGACTATCAAATCAGCAGCTACGGTT
Drosophila_yakuba|12048       GCGCCCTTGAGTGCGCGCAGCGGTGCCTCCGCCAAGACCCTCAAATCCAAGCGATCCGTT
Drosophila_melanogaster|21724 GCACCCTTGAGCGCTCGCAGCAGTGCCTCCACAAAGACCCTCAAGTCCAAGCGATCCGTT
Drosophila_sechellia|2865     GCACCCTTGAGCGCTCGCAGCAGTGCCTCCACAAAGACCATCAAGTCCAAGCGATCCGTA
Drosophila_simulans|15598     GCACCCTTGAGCGCTCGCAGCAGTGCATCCACAAAGACCATCAAGTCCAAGCGATCCGTT
                              ** *** *.** ** ***** .. **.**.   ***** .****.**....  ::* **:

Drosophila_willistoni|9448    AGATCAACGTGCAGTGTCAAATCCCGGGCCACCATCAAGTCCGTGGAGTCAGTCAAGTCT
Drosophila_yakuba|12048       ---------------------------------------TCCCAGGAGAGCGTACGCTCG
Drosophila_melanogaster|21724 ---------------------------------------TCCCAGGAGAGTGTGCGCTCG
Drosophila_sechellia|2865     ---------------------------------------TCCCAGGAGAGTGTGTGCTCG
Drosophila_simulans|15598     ---------------------------------------TCCCAGGAGAGTGTGCGCTCG
                                                                     *** :****:  **  . ** 

Drosophila_willistoni|9448    CAGGCCACGCTCAAGTCTCATATGTCGCACAAGTCGCACAAGTCGAATGCCACCCTAAAG
Drosophila_yakuba|12048       AATGCCACCATCAAGTCGAACATCACTGTGGCCTCCAGGAGCACCACGGCCTCGAAACGA
Drosophila_melanogaster|21724 AATGCCACCATCAAGTCGAACATTACTGTGGCCTCCAGAAGCACCACGGCTTCGAAGAGA
Drosophila_sechellia|2865     AATGCCACCATCAAGTCGAATGTTACTGTGGCCTCCAGAAGCACCAATGCTTCGAAGAGA
Drosophila_simulans|15598     AATGCCACCATCAAGTCGAACGTTACTGTGGCCTCCAGAAGCACCACGGCTTCGAAGAGA
                              .* ***** .******* .* .* :*  : .. ** .. *. :* *. ** :* .:....

Drosophila_willistoni|9448    TCTCATGTCTCTGGGAAGTCGAGGGCTTCATCCACAGCCAAGTCGCAGGTTAGTCGTCGT
Drosophila_yakuba|12048       TCTCACGTCAGTCGCAAGTCGCAGTTAATGGAGGTGATGCCGCCACCGACCCACTTG---
Drosophila_melanogaster|21724 TCTCAAGTCAGTCGCAAGTCGAAGTTAATGGAGGTAATGCCGCCACCAACCCACTTG---
Drosophila_sechellia|2865     TCTCAAGTCAGTCGCAAGTCGAAGTTAATGGAGGTAATGCCGCCACCAACCCACTTG---
Drosophila_simulans|15598     TCTCAAGTCAGTCGCAAGTCGAAGTTAATGGAGGTAATGCCGCCACCAACCCACTTG---
                              ***** ***: * * ******..*  :: . . . ..  ..* *.*...  ..       

Drosophila_willistoni|9448    TTTGTGGCAGGCGGCGAATCATCCATGCCCCAGAAGAGTCCATCTAGCACAGGACACATG
Drosophila_yakuba|12048       ---------------GAGGATCAGAGGCCCAAGGAGAGGGAGAGGGAGAGGGAGAAGGAG
Drosophila_melanogaster|21724 ---------------GAGGATCGTAGGCCCAAGGAGCGAGAGAAGGAG------------
Drosophila_sechellia|2865     ---------------GAGGATCGAAGGCCCCAGGAGCGAGAGAAGGAG------------
Drosophila_simulans|15598     ---------------GAGGATCGAAGGCCCAAGGAGCGAGAGAAGGAG------------
                                             **. .:   * ****.**.**.*  ..:  ..             

Drosophila_willistoni|9448    GAGGGCCCTTGTTGTTGTTCCCAGCAGAGTCACATGGAA---AATGAGCGCCTGGCTGCC
Drosophila_yakuba|12048       AAGGTGCCAACCGCCATTGAGGGCTACACACCGTTGACCGCCAGCGAGCGGCAGGCGGCT
Drosophila_melanogaster|21724 AAGGCGCCAACTGCCATCGAAGGCTACACACCGTTGACGCCCAGCGAGAGACAGGCTGCT
Drosophila_sechellia|2865     AAGGCGCCAACTGCCATCGAAGGCTACACACCGTTGACAGCCAATGAGAGACAGGCTGCT
Drosophila_simulans|15598     AAGGCGCCCACTGCCATCGAAGGCTACACACCGTTGACACCCAACGAGAGACAGGCTGCT
                              .***  ** :     :   .  .  * * :*. :**..    *. ***.* *:*** ** 

Drosophila_willistoni|9448    TTGAATGAAGCCCACTACAAGTACGGCAAACTGATTGAGGAGTATAATCACATGCCCGTA
Drosophila_yakuba|12048       CTGCAGGATGCCCACATAAAGTACAGTAAGCTGGTCGAGGAATACAATCATATGCCCGTT
Drosophila_melanogaster|21724 CTCCAGGATGCCCACGTTAAATATAGTAAGCTGGTCGAGGAATACAATCGTATGCCCGTT
Drosophila_sechellia|2865     CTCCAGGATGCCCACATAAAATATAGCAAGCTGGTGGAGGAATACAATCGTATGCCCGTT
Drosophila_simulans|15598     CTCCAGGATGCCCACATAAAGTATAGCAAGCTGGTCGAGGAATACAATCGTATGCCCGTT
                               * .* **:****** : **.** .* **.***.* *****.** ****. ********:

Drosophila_willistoni|9448    TCGGAGCCAACATTGCGGGTACGTAATCGAAAGGCTGCCATCGAACGAGAACTCGATCAA
Drosophila_yakuba|12048       TCGGAGCCAACTCTGCGCGTGCGCAATCGGAAAATCGCCATCGAGCGGCAGCTGGACGAG
Drosophila_melanogaster|21724 TCTGAGCCAACTTTGCGCGTGCGCAATCGAAAAATCGCAATCGAACGCCAACTGGACGAA
Drosophila_sechellia|2865     TCTGAGCCAACTTTGCGCGTGCGCAATCGAAAGATCGCAATCGAACGACAGCTGGACGAA
Drosophila_simulans|15598     TCTGAGCCAACTTTGCGCGTGCGCAATCGAAAGATCGCAATCGAACGACAGCTGGACGAA
                              ** ********: **** **.** *****.**..  **.*****.**  *.** **  *.

Drosophila_willistoni|9448    TTGGACTACGCCATCAATATGTATGATCAGACTCAT------ATGTATTACAAACGCTGA
Drosophila_yakuba|12048       CTGGACTATGCCATCAATATGTTTGATCAGCCGCACATGGATATGTATTACAAGAAGTGA
Drosophila_melanogaster|21724 CTGGACTATGCCATCAATATGTTTGATCAGCCCCATATGGATATGTATTATAAGAAGTGA
Drosophila_sechellia|2865     CTGGACTATGCCATCAATATGTTCGATCAGCCCCATATGGATATGTATTACAAGAAGTGA
Drosophila_simulans|15598     CTGGACTATGCCATCAATATGTTCGATCAGCCCCATATGGATATGTATTACAAGAAGTGA
                               ******* *************: ******.* **       ******** **... ***

multiple sequence alignment in CLUSTALW format


Drosophila_willistoni|9547    -MSLNRVNRNGRDFLQENKQKVAHWETNGRLTAAAAAKRVNLWRPVVLHYSSGLRPFGQR
Drosophila_yakuba|6466        MSTLRRSHGGGRDFLQENKLNVTRMETNGRCLAAANARRVPLWRPVVLHYSEKVRPHVYS
Drosophila_melanogaster|20093 MSALRRSHGGGRDFLQENKQNVSRMETNGRCIAAANARRVPLWRPVVLHYPEKLRPHVYN
Drosophila_sechellia|2026     MSALRRSHGEGRDFLQENKLNVSRMETNGRCIAAANARRVPLWRPVVLHYTEKLRPHAYN
Drosophila_simulans|5993      MSELRRSHGGGRDFLQENKQNVSRMETNGRCIAAANARRVPLWRPVVLHYTEKLRPHAYN
                                 *.* :  ********* :*:: *****  *** *:** *********.. :**.   

Drosophila_willistoni|9547    T-NTRTRNSVPLHESGKMHSGLAQPYGFHQEERPVRPLTRAARHMAKQQKGMGDEKGRQG
Drosophila_yakuba|6466        TNQRRARPLHGAHESPRLRSGLAQPYGFQNEMRRRLPPNPCGCDVPTRKTEERKEQERLQ
Drosophila_melanogaster|20093 I-QRRTRPLHGAHESPRLRSGLAQPYGFHNEMRRRMPPNPCGCDLTTRKTVERKEQERLQ
Drosophila_sechellia|2026     V-QRRPRQLHGAHESPRLRGGLAQPYGFHNEMRRRMPPNSM-------------------
Drosophila_simulans|5993      V-QRRPRQLHGAHESPRLRGGLAQPYGFHNEMRRRMPPNSCGCDSTTRKSEERKEQERLQ
                                : *.*     *** :::.********::* *   * .                     

Drosophila_willistoni|9547    GG---DSSRMAKQTQTQTQSQTG----EIRDSRLAKKSLPKSDHQHVGQL---DQVEQPP
Drosophila_yakuba|6466        GGWEDQQVKLPRKCCTGCNCLHGYPNTNPSDQSNKVEAVSQ------------HQGQQSE
Drosophila_melanogaster|20093 GGWE--DQQVPRKCCSGCTCHHGYPTNKPSDQDHQAKEVSQH-QGHHGQAVAPHQGQQSE
Drosophila_sechellia|2026     --WLRFDHTVTRQ-----------------------RAVPQH-EGQHGQAVAPHQGQQSE
Drosophila_simulans|5993      GGWE--DQQKQRKCCSGCTCHHGYPTNTPSDQGDQAKAVPQPGEGHHGQAVAPHQGQQSE
                                    .    ::                       . :.:            .* :*. 

Drosophila_willistoni|9547    TSLAVPKQTGD-DEDDALSVYSLR------SKASQRSNISKISKKSSLHLA-GEGGDE-E
Drosophila_yakuba|6466        MDGPMPTKQGEGDQADRVSVCSRM---------SRVSRASQASRRSQAKSTQGEGTNDPE
Drosophila_melanogaster|20093 TDGQIQPKHGEGDQADRISVCSRMSQESRASRASRASRASRASRRSEAQSTQGQGNNDPE
Drosophila_sechellia|2026     TDGQIQPKHGEGDEADRISVCSRM------SRASRASQASLASCRSQAKSTQAQENNEPE
Drosophila_simulans|5993      TDGQIQPKHGEGDQADRISVCSRM------SGASRASQASQASRRSQAKSTQAQENNEPE
                               .  :  : *: *: * :** *           *: *. *  * :*. : : .:  :: *

Drosophila_willistoni|9547    APLSARSNASLKTIKSAATVRSTCSVKSRATIKSVESVKSQATLKSHMSHKSHKSNATLK
Drosophila_yakuba|6466        APLSARSGASAKTLKSKRSV-------------SQESVRSNATIKSNITVASRSTTASKR
Drosophila_melanogaster|20093 APLSARSSASTKTLKSKRSV-------------SQESVRSNATIKSNITVASRSTTASKR
Drosophila_sechellia|2026     APLSARSSASTKTIKSKRSV-------------SQESVCSNATIKSNVTVASRSTNASKR
Drosophila_simulans|5993      APLSARSSASTKTIKSKRSV-------------SQESVRSNATIKSNVTVASRSTTASKR
                              *******.** **:**  :*             * *** *:**:**:::  *:.:.*: :

Drosophila_willistoni|9547    SHVSGKSRASSTAKSQVSRRFVAGGESSMPQKSPSSTGHMEGPCCCSQQSHME-NERLAA
Drosophila_yakuba|6466        SHVSRKSQLMEVMPPPTHL------EDQRPKEREREREKEKVPTAIEGYTPLTASERQAA
Drosophila_melanogaster|20093 SQVSRKSKLMEVMPPPTHL------EDRRPKEREKE----KAPTAIEGYTPLTPSERQAA
Drosophila_sechellia|2026     SQVSRKSKLMEVMPPPTHL------EDRRPQEREKE----KAPTAIEGYTPLTANERQAA
Drosophila_simulans|5993      SQVSRKSKLMEVMPPPTHL------EDRRPKEREKE----KAPTAIEGYTPLTPNERQAA
                              *:** **:  ..  . .        *.  *::   .    : * . .  : :  .** **

Drosophila_willistoni|9547    LNEAHYKYGKLIEEYNHMPVSEPTLRVRNRKAAIERELDQLDYAINMYDQTH--MYYKR
Drosophila_yakuba|6466        LQDAHIKYSKLVEEYNHMPVSEPTLRVRNRKIAIERQLDELDYAINMFDQPHMDMYYKK
Drosophila_melanogaster|20093 LQDAHVKYSKLVEEYNRMPVSEPTLRVRNRKIAIERQLDELDYAINMFDQPHMDMYYKK
Drosophila_sechellia|2026     LQDAHIKYSKLVEEYNRMPVSEPTLRVRNRKIAIERQLDELDYAINMFDQPHMDMYYKK
Drosophila_simulans|5993      LQDAHIKYSKLVEEYNRMPVSEPTLRVRNRKIAIERQLDELDYAINMFDQPHMDMYYKK
                              *::** **.**:****:************** ****:**:*******:**.*  ****: