Orthologs Set ID: EOG4006CJ


Orthology Database
OrthoDB4
Gene Symbol(s)
NANS

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Anolis carolinensis 12516 162, 393, 496, 666, 1149
Bombyx mori 1093 162, 393, 762, 1087
Bos taurus 25318 162, 393, 496, 666, 1149
Branchiostoma floridae 15501 162, 397, 496, 666, 801, 1084, 1217
Branchiostoma floridae 21332 162, 393, 496, 666, 801, 1149
Callithrix jacchus 47342 496, 666, 1149
Canis familiaris 3275 162, 393, 496, 666, 1149
Cavia porcellus 11788 162, 393, 496, 666, 1149
Choloepus hoffmanni 8125 393, 496, 666, 1149
Culex quinquefasciatus 11186 162
Danio rerio 20197 69, 98, 116, 144, 162, 393, 502, 562, 666, 1149, 1333
Danio rerio 2021 162, 393, 496, 666, 1149
Daphnia pulex 27157 69, 393, 523, 842
Dasypus novemcinctus 11596 162, 393, 439, 496, 666, 1149
Dipodomys ordii 12451 162, 393, 496, 666, 1149
Drosophila grimshawi 11395 393
Drosophila melanogaster 15129 393
Drosophila sechellia 3500 393
Drosophila simulans 14756 393
Echinops telfairi 11114 162, 393, 496, 666
Equus caballus 16216 393, 496, 666, 1149
Erinaceus europaeus 11688 162, 393, 496, 666, 1149
Felis catus 37221 162, 393, 496, 666, 1149
Fugu rubripes 17860 162, 393, 496, 666, 1149
Gallus gallus 23025 162, 393, 496, 666, 1149
Gasterosteus aculeatus 6537 162, 393, 496, 666, 1149
Gorilla gorilla 9156 496, 666, 1149
Homo sapiens 94304 162, 393, 496, 666, 1149
Loxodonta africana 23090 162, 393, 496, 666, 1149
Macropus eugenii 3366 495, 573, 624, 651, 678
Macropus eugenii 4860 162, 393, 424, 435, 519, 1335
Microcebus murinus 13762 162, 393, 496, 666, 1149
Monodelphis domestica 25546 162, 393, 496, 666, 1149
Mus musculus 28747 162, 393, 496, 666, 1149
Myotis lucifugus 4915 496, 666, 1149
Nematostella vectensis 5682
Ochotona princeps 9469 393, 496, 666, 1149, 1221
Ornithorhynchus anatinus 19300 162, 393, 496, 666, 1149
Oryzias latipes 24531 162, 393, 430, 432, 666, 1149
Otolemur garnettii 6328 38, 105, 162, 393, 496, 666, 1149
Pan troglodytes 37248 162, 393, 496, 666, 1149
Pediculus humanus 293 12
Pongo abelii 27904 162, 393, 496, 666, 1149
Procavia capensis 13404 35, 162, 393, 496, 666, 1149
Pteropus vampyrus 3614 162, 393, 496, 666, 1149
Rattus norvegicus 27085 162, 393, 496, 666, 1149
Sorex araneus 5310 162, 393, 496, 666, 1149, 1361
Spermophilus tridecemlineatus 6701 393, 468, 489, 496, 546, 666, 706, 720, 777, 798, 813, 831, 1149
Sus scrofa 1708 162, 393, 496, 666, 1149
Taeniopygia guttata 18370 162, 393, 496, 666, 1149
Tarsius syrichta 13515 162, 364, 393, 496, 555, 666, 745, 1149
Tetraodon nigroviridis 8606 162, 393, 496, 666, 1149
Tribolium castaneum 1099 162, 762
Tupaia belangeri 7743 162, 393, 496, 666, 1149
Tursiops truncatus 13214 162, 393, 496, 666, 738, 1149
Vicugna pacos 359 162, 393, 496, 666, 1021, 1114, 1149
Xenopus tropicalis 7302 162, 393, 496, 666, 1149

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 12516 ENSACAT00000002042 100558551 ENSACAG00000002054 nans anoCar1
Bombyx mori 1093 BGIBMGA002651-TA v2.0
Bos taurus 25318 ENSBTAT00000025318 540602 ENSBTAG00000019023 NANS bosTau4
Branchiostoma floridae 21332 estExt_fgenesh2_pm.C_2320007 braFlo1
Branchiostoma floridae 15501 fgenesh2_pm.scaffold_325000009 braFlo1
Callithrix jacchus 47342 ENSCJAT00000021407 100411585 ENSCJAG00000010966 NANS calJac3
Canis familiaris 3275 ENSCAFT00000003885 481624 ENSCAFG00000002469 NANS canFam2
Cavia porcellus 11788 ENSCPOT00000001311 100716456 ENSCPOG00000001295 NANS cavPor3
Choloepus hoffmanni 8125 ENSCHOT00000008122 ENSCHOG00000008106 NANS choHof1
Culex quinquefasciatus 11186 CPIJ013964-RA 6047730 CPIJ013964 CpipJ1
Danio rerio 2021 ENSDART00000067086 322780 ENSDARG00000045620 nansa danRer6
Danio rerio 20197 ENSDART00000054817 492779 ENSDARG00000036009 zgc:101549 danRer6
Daphnia pulex 27157 PASA_GEN_106900002 1.1
Dasypus novemcinctus 11596 ENSDNOT00000023807 ENSDNOG00000025961 NANS dasNov2
Dipodomys ordii 12451 ENSDORT00000006241 ENSDORG00000006241 Nans dipOrd1
Drosophila grimshawi 11395 FBtr0149306 6568185 FBgn0121368 GH13892 droGri2
Drosophila melanogaster 15129 FBtr0082588, NM_141938 41528 FBgn0038045 Sas dm3
Drosophila sechellia 3500 FBtr0207016 6606666 FBgn0178896 GM24031 droSec1
Drosophila simulans 14756 FBtr0218742 6728357 FBgn0190348 GD18832 droSim1
Echinops telfairi 11114 ENSETET00000010815 ENSETEG00000010816 NANS TENREC
Equus caballus 16216 ENSECAT00000017618 100064126 ENSECAG00000016772 NANS equCab2
Erinaceus europaeus 11688 ENSEEUT00000010529 ENSEEUG00000010539 NANS eriEur1
Felis catus 37221 ENSFCAT00000001207 101092303 ENSFCAG00000001207 NANS felCat3
Fugu rubripes 17860 ENSTRUT00000039895 778024 ENSTRUG00000015552 NANS fr2
Gallus gallus 23025 ENSGALT00000024727 427283 ENSGALG00000015320 NANS galGal3
Gasterosteus aculeatus 6537 ENSGACT00000024663 ENSGACG00000018612 nansa gasAcu1
Gorilla gorilla 9156 ENSGGOT00000034605 101124502 ENSGGOG00000021976 NANS gorGor3
Homo sapiens 94304 ENST00000210444, NM_018946 54187 ENSG00000095380 NANS hg19,GRCh37
Loxodonta africana 23090 ENSLAFT00000001944 100659127 ENSLAFG00000001944 NANS loxAfr3
Macropus eugenii 4860 ENSMEUT00000004857 ENSMEUG00000004848 Meug_1.0
Macropus eugenii 3366 ENSMEUT00000003365 ENSMEUG00000003358 Meug_1.0
Microcebus murinus 13762 ENSMICT00000012793 ENSMICG00000012795 NANS micMur1
Monodelphis domestica 25546 ENSMODT00000004079 100014569 ENSMODG00000003270 NANS monDom5
Mus musculus 28747 ENSMUST00000030018 94181 ENSMUSG00000028334 Nans mm9
Myotis lucifugus 4915 ENSMLUT00000004846 102435662 ENSMLUG00000004849 NANS myoLuc1
Nematostella vectensis 5682 gw.6174.1.1 Nemve1
Ochotona princeps 9469 ENSOPRT00000012088 101522937 ENSOPRG00000012095 NANS OchPri2.0
Ornithorhynchus anatinus 19300 ENSOANT00000017641 ENSOANG00000011134 NANS ornAna1
Oryzias latipes 24531 ENSORLT00000025776 101166198 ENSORLG00000020815 nansa oryLat2
Otolemur garnettii 6328 ENSOGAT00000006095 100951418 ENSOGAG00000006095 NANS otoGar1
Pan troglodytes 37248 ENSPTRT00000039153 743934 ENSPTRG00000021173 NANS panTro2
Pediculus humanus 293 PHUM018360-RA 8233798 PHUM018360 PhumU1
Pongo abelii 27904 ENSPPYT00000022664 100446862 ENSPPYG00000019431 NANS ponAbe2
Procavia capensis 13404 ENSPCAT00000013086 ENSPCAG00000013121 NANS proCap1
Pteropus vampyrus 3614 ENSPVAT00000006571 ENSPVAG00000006573 NANS pteVam1
Rattus norvegicus 27085 ENSRNOT00000012260 298071 ENSRNOG00000008945 Nans rn4
Sorex araneus 5310 ENSSART00000005217 ENSSARG00000005216 NANS sorAra1
Spermophilus tridecemlineatus 6701 ENSSTOT00000006702 101969015 ENSSTOG00000006697 Nans speTri1
Sus scrofa 1708 ENSSSCT00000005913 100155883 ENSSSCG00000005373 NANS susScr2
Taeniopygia guttata 18370 ENSTGUT00000000114 100227675 ENSTGUG00000000113 NANS taeGut1
Tarsius syrichta 13515 ENSTSYT00000006865 ENSTSYG00000006870 NANS tarSyr1
Tetraodon nigroviridis 8606 ENSTNIT00000021471 ENSTNIG00000018070 nansa tetNig2
Tribolium castaneum 1099 GLEAN_00193 Tcas3.0
Tupaia belangeri 7743 ENSTBET00000007744 ENSTBEG00000007758 NANS tupBel1
Tursiops truncatus 13214 ENSTTRT00000010826 101320184 ENSTTRG00000010826 NANS turTru1
Vicugna pacos 359 ENSVPAT00000010546 102528094 ENSVPAG00000010546 NANS vicPac1
Xenopus tropicalis 7302 ENSXETT00000014349 100492893 ENSXETG00000006558 nans xenTro2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 1979 ENSACAP00000001994 100558551 ENSACAG00000002054 nans anoCar1
Bombyx mori 2651 BGIBMGA002651-PA v2.0
Bos taurus 405 ENSBTAP00000025318 540602 ENSBTAG00000019023 NANS bosTau4
Branchiostoma floridae 2596 fgenesh2_pm.scaffold_325000009 braFlo1
Branchiostoma floridae 2597 estExt_fgenesh2_pm.C_2320007 braFlo1
Callithrix jacchus 38506 ENSCJAP00000020263 100411585 ENSCJAG00000010966 NANS calJac3
Canis familiaris 10263 ENSCAFP00000003592 481624 ENSCAFG00000002469 NANS canFam2
Cavia porcellus 9222 ENSCPOP00000001174 100716456 ENSCPOG00000001295 NANS cavPor3
Choloepus hoffmanni 7165 ENSCHOP00000007161 ENSCHOG00000008106 NANS choHof1
Culex quinquefasciatus 14008 CPIJ013964 CpipJ1
Danio rerio 17283 ENSDARP00000054816 492779 ENSDARG00000036009 zgc:101549 danRer6
Danio rerio 19646 ENSDARP00000067085 322780 ENSDARG00000045620 nansa danRer6
Daphnia pulex 25304 JGI_V11_300651 1.1
Dasypus novemcinctus 10264 ENSDNOP00000016722 ENSDNOG00000025961 NANS dasNov2
Dipodomys ordii 11724 ENSDORP00000005842 ENSDORG00000006241 Nans dipOrd1
Drosophila grimshawi 3802 FBpp0147798 6568185 FBgn0121368 GH13892 droGri2
Drosophila melanogaster 13887 FBpp0082060 41528 FBgn0038045 Sas dm3
Drosophila sechellia 13636 FBpp0205508 6606666 FBgn0178896 GM24031 droSec1
Drosophila simulans 8661 FBpp0217234 6728357 FBgn0190348 GD18832 droSim1
Echinops telfairi 8772 ENSETEP00000008784 ENSETEG00000010816 NANS TENREC
Equus caballus 14457 ENSECAP00000014323 100064126 ENSECAG00000016772 NANS equCab2
Erinaceus europaeus 9613 ENSEEUP00000009599 ENSEEUG00000010539 NANS eriEur1
Felis catus 2721 ENSFCAP00000001120 101092303 ENSFCAG00000001207 NANS felCat3
Fugu rubripes 39754 ENSTRUP00000039754 778024 ENSTRUG00000015552 NANS fr2
Gallus gallus 13667 ENSGALP00000024681 427283 ENSGALG00000015320 NANS galGal3
Gasterosteus aculeatus 24344 ENSGACP00000024614 ENSGACG00000018612 nansa gasAcu1
Gorilla gorilla 7848 ENSGGOP00000026478 101124502 ENSGGOG00000021976 NANS gorGor3
Homo sapiens 6196 ENSP00000210444 54187 ENSG00000095380 NANS hg19,GRCh37
Loxodonta africana 21512 ENSLAFP00000001627 100659127 ENSLAFG00000001944 NANS loxAfr3
Macropus eugenii 4430 ENSMEUP00000004425 ENSMEUG00000004848 Meug_1.0
Macropus eugenii 3068 ENSMEUP00000003065 ENSMEUG00000003358 Meug_1.0
Microcebus murinus 11653 ENSMICP00000011653 ENSMICG00000012795 NANS micMur1
Monodelphis domestica 4284 ENSMODP00000003993 100014569 ENSMODG00000003270 NANS monDom5
Mus musculus 8182 ENSMUSP00000030018 94181 ENSMUSG00000028334 Nans mm9
Myotis lucifugus 4415 ENSMLUP00000004414 102435662 ENSMLUG00000004849 NANS myoLuc1
Nematostella vectensis 821 gw.6174.1.1 Nemve1
Ochotona princeps 8234 ENSOPRP00000011033 101522937 ENSOPRG00000012095 NANS OchPri2.0
Ornithorhynchus anatinus 1192 ENSOANP00000017638 ENSOANG00000011134 NANS ornAna1
Oryzias latipes 24567 ENSORLP00000025775 101166198 ENSORLG00000020815 nansa oryLat2
Otolemur garnettii 5446 ENSOGAP00000005444 100951418 ENSOGAG00000006095 NANS otoGar1
Pan troglodytes 17523 ENSPTRP00000036182 743934 ENSPTRG00000021173 NANS panTro2
Pediculus humanus 289 PHUM018360-PA 8233798 PHUM018360 PhumU1
Pongo abelii 833 ENSPPYP00000021774 100446862 ENSPPYG00000019431 NANS ponAbe2
Procavia capensis 12537 ENSPCAP00000012227 ENSPCAG00000013121 NANS proCap1
Pteropus vampyrus 3400 ENSPVAP00000006205 ENSPVAG00000006573 NANS pteVam1
Rattus norvegicus 10164 ENSRNOP00000012260 298071 ENSRNOG00000008945 Nans rn4
Sorex araneus 4725 ENSSARP00000004725 ENSSARG00000005216 NANS sorAra1
Spermophilus tridecemlineatus 5991 ENSSTOP00000005994 101969015 ENSSTOG00000006697 Nans speTri1
Sus scrofa 5757 ENSSSCP00000005766 100155883 ENSSSCG00000005373 NANS susScr2
Taeniopygia guttata 602 ENSTGUP00000000112 100227675 ENSTGUG00000000113 NANS taeGut1
Tarsius syrichta 12387 ENSTSYP00000006284 ENSTSYG00000006870 NANS tarSyr1
Tetraodon nigroviridis 8722 ENSTNIP00000021237 ENSTNIG00000018070 nansa tetNig2
Tribolium castaneum 191 GLEAN_00193 Tcas3.0
Tupaia belangeri 6719 ENSTBEP00000006704 ENSTBEG00000007758 NANS tupBel1
Tursiops truncatus 12503 ENSTTRP00000010267 101320184 ENSTTRG00000010826 NANS turTru1
Vicugna pacos 336 ENSVPAP00000009814 102528094 ENSVPAG00000010546 NANS vicPac1
Xenopus tropicalis 16055 ENSXETP00000014349 100492893 ENSXETG00000006558 nans xenTro2

multiple sequence alignment in CLUSTALW format


Nematostella_vectensis|5682        ------------------------------------------------------------
Drosophila_grimshawi|11395         ------------------------------ATGTTGTTGCTTGATATAATGTCAAAAAAG
Drosophila_melanogaster|15129      ------------------------------ATGCTGTTAAACGATATCATAAGCGGAAAA
Drosophila_sechellia|3500          ------------------------------ATGCTGTTAAACGATATTATAAGCGGAAAT
Drosophila_simulans|14756          ------------------------------ATGCTGTTAAACGATATTATAAGCGGAAAA
Pediculus_humanus|293              ATGGCAGGAGAGGATGTACAAATCAAAGGACCGAATACGATTAGAATAGGAAATTGTTCA
Bombyx_mori|1093                   ------------------------------ATGGTGGAAGTCAAAATAACTGATGACATT
Tribolium_castaneum|1099           ------------------------------ATGGCCGAATTACAAATCACTCCCAAACGC
Culex_quinquefasciatus|11186       ------------------------------------------ATGAAGATTTCCGGGAGG
Daphnia_pulex|27157                ------------------------ATGACGGCGCGCAGTTTTGAGTTGGTCAACAATACA
Branchiostoma_floridae|21332       ---------------------------ATGTCGGTAGAATTTGAACTAGCGCCGGGCCGC
Branchiostoma_floridae|15501       ------------------------------------------------------------
Danio_rerio|20197                  ---------------------------ATGCCTGTCGAGTTTGAACTTTGCCCTGTGAGA
Oryzias_latipes|24531              ---------------------------ATGGCGTCCGTCTTCGAGCTCTGTCCCGGCCGG
Danio_rerio|2021                   ---------------------------ATGCCACTTAAATTTGAATTATGTCCCGGCCGC
Gasterosteus_aculeatus|6537        ---------------------------ATGCCTTTAGAGTTCGAGCTGTGTCCCGGTCGG
Tetraodon_nigroviridis|8606        ---------------------------ATGCCGTTAGAGTTTGAACTATGTCCTGGTCGA
Fugu_rubripes|17860                ---------------------------ATGCCGTTAGAGTTTGAACTGTGTCCTGGTCGT
Xenopus_tropicalis|7302            ---------------------------ATGCCTTTAGAGTTCGAATTATGCCCCGGGCGG
Dipodomys_ordii|12451              ---------------------------ATGCCGCTGGAGCTGGAGCTGTGCCCCGGGCGC
Sorex_araneus|5310                 ---------------------------ATGCCGTTAGAACTGGAGCTGTGTCCCGGGCGC
Macropus_eugenii|3366              ------------------------------------------------------------
Spermophilus_tridecemlineatus|6701 ------------------------------------------------------------
Monodelphis_domestica|25546        ---------------------------ATGCCGCTAGAGCTGGAGCTGTGCCCCGGTCGC
Macropus_eugenii|4860              ---------------------------ATGCCGCTGGAGCTGGAGCTGTGCCCCGGCCGC
Microcebus_murinus|13762           ---------------------------ATGCCGCTGGAGCTGGAGCTGTGTCCTGGGCGC
Tupaia_belangeri|7743              ---------------------------ATGCCGCTGGAGCTGGAGCTGTGCCCCGGTCGC
Anolis_carolinensis|12516          ---------------------------ATGCCGCTGGAAATAGAGCTGTGCCCCGGGCGG
Ochotona_princeps|9469             ------------------------------------------------------------
Echinops_telfairi|11114            ---------------------------ATGCCGCTGGAGCTGGAGCTGTGTCCCGGGCGC
Mus_musculus|28747                 ---------------------------ATGCCGCTGGAACTGGAGCTGTGTCCCGGGCGC
Rattus_norvegicus|27085            ---------------------------ATGCCGCTGGAGCTGGAGCTGTGTCCCGGGCGC
Cavia_porcellus|11788              ---------------------------ATGCCGCTGGAAGTGGAGCTGTGCCCGGGGCGC
Procavia_capensis|13404            ---------------------------ATGCCCGTGGAACTGGAGCTATGCCCCGGGCGC
Loxodonta_africana|23090           ---------------------------ATGCCGCTGGAGCTGGAGCTCTGTCCTGGGCGC
Canis_familiaris|3275              ---------------------------ATGCCGCTGGAGCTGGAGCTGTGTCCCGGGCGC
Erinaceus_europaeus|11688          ---------------------------ATGCCGCTGGAGCTGGAGTTGTGTCCCGGGCGC
Bos_taurus|25318                   ---------------------------ATGCCGCTGGAGCTGGAGCTGTGTCCTGGGCGC
Tursiops_truncatus|13214           ---------------------------ATGCCGCTGGAGCTGGAGCTGTGTCCCGGGCGC
Felis_catus|37221                  ---------------------------ATGCCGCTGGAACTGGAGCTGTGTCCCGGGCGC
Vicugna_pacos|359                  ---------------------------ATGCCGCTGGAGCTGGAGCTGTGTCCCGGGCGC
Sus_scrofa|1708                    ---------------------------ATGCCGCTGGAGCTGGAGCTGTGTCCCGGACGC
Pteropus_vampyrus|3614             ---------------------------ATGCCGCTGGAGCTGGAGCTGTGTCCCGGGCGC
Myotis_lucifugus|4915              ------------------------------------------------------------
Equus_caballus|16216               ------------------------------------------------------------
Otolemur_garnettii|6328            ---------------------------ATGCCGCTGGAGCTGGAGCTGTGTCCCGGGCGC
Callithrix_jacchus|47342           ------------------------------------------------------------
Gorilla_gorilla|9156               ------------------------------------------------------------
Homo_sapiens|94304                 ---------------------------ATGCCGCTGGAGCTGGAGCTGTGTCCCGGGCGC
Pan_troglodytes|37248              ---------------------------ATGCCGCTGGAGCTGGAGCTGTGTCCCGGGCGC
Pongo_abelii|27904                 ---------------------------ATGCCGCTGGAGCTGGAGCTGTGTCCCGGGCGC
Ornithorhynchus_anatinus|19300     ---------------------------ATGCCGCTGGAGCTGGAGCTCTGTCCCGGCCGC
Gallus_gallus|23025                ------------------------------------------------------------
Taeniopygia_guttata|18370          ---------------------------ATGGCCGGCGAGTTCGAGCTGTGCCCCGGGCGG
Choloepus_hoffmanni|8125           ------------------------------------------------------------
Dasypus_novemcinctus|11596         ---------------------------ATGCCGCTGGAGCTGGAGCTGTGTCCTGGGCGC
Tarsius_syrichta|13515             ---------------------------ATGCCGCTGGAGCTGGAGTTGTGTCCCGGACGC
                                                                                               

Nematostella_vectensis|5682        ---------------------------------------------------AATCAC---
Drosophila_grimshawi|11395         ATATGT---------AACGAAGTATATATA---ATTGCGGAAATTGGTCAAAATCATCAG
Drosophila_melanogaster|15129      TTAGTT---------GATTCCGTCTATATT---ATAGCGGAAATTGGCCAAAATCACCAA
Drosophila_sechellia|3500          GAAGTT---------GATTCCGTCTATATT---ATAGCGGAAATTGGACAAAACCACCAA
Drosophila_simulans|14756          GTAGTT---------GATTCCGTCTATATT---ATAGCGGAAATTGGCCAAAACCACCAA
Pediculus_humanus|293              GCTATAGGACCAAATGAAAGATGTTTTATC---ATTGCTGAAATCGGACAAAATCATCAA
Bombyx_mori|1093                   AGAATTGGCGGCAATAATCCGTGTTTTATA---ATAGCGGAAGCGGGACAGAATCACCAA
Tribolium_castaneum|1099           ACAATTGGCCATAATCACCCTACCTTTATC---ATCGCCGAAATTGGCCAAAACCACCAA
Culex_quinquefasciatus|11186       GACGTCGGGGATGGTCATCCGGTGTTTGTC---GTGGCCGAGATTGGCCAGAACCATCAG
Daphnia_pulex|27157                TGGATTGGT---------------------------------------------------
Branchiostoma_floridae|21332       ATGGTGGGAGGAGACCACCCTTGCTTTGTG---GTGGCCGAGATTGGACAGAATCATCAG
Branchiostoma_floridae|15501       ATGGTGGGAGGAGACCACCCTTGCTTTGTG---GTGGCCGAGATTGGACAGAATCATCAG
Danio_rerio|20197                  AAAATTGGGTGTTGTTTTTTGTGTTTTATATTTATTAATAATTTATTTATGCTGAAATAT
Oryzias_latipes|24531              AAGATCGGCGGGGAGCATCCGTGCTTCATC---ATCGCAGAGATCGGACAGAACCACCAG
Danio_rerio|2021                   ATGATCGGAGGAAACAATCCGTGCTTCATT---ATTGCAGAAATCGGACAGAATCATCAG
Gasterosteus_aculeatus|6537        ATGATCGGAGGAAACCACCCGTGCTTCATT---ATCGCTGAAATTGGACAAAATCACCAG
Tetraodon_nigroviridis|8606        GTGGTCGGAGGAGACCACCCGTGTTTTATT---ATCGCTGAAATTGGACAAAACCACCAG
Fugu_rubripes|17860                GTGGTGGGAGGAAACCATCCGTGTTTCATT---ATCGCTGAAATTGGACAAAATCACCAA
Xenopus_tropicalis|7302            AAGATTGGAGGGGAGAATCCATGCTTCGTC---ATTGCCGAGATCGGGCAGAACCACCAG
Dipodomys_ordii|12451              TGGGTGGGAGGGCAGCACCCATGCTTCATC---ATTGCCGAGATCGGCCAGAACCATCAG
Sorex_araneus|5310                 TGGGTGGGCGGGCGGCACCCGTGCTTCATC---ATCGCCGAGATCGGCCAGAACCACCAG
Macropus_eugenii|3366              ------------------------------------------------------------
Spermophilus_tridecemlineatus|6701 ------------------------------------------------------------
Monodelphis_domestica|25546        TGGGTCGGGGGGAACCATCCCTGCTTCATC---ATCGCCGAGATCGGGCAGAATCACCAG
Macropus_eugenii|4860              TGGGTCGGAGGGAACCACCCCTGCTTCATC---ATCGCCGAGATCGGGCAGAACCACCAG
Microcebus_murinus|13762           TGGGTGGGCGGGCAGCACCCGTGCTTCATC---ATTGCCGAGATCGGCCAGAACCACCAG
Tupaia_belangeri|7743              TGGGTGGGCGGGGAGCACCCGTGCTTCATC---ATTGCAGAGATCGGCCAGAACCACCAG
Anolis_carolinensis|12516          CGGATCGGAGGGGAGAATCCCTGCTTCATC---ATCGCCGAGATCGGTCAGAACCACCAG
Ochotona_princeps|9469             ------------------------------------------------------------
Echinops_telfairi|11114            TGGGTGGGCGGGCAGCATCCGTGCTTCATC---ATCGCCGAGATCGGCCAGAACCACCAG
Mus_musculus|28747                 TGGGTGGGTGGAAAGCACCCGTGCTTCATC---ATCGCGGAGATCGGCCAGAACCACCAA
Rattus_norvegicus|27085            TGGGTGGGTGGACAGCACCCGTGCTTCATC---ATCGCGGAGATCGGCCAGAACCACCAA
Cavia_porcellus|11788              TGGGTAGGCGGGCAGCATCCATGCTTCATC---ATTGCCGAAATCGGCCAGAACCACCAG
Procavia_capensis|13404            TGGGTGGGCGGGCAACACCCGTGCTTCATC---ATTGCCGAGATCGGCCAGAACCACCAG
Loxodonta_africana|23090           TGGGTGGGCGGGCAGCACCCGTGCTTCATC---ATCGCAGAGATCGGCCAGAACCACCAG
Canis_familiaris|3275              TGGGTGGGCGGGCAGCACCCGTGCTTCATC---ATTGCCGAGATCGGCCAGAACCACCAG
Erinaceus_europaeus|11688          TGGGTGGGCGGGCAGCACCCATGCTTCATC---ATTGCCGAGATCGGCCAGAACCACCAG
Bos_taurus|25318                   TGGGTGGGCGGGCACCATCCATGTTTTATC---ATTGCCGAGATCGGCCAGAACCACCAG
Tursiops_truncatus|13214           TGGGTGGGCGGGCAGCACCCATGCTTCATC---ATTGCCGAGATCGGCCAGAACCACCAG
Felis_catus|37221                  TGGGTGGGCNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNN
Vicugna_pacos|359                  TGGGTGGGCGGGCAGCACCCATGCTTCATC---ATTGCGGAGATCGGCCAGAACCACCAG
Sus_scrofa|1708                    TGGGTGGGCGGGCAGCACCCATGCTTCATC---ATTGCGGAGATAGGCCAGAACCACCAG
Pteropus_vampyrus|3614             TGGGTGGGCGGACAGCACCCGTGCTTTATC---ATTGCCGAGATCGGCCAGAACCACCAA
Myotis_lucifugus|4915              ------------------------------------------------------------
Equus_caballus|16216               ------------------------------------------------------------
Otolemur_garnettii|6328            TGGGTGGGCGGGCAGCACCCGTGCTTCATC---ATTGCCGAGATCGGCCAGAACCACCAG
Callithrix_jacchus|47342           ------------------------------------------------------------
Gorilla_gorilla|9156               ------------------------------------------------------------
Homo_sapiens|94304                 TGGGTGGGCGGGCAACACCCGTGCTTCATC---ATTGCCGAGATCGGCCAGAACCACCAG
Pan_troglodytes|37248              TGGGTGGGCGGGCAACACCCGTGCTTCATC---ATTGCCGAGATCGGCCAGAACCACCAG
Pongo_abelii|27904                 TGGGTGGGCGGGCAACACCCGTGCTTCATC---ATTGCCGAGATCGGCCAGAACCACCAG
Ornithorhynchus_anatinus|19300     CGGGTCGGGGGCGCCCACCCCTGCTTCATC---ATCGCAGAGATCGGCCAGAACCACCAG
Gallus_gallus|23025                ------------------------------------------------------------
Taeniopygia_guttata|18370          CGCGTCGGCGGCGACCAGCCCTGCTTCATC---ATCGCCGAGATCGGGCAGAACCACCAG
Choloepus_hoffmanni|8125           ------------------------------------------------------------
Dasypus_novemcinctus|11596         TGGGTGGGCGGGCAGCACCCGTGCTTCATC---ATTGCCGAGATCGGCCAGAACCACCAG
Tarsius_syrichta|13515             TGGGTGGGCGGGCAGCACCCGTGCTTCATC---ATCGCCGAGATCGGCCAGAACCACCAG
                                                                                               

Nematostella_vectensis|5682        ------------------------------------------------------------
Drosophila_grimshawi|11395         GGATGCCCCGAAACGGCTAAACGGATGATACTGGAAGCGAAGAAAGCTGGATGCCACTGT
Drosophila_melanogaster|15129      GGTTGTGTGGAAACAGCGAAGAAAATGATATGGGAGGCCAAAAAAGCCGGTTGCCACTGC
Drosophila_sechellia|3500          GGTTGTGTGGAAACAGCGAAGAAAATGATATTAGAGGCCAAGAAAGCCGGTTGCCACTGC
Drosophila_simulans|14756          GGTTGTGTGGAAACAGCGAAGAAAATGATATGGGAGGCCAAGAAAGCCGGTTGCCACTGC
Pediculus_humanus|293              GGTGATATAAATTTAGCAAAAGAAATGATATTATTAGCAAAAGAGAGTGGAGCTGATTGT
Bombyx_mori|1093                   GGTGACATCGAGATCGCAAAAAAATTAATAAAAGCTGCTAAGGAAGCTGGAGCTAGCTGC
Tribolium_castaneum|1099           GGCGACGTAAAGATCGCCAAAAAATTAATTCATTTGGCGAAGGAAAGTGGGGCCGATTGT
Culex_quinquefasciatus|11186       GGTTCGCTGGAGGTCGCGAAGCGGATGATCGTGAAGGCAAAGGAGCTGGGTGCCGATTGC
Daphnia_pulex|27157                ---------------------------ATAAAGATGGCCAAGGACTGTGGTGCTGACTGC
Branchiostoma_floridae|21332       GGGGACATCAACATCGCCAAAGAGATGATTAAGAAAGCCAAGGAGGCTGGTGCAGATGCG
Branchiostoma_floridae|15501       GGGGACATCAACATCGCCAAAGAGATGATTAAGAAAGCCAAGGAGGCTGGTGCAGATGCG
Danio_rerio|20197                  GGAATTTTAGATATTATTTATGCAATTATGCTTTCTGCAAAAGACTGTGGAGCCGATTGT
Oryzias_latipes|24531              GGGGACATTGAAACGGCCAAGAAAATGATCCAAGTGGCGAAGGACGCCGGGGCGGATTGT
Danio_rerio|2021                   GGAGACATTGAGATTGCCAAGAAAATGATCAAAATGGCAAAGGACTGTGGTGCGGACTGT
Gasterosteus_aculeatus|6537        GGAGACATTGAGATTGCCAAGAAAATGATCAAGATGGCAAAGGACTGCGGTGCGGATTGT
Tetraodon_nigroviridis|8606        GGAGACATTGAAATCGCCAAGAAAATGATCAAAATGGCCAAGGACTGTGGTGCTGATTGT
Fugu_rubripes|17860                GGAGACATTGAAATCGCCAAGAAAATGATCAAAATGGCAAAGGATTGTGGTGCCGATTGT
Xenopus_tropicalis|7302            GGCGACTTGGAAATCGCCAAGAAAATGATCCGCATGGCAAAGGACAGCGGTGCGGATTGT
Dipodomys_ordii|12451              GGCGACCTGGACGTGGCCAAGCGCATGATCCGCACGGCCAAGGAGTGTGGGGCTGATTGT
Sorex_araneus|5310                 GGCGATCTGGACGTGGCCAAGCGCATGATCCGCATGGCCAAGGAGTGCGGCGCCGACTGT
Macropus_eugenii|3366              ------------------------------------------------------------
Spermophilus_tridecemlineatus|6701 ------------------------------------------GAGTGTGGAGCCGATTGT
Monodelphis_domestica|25546        GGCGATATAGAGGTGGCCAAGCGCATGATCCGGATGGCCAAGGAGTGTGGAGCTGACTGT
Macropus_eugenii|4860              GGCGACCTGGACGTGGCCAAGCGCATGATCCGGATGGCCAAGGAATGCGGGGCTGACTGT
Microcebus_murinus|13762           GGCGACCTGGACGTGGCCAAGCGCATGATCCGCACCGCCAAGGAGTGTGGGGCTGATTGT
Tupaia_belangeri|7743              GGCGACCTGGACGTGGCCAAGCGCATGATCCGCATTGCCAAGGAGTGTGGGGCCGACTGT
Anolis_carolinensis|12516          GGCGACCTGGAGATCGCCAAGAAGATGATCCGCGTGGCTAAGGAGTGTGGAGCGGATTGT
Ochotona_princeps|9469             ------------------------------------------GAGTGTGGGGCTGACTGT
Echinops_telfairi|11114            GGCGACCTGGACATCGCCAAGCGCATGATCCGCACGGCGAAGGAGTGCGGAGCCGACTGT
Mus_musculus|28747                 GGAGACATAGATGTGGCCAAGCGCATGATCCGCACTGCCAAGGAGTGTGGGGCCGACTGC
Rattus_norvegicus|27085            GGAGACTTAGATGTGGCCAAGCGCATGATCCGCACTGCCAAGGAGTGTGGGGCCGACTGC
Cavia_porcellus|11788              GGCGACCTGGAGGTGGCCAAACGCCTGATCCGCACCGCCAAGGAGTGTGGTGCTGATTGT
Procavia_capensis|13404            GGCGACCTGGACGTGGCAAAACGCATGATCCGCACCGCGAAGGAGTGTGGGGCTGACTGT
Loxodonta_africana|23090           GGCGACCTGGACGTGGCCAAACGCATGATCCGCACGGCGAAGGAGTGTGGAGCTGATTGT
Canis_familiaris|3275              GGCGACCTGGAAGTGGCCAAGCGCATGATCCGCACGGCTAAGGAGTGTGGGGCCGATTGT
Erinaceus_europaeus|11688          GGCGACCTGGACGTGGCCAAACGCATGATCCGCACGGCCAAGGAATGTGGAGCCGACTGT
Bos_taurus|25318                   GGCGATCTGGACGTGGCCAAGCGCATGATCCGCATGGCTAAGGAGTGCGGGGCCGATTGT
Tursiops_truncatus|13214           GGCGACCTGGACGTGGCCAAGCGCATGATCCGCATGGCCAAGGAGTGTGGCGCTGACTGT
Felis_catus|37221                  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGTGTGGGGCCGATTGT
Vicugna_pacos|359                  GGCGACCTCGACGTGGCCAAGCGCATGATCCGCACCGCCAAGGAGTGTGGGGCTGATTGT
Sus_scrofa|1708                    GGCGACCTGGATGTGGCCAAGCGCATGATCCGTATGGCCAAGGAGTGTGGGGCTGATTGC
Pteropus_vampyrus|3614             GGCGACCTGGACGTGGCCAAGCGTATGATCCGCGTGGCCAAGGAGTGTGGAGCTGATTGT
Myotis_lucifugus|4915              ------------------------------------------------------------
Equus_caballus|16216               ---------------------------------GTGTTGCAGGAGTGTGGGGCTGACTGT
Otolemur_garnettii|6328            GGCGACCTTGACGTGGCCAAGCGCATGATCCGTACCGCCAAGGAGTGTGGGGCTGACTGT
Callithrix_jacchus|47342           ------------------------------------------------------------
Gorilla_gorilla|9156               ------------------------------------------------------------
Homo_sapiens|94304                 GGCGACCTGGACGTAGCCAAGCGCATGATCCGCATGGCCAAGGAGTGTGGGGCTGATTGT
Pan_troglodytes|37248              GGCGACCTGGACGTAGCCAAGCGCATGATCCGCATGGCCAAGGAGTGTGGGGCTGATTGT
Pongo_abelii|27904                 GGCGACCTGGACGTGGCCAAGCGCATGATCCGCATGGCCAAGGAGTGTGGGGCTGATTGT
Ornithorhynchus_anatinus|19300     GGCGACCTGGACATCGCCAAACGCATGATCCGCATGGTCAAGGATTGTGGGGCAGACTGT
Gallus_gallus|23025                ---------------------------NNCCGCATGGCCAAGGAGTGTGGGGCAGACTGT
Taeniopygia_guttata|18370          GGCGACCTGGAGATCGCCAAGCGCATGATCCGCATGGTCAAGGAGTGTGGAGCCGACTGT
Choloepus_hoffmanni|8125           ------------------------------------------GAATGCGGGGCTGATTGT
Dasypus_novemcinctus|11596         GGCGACCTGGACGTGGCCAAGCGCATGATCCGCACCGCCAAGNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|13515             GGCGACCTGGAAGTGGCCAAGCGCATGATCCGCACCGCCAAGNNNNNNNNNNNNNNNNNN
                                                                                               

Nematostella_vectensis|5682        ------------------------------------------------------------
Drosophila_grimshawi|11395         GTGAAATTTCAAAAATCCGATTTGGCTGCAAAGTTTACAAGTTCCGCCCTAAATCGAAAA
Drosophila_melanogaster|15129      GTCAAGTTTCAAAAATCGGATTTGCCAGCAAAGTTTACGAGATCCGCTCTAGATCGCGAA
Drosophila_sechellia|3500          GTCAAGTTTCAAAAATCCGATTTGCCAACAAAGTTTACGAGATCCGCTCTAGATCGCGAA
Drosophila_simulans|14756          GTCAAGTTTCAAAAATCCGATTTGCCAGCAAAGTTTACGAGATCCGCTCTAGATCGCGAA
Pediculus_humanus|293              GTTAAATTTCAAAAAAGTCACTTACCATCAAAATTTAACAAGAAAGCATTGATGAGACCC
Bombyx_mori|1093                   GTGAAGTTTCAAAAGACATGTCTCGGAGAGAAATTTACAAAAAAATATCTAGAAAGGCCT
Tribolium_castaneum|1099           GTTAAATTCCAGAAAACCTGTCTCACTGAAAAATTCAATAAATCGGCCCTAGACAGGCCA
Culex_quinquefasciatus|11186       GTCAAGTTCCAGAAGTCTTGTCTTGCGGCTAAATTTACTCGGAATGCTCTTCGTAAACCC
Daphnia_pulex|27157                GTCAAGTTTCAGAAATCAGATTTGCATTCCAAATTCACCAAGTCAGTCTTGGCTCGTCAC
Branchiostoma_floridae|21332       GCAAAGTTCCAGAAGAGTGAGCTGACGAGGCGGTTCAACCGAGCAGCCCTGGCTCGGCCT
Branchiostoma_floridae|15501       GCAAAGTTCCAGAAGAGTGAGCTGACGAGGCGGTTCAACCGAGCAGCCCTGGCTCGGCCT
Danio_rerio|20197                  GCAAAGTTTCAGAAGAGCGAGATCGAGCACAGATTCACCAGAAACGCTCTGGATCGGCTT
Oryzias_latipes|24531              GCCAAATTCCAGAAGAGCGAGTTGGAGCACAAGTTCAACAAGCGAGCGTTGGAGCGGCCA
Danio_rerio|2021                   GCAAAGTTTCAGAAGAGTGAGCTTGAGTATAAATTCAATAAGAAAGCCCTTGAACGGCCA
Gasterosteus_aculeatus|6537        GCCAAATTTCAGAAGAGTGAATTGGATCATAAATTCAACAAGAAAGCTTTGGAGCGCCCG
Tetraodon_nigroviridis|8606        GCCAAATTCCAAAAAAGTGAATTGGAAGACAAGTTTAACAGACGAGCTCTGGAGAGGCCG
Fugu_rubripes|17860                GCCAAATTCCAGAAAAGTGAACTGAAGTACAAGTTTAACAAACGAGCTTTGGAGAGACCG
Xenopus_tropicalis|7302            GCAAAGTTTCAGAAGAGTGCGCTGGAGTACAAGTTCAATAAAAAAGCGCTGGAGAGGCCA
Dipodomys_ordii|12451              GCCAAGTTCCAGAAGAGTGAGCTGGAATTCAAGTTTAACCGGAAGGCTCTACAGAGGCCG
Sorex_araneus|5310                 GCCAAGTTTCAGAAGAGTGAGCTGGAGCACAAGTTCAACCGGAAGGCCCTGGAGCGGCCC
Macropus_eugenii|3366              ------------------------------------------------------------
Spermophilus_tridecemlineatus|6701 GCCAAGTTCCAGAAGAGTGAGCTGGAATTCAAGTTTAATCGGAAAGCCCTGGAAAGGCCA
Monodelphis_domestica|25546        GCCAAATTTCAAAAGAGTGAGCTGGAGCACAAGTTTAACCGTCGAGCTTTGGAGCGACCC
Macropus_eugenii|4860              GCCAAATTTCAGAAAAGTGAGCTGGAACACAAGTTCAACCGTCGGGCTTTGGAGCGACCC
Microcebus_murinus|13762           GCCAAGTTCCAGAAGAGTGAGCTGGAATTCAAGTTCAATCGGAAAGCCTTGGAGAGGCCA
Tupaia_belangeri|7743              GCCAAGTTCCAGAAGAGCGAGCTGGAATTCAAGTTCAATCGGAAAGCCTTGGAGAGGCCA
Anolis_carolinensis|12516          GCCAAGTTCCAAAAAAGTGAGCTCGAACACAAATTCAACAGGAAGGCATTGGAGAGGCCA
Ochotona_princeps|9469             GCCAAGTTCCAGAAGAGCGAGCTGGAATTCAAGTTCAATCGGAAGGCTTTGGAGAGGCCC
Echinops_telfairi|11114            GCCAAGTTCCAGAAGAGTGAGCTGGAATACAAGTTTAACCGGAGGGCCCTGGAGAGGCCT
Mus_musculus|28747                 GCTAAGTTTCAGAAGAGCGAGTTGGAGTTCAAGTTTAACCGGAAGGCCCTGGAGAGACCA
Rattus_norvegicus|27085            GCTAAGTTTCAGAAGAGTGAGTTGGAGTTCAAGTTTAACCGGAAGGCCCTGGAGAGACCA
Cavia_porcellus|11788              GCCAAGTTCCAGAAGAGTGAACTGGAATTCAAGTTTAATCGGAAAGCCTTGGAGAGGCCG
Procavia_capensis|13404            GCCAAGTTCCAGAAGAGTGAGCTGGAATACAAGTTTAACCGGAGAGCCTTGGCAAGGCCT
Loxodonta_africana|23090           GCCAAGTTCCAGAAGAGTGAGCTGGAATACAAGTTTAATCGGAGAGCCTTGGAGAGGCCA
Canis_familiaris|3275              GCCAAGTTCCAGAAGAGCGAGCTGGAGTACAAGTTTAATCGGAAAGCCTTGGAGAGGCCC
Erinaceus_europaeus|11688          GCCAAGTTCCAGAAGAGTGAGCTGGAGTACAAGTTTAATCGCAAAGCCTTGGAGAGGCCA
Bos_taurus|25318                   GCCAAGTTCCAGAAGAGTGAGCTGGAGTATAAGTTTAATCGGAAAGCCTTGGAGAGGCCA
Tursiops_truncatus|13214           GCCAAGTTCCAGAAGAGTGAGCTGGAGTATAAGTTTAATCGGAAAGCCTTGGAGAGGCCG
Felis_catus|37221                  GCCAAGTTCCAGAAGAGTGAGCTGGAGTACAAGTTTAATCGGAAAGCCTTGGAGAGGCCC
Vicugna_pacos|359                  GCCAAGTTCCAGAAGAGTGAGCTGGAATACAAGTTTAATCGGAAAGCCTTGGAGAGGCCG
Sus_scrofa|1708                    GCCAAGTTCCAGAAGAGTGAGCTGGAGTATAAGTTTAATCGGAAAGCCTTGGAGAGGCCG
Pteropus_vampyrus|3614             GCCAAGTTCCAGAAGAGTGAGCTGGAGTACAAGTTTAATCGGAAAGCCTTGGAGAGGCCG
Myotis_lucifugus|4915              ------------------------------------------------------------
Equus_caballus|16216               GCCAAGTTCCAGAAGAGTGAGCTGGAGTACAAGTTCAATCGGAAGGCCTTGGCGAGGCCG
Otolemur_garnettii|6328            GCCAAGTTCCAGAAGAGTGAGCTGGAATTCAAGTTTAATCGGAAAGCCTTGGAGAGGCCG
Callithrix_jacchus|47342           ------------------------------------------------------------
Gorilla_gorilla|9156               ------------------------------------------------------------
Homo_sapiens|94304                 GCTAAGTTCCAGAAGAGTGAGCTAGAATTCAAGTTTAATCGGAAAGCCTTGGAGAGGCCA
Pan_troglodytes|37248              GCCAAGTTCCAGAAGAGTGAGCTAGAATTCAAGTTTAATCGGAAAGCCTTGGAGAGGCCA
Pongo_abelii|27904                 GCCAAGTTCCAGAAGAGTGAGCTAGAATTCAAGTTTAATCGGAAAGCCTTGGAGAGGCCA
Ornithorhynchus_anatinus|19300     GCTAAGTTCCAGAAGAGTGAGCTGGAGCATAAGTTTAATAAGAAAGCCTTGGAGAGACCA
Gallus_gallus|23025                GCTAAGTTTCAGAAGAGCGAGCTGGAATACAAATTCAACAAAAAAGCCTTAGAGAGGCCG
Taeniopygia_guttata|18370          GCCAAGTTCCAGAAGAGTGAACTGGAGTACAAATTCAACAAGAAAGCCTTAGAAAGACCC
Choloepus_hoffmanni|8125           GCCAAGTTCCAGAAGAGTGAGCTGGAATATAAGTTTAATCGGAAAGCTTTGGAACGGCCA
Dasypus_novemcinctus|11596         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|13515             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                                                                               

Nematostella_vectensis|5682        ------------------------------------------------------------
Drosophila_grimshawi|11395         TACGTCAGTGATCACGCCTGGGGCAGCACATACGGGCAGCATAAGGAATATTTAGAATTT
Drosophila_melanogaster|15129      TATATCAGTGATCACGCCTGGGGAAAAACGTACGGGGAGCACAAGGAGTACCTGGAGTTC
Drosophila_sechellia|3500          TATATCAGCGATCACGCCTGGGGAAAAACCTACGGAGAGCACAAGGAGTATCTGGAGTTC
Drosophila_simulans|14756          TATATCAGCGATCACGCCTGGGGAAAAACCTACGGAGAGCACAAGGAGTATCTGGAGTTC
Pediculus_humanus|293              TACATTAGTCCTAATTCTTGGGGGGCAACATATGGGGATCATAAAAATTATTTAGAATTT
Bombyx_mori|1093                   TACGACAACCCAAACTCGTGGGGAAAGACGTACGGAGAACACAAAAGTCATTTGGAATTC
Tribolium_castaneum|1099           TACCGTGGCCCCCATTCATGGGGGGCCACCTACGGCGAACACAAACAATTTCTGGAATTT
Culex_quinquefasciatus|11186       TACAGCGGTGATAATTCGTGGGGAAGCACCTATGGCGAACACAAAGCATTTTTGGAGTTC
Daphnia_pulex|27157                TACGAGAGCCCACATGCTTGGGCTTCAACTTACGGGGAACACAAAACATTCTTGGAGTTT
Branchiostoma_floridae|21332       TACACCAGCCCCAACGCCTGGGGGCCGACTTACGGCGAACACAAACAGCACCTGGAGTTC
Branchiostoma_floridae|15501       TACACCAGCCCCAACGCCTGGGGGCCGACTTACGGCGAAACAAACAGCACCTGGAGTTCA
Danio_rerio|20197                  TACACATCCCCTCACGCTTGGGGCCCGACATACGGAGCTCATAAGCACCATCTGGAGTTC
Oryzias_latipes|24531              TACAACTCCAAAAACTCCTGGGGGAAAACCTACGGTGAACACAAGCGCCACCTGGAGTTC
Danio_rerio|2021                   TACACCTCCAAACACTCCTGGGGGAAAACATACGGAGAGCATAAGCGACACCTGGAGTTC
Gasterosteus_aculeatus|6537        TACAATTCTGTTCACTCCTGGGGGAAAACTTATGGTGAACACAAACGCCACCTGGAGTTC
Tetraodon_nigroviridis|8606        TACACTTCCAAACATTCTTGGGGGAAAACCTACGGTGAACACAAGCGTCATCTGGAGTTT
Fugu_rubripes|17860                TACACTTCCAAACACTCTTGGGGGAAAACTTATGGTGAACACAAGCATCATCTCGAGTTT
Xenopus_tropicalis|7302            TATAACTCTCCACACTCTTGGGGGAAAACATATGGAGATCACAAGCGCCACCTGGAGTTC
Dipodomys_ordii|12451              TACACTTCAAAACACTCCTGGGGAAAGACATATGGAGAGCACAAACGGCACCTAGAATTC
Sorex_araneus|5310                 TACACGTCCAAGCACTCCTGGGGCAAGACCTACGGGGAGCACAAGCGGCACCTGGAGTTC
Macropus_eugenii|3366              ------------------------------------------------------------
Spermophilus_tridecemlineatus|6701 TACACCTCAAAGCATTCCTGGGGGAAGACATATGGGGAGCACAAACGCCATTTGGAATTC
Monodelphis_domestica|25546        TACACTTCTAAACACTCTTGGGGGAAAACCTACGGAGACCACAAACGCCACCTTGAATTC
Macropus_eugenii|4860              TACGCTTCTAAACACTCCTGGGGGAAGACCTACGGAGAGCACAAGCGCTACCTCGAATTC
Microcebus_murinus|13762           TACACTTCGAAGCACTCCTGGGGGCAGACATACGGGGAGCACAAACGGCACCTGGAGTTC
Tupaia_belangeri|7743              TACACTTCGAAGCATTCCTGGGGGAAGACCTATGGGGAACACAAACGGCACCTGGAATTT
Anolis_carolinensis|12516          TACACATCCAAACACTCATGGGGAAAAAACTACGGAGAGCACAAACGCCACTTGGAGTTC
Ochotona_princeps|9469             TACACCTCAAAGCACTCGTGGGGGAAGACGTATGGTGAGCACAAGCGGCACCTGGAGTTC
Echinops_telfairi|11114            TACACGTCCAAGCACTCCTGGGGCAAGACATACGGGGAGCATAAACGCTACCTGGAGTTC
Mus_musculus|28747                 TATACTTCGAAGCATTCATGGGGGAAGACGTATGGGGAGCACAAGCGGCATCTGGAATTC
Rattus_norvegicus|27085            TATACTTCGAAGCATTCATGGGGGAAGACTTACGGGGAGCACAAACGACATCTAGAATTC
Cavia_porcellus|11788              TATACTTCGAAGCATTCTTGGGGGAAGACCTATGGGGAACATAAGCAGCACCTGGAATTC
Procavia_capensis|13404            TATACTTCAAAGCACTCCTGGGGGAAAACCTACGGGGAGCACAAGCGTTACCTGGAGTTC
Loxodonta_africana|23090           TATACTTCGAAGCATTCCTGGGGGAAAACCTACGGGGAACACAAACGTCACCTGGAATTC
Canis_familiaris|3275              TATACGTCCAAGCATTCCTGGGGCAAGACGTACGGGGAGCACAAGCGCCACCTGGAGTTC
Erinaceus_europaeus|11688          TACACCTCGAAGCATTCTTGGGGGAAGACTTATGGAGAGCACAAACGCCACCTGGAGTTC
Bos_taurus|25318                   TACACCTCGAAGCATTCCTGGGGGAAGACATACGGGGAGCACAAACGCCATCTGGAGTTC
Tursiops_truncatus|13214           TATACTTCGAAGCATTCCTGGGGGAAGACGTACGGGGAGCACAAACGCCACCTGGAATTC
Felis_catus|37221                  TACACGTCGAAGCATTCCTGGGGGAAGACGTATGGGGAGCACAAGCGCCACCTGGAGTTC
Vicugna_pacos|359                  TATACTTCGAAGCACTCCTGGGGGAAGACGTACGGGGAGCACAAACGCCACCTGGAATTC
Sus_scrofa|1708                    TACACTTCAAAGCACTCCTGGGGGAAGACCTACGGGGAGCACAAACGCCACCTGGAATTC
Pteropus_vampyrus|3614             TATGCTTCGAAGCATTCCTGGGGTAAGACGTATGGGGAACACAAGCGCCACCTGGAATTC
Myotis_lucifugus|4915              ------------------------------------------------------------
Equus_caballus|16216               TACACGTCGAAGCATTCCTGGGGGCAGACTTACGGGGAGCACAAGCGCCACCTGGAGTTC
Otolemur_garnettii|6328            TACACTTCGAAGCATTCCTGGGGAAAGACATACGGGGAGCACAAACGGCACCTAGAGTTC
Callithrix_jacchus|47342           ------------------------------------------------------------
Gorilla_gorilla|9156               ------------------------------------------------------------
Homo_sapiens|94304                 TACACCTCGAAGCATTCCTGGGGGAAGACGTACGGGGAGCACAAACGACATCTGGAGTTC
Pan_troglodytes|37248              TACACCTCGAAGCATTCCTGGGGGAAGACGTACGGGGAGCACAAACGACATCTGGAGTTC
Pongo_abelii|27904                 TACACCTCGAAGCATTCCTGGGGGAAGACGTACGGGGAGCACAAACGACATCTGGAGTTC
Ornithorhynchus_anatinus|19300     TACACCTCTCAGCACTCTTGGGGGAAAACCTACGGAGAGCACAAACGCCATCTCGAGTTC
Gallus_gallus|23025                TACACCTCCAAACACTCCTGGGGGAAGACCTACGGGGAGCACAAGCGCCACTTGGAGTTC
Taeniopygia_guttata|18370          TACACCTCTAAACACTCCTGGGGAAAGACCTATGGGGAGCACAAGCGCCACTTGGAGTTC
Choloepus_hoffmanni|8125           TATCCTTCGAAACATTCCTGGGGGAGAACCTATGGGGAGCACAAACGGCACCTGGAGTTC
Dasypus_novemcinctus|11596         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|13515             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                                                                               

Nematostella_vectensis|5682        ------------------------------------------------------------
Drosophila_grimshawi|11395         TCCAAGGAGGTGTACCATCTACTGCAG---------------GACTATAGCCGTGAAATT
Drosophila_melanogaster|15129      TCCAAAGATCAGTATCTCCAGCTGCAG---------------GCCCACTGCAAGGAGTTA
Drosophila_sechellia|3500          TCCAAGGATCAGTATCTCCAGCTGCAG---------------GCCCACTGCAAGGAGTTA
Drosophila_simulans|14756          TCCAAGGATCAGTATCTCCAGCTGCAG---------------GCCCACTGCAAGGAGTTA
Pediculus_humanus|293              GATGACAATGATTTTATAGAATTACAA---------------AATTTTTCACATTCTAAA
Bombyx_mori|1093                   TCCGATACACAATACAGAGAATTGTTT---------------AGATACGCTCAGGAGGTC
Tribolium_castaneum|1099           ACAAAAGAACAGTTTCGCGAATTGCAA---------------AGTTTTGCCGCCGAAATT
Culex_quinquefasciatus|11186       TCCCTGGAAGACTACAAAGAACTTCAG---------------CGATTCTGCGCCGAGCAG
Daphnia_pulex|27157                TCAGAGGACCATTATAAAGAACTGATG---------------GCATTTGCCTCTTTGATA
Branchiostoma_floridae|21332       AGCCACGATCAGTACAAGGAGCTCCAG---------------GCTTACGCCAAACAGCAA
Branchiostoma_floridae|15501       GCCACGATCAGTACAAGGAGCTCCAGGCTTACGCCAAACAGCAAGGCATCTACTTCTTTG
Danio_rerio|20197                  AGTCACGAGCAGTACAGAGAACTACAG---------------CAATACGCCACAGACATC
Oryzias_latipes|24531              AGCCATGAGCAGTACAGGGAGCTGCAG---------------AGATTCGCCGCAGACGTG
Danio_rerio|2021                   AGTCATGAGCAGTACAGGGAGCTGCAG---------------CAGTACGCTAAACAAGTG
Gasterosteus_aculeatus|6537        AGCCATGAGCAGTACAAGGAACTGCAG---------------AAATATGCTGAGGAGGTG
Tetraodon_nigroviridis|8606        AGTCACGACCAGTATGAAGAGCTGCAA---------------AAATACGCAGAAGAGGTT
Fugu_rubripes|17860                ACTCATGAACAGTATAAACAGCTGCAA---------------AAATATGCACAAGAGGTG
Xenopus_tropicalis|7302            AGCCATGATCAGTTCCGGGAGCTACAG---------------AAGTATGCAAAAGAAATT
Dipodomys_ordii|12451              AGCCATGCCCAGTACAAGGAGCTGCAG---------------CAATATGCCCAGGAGATC
Sorex_araneus|5310                 AGCCATGCCCAGTACAAGGAGCTGCAG---------------AGCTACGCCCAGGAGGTG
Macropus_eugenii|3366              ------------------------------------------------------------
Spermophilus_tridecemlineatus|6701 AGTCATGACCAATACCGGGAGCTGCAA---------------CGATACGCCGAGGAGATT
Monodelphis_domestica|25546        AGCCATGACCAGTATAGGGAGTTACAG---------------AAATATGCCAAGGAAATA
Macropus_eugenii|4860              AGCCACGATCAATACAGGGAGTTACAG---------------AAATATGCCAAGGAAATA
Microcebus_murinus|13762           AGCCACGACCAGTACAGGGAGCTGCAG---------------AGATATGCCAAGGAGGTT
Tupaia_belangeri|7743              AGCCATGACCAGTACCGGGAGCTGCAG---------------AGATATGCCGCGGAGGTG
Anolis_carolinensis|12516          AGCCACGACCAGTACCGGGAACTCCAG---------------CGCTATGCCAAGGAGATT
Ochotona_princeps|9469             AGCCATTCTCAGTACCGTGAGCTGCAG---------------CAGTATGCCCAGGAGGTG
Echinops_telfairi|11114            AGCCATGCCCAGTACCGGGAGCTGCAG---------------AGCTATGCCAGCGAGATC
Mus_musculus|28747                 AGCCACGACCAGTACAAGGAGCTGCAG---------------AGCTATGCGCAGGAGATC
Rattus_norvegicus|27085            AGCCACGATCAGTACAAGGAGCTGCAG---------------AGCTACGCGCAGGAGATT
Cavia_porcellus|11788              AGCCACGAGCAGTACCGGGAGCTGCAG---------------CGCTACGCCCGGGAGATC
Procavia_capensis|13404            AGCCATGACCAGTACAAGGAGCTGCAG---------------AAATATGCCGAGGAGATT
Loxodonta_africana|23090           AGCCATGCCCAGTACAAGGAGCTGCAG---------------AAATACGCCGAGGAGATT
Canis_familiaris|3275              AGCCACGAGCAGTACAGGGAGCTGCAG---------------AGATACGCTCAGGAGGTT
Erinaceus_europaeus|11688          AGCCACGCCCAGTACAAGGAGCTGCAG---------------AGATACGCCCAAGAGATC
Bos_taurus|25318                   AGCCATGCCCAGTACAAGGAGCTGCAG---------------AAATATGCCGAGGAGGTT
Tursiops_truncatus|13214           AGCCACGCCCAGTACAAGGAGCTGCAG---------------AAATATGCTGAGGAGGTT
Felis_catus|37221                  AGCCATGCCCAGTACAGGGAGCTGCAG---------------AGATACGCCCAGGAGATT
Vicugna_pacos|359                  AGCCACGCCCAGTACAGGGAGCTGCAG---------------AAGTATGCCAAGGAGGTT
Sus_scrofa|1708                    AGCCACGCCCAGTACAGGGAGCTGCAG---------------AAATTCGCTGAGGAGGTT
Pteropus_vampyrus|3614             AGCCATGCGCAGTACAAGGAGCTGCAG---------------AGGTATGCTGAGGAGGTT
Myotis_lucifugus|4915              ------------------------------------------------------------
Equus_caballus|16216               AGCCACGACCAGTACAAGGAGCTGCAG---------------AGCTATGCCCAGGAGGTT
Otolemur_garnettii|6328            AGCCATGACCAGTACCGGGAGCTGCAG---------------AGATATGCCGAGGAGGTG
Callithrix_jacchus|47342           ------------------------------------------------------------
Gorilla_gorilla|9156               ------------------------------------------------------------
Homo_sapiens|94304                 AGCCATGACCAGTACAGGGAGCTGCAG---------------AGGTACGCCGAGGAGGTT
Pan_troglodytes|37248              AGCCATGACCAGTACAGGGAGCTGCAG---------------AGGTACGCCGAGGAGGTT
Pongo_abelii|27904                 AGCCATGACCAGTACAGGGAGCTGCAG---------------AGGTACGCCGAGGAGGTT
Ornithorhynchus_anatinus|19300     AGCCACGACCAGTACAGGGAGCTGCAG---------------AAATATGCCGAGGAGATA
Gallus_gallus|23025                AGTCATGACCAGTACAGAGAGCTGAAG---------------AAGTATGCGGAGGAGGTT
Taeniopygia_guttata|18370          AGTCATGACCAATATAGAGAGCTAAAG---------------AAGTATGCAGAGGAAATT
Choloepus_hoffmanni|8125           AGCCACGCGCAGTACAGGGAGCTGCAG---------------AGCTATGCGGCGGAGGTG
Dasypus_novemcinctus|11596         NNNNNNNNNNNNNNNNNNNNNNNNNNN---------------NNNNNNNNNNNNNNNNNN
Tarsius_syrichta|13515             NNNNNNNNNNNNNNNNNNNNNNNNNNN---------------NNNNNNNNNNNNNNNNNN
                                                                                               

Nematostella_vectensis|5682        ------------------------------------------------------------
Drosophila_grimshawi|11395         GGAATCGATTTCACTGCATCCGCTATGGATGAGCGTTCTCTGGAGTTTCTG---GCAGAT
Drosophila_melanogaster|15129      AATGTGGACTTTACGGCTTCCGCCATGGATGAGAGATCGTTGGAGTTCCTT---TCTGCT
Drosophila_sechellia|3500          AATGTGGACTTTACGGCTTCCGCCATGGATGAGAGATCGTTGCAGTTCCTT---GCCGAT
Drosophila_simulans|14756          AATGTGGACTTTACGGCTTCCGCCATGGATGAGAGATCGTTGGAGTTCCTT---GCCGAT
Pediculus_humanus|293              AACATTATTTTTTCAAGTTCAGTAATGGATGAGGTTTCTTTAAACTTTTTA---AATAAT
Bombyx_mori|1093                   GGGATTTTATTCACCGCCTCTGCCATGGACATGGTATCTTTTGACTTTCTG---GTTAAC
Tribolium_castaneum|1099           GGTATTTTATTCACAGCGTCAGCAATGGATTCACAATCTTTACGATTTCTT---GCCAGT
Culex_quinquefasciatus|11186       GACATTCTCTTCAGTGCTTCAGCTATGGATCCAGTGTCGCTGCAGCAGCTG---CTCGAA
Daphnia_pulex|27157                AACATACACTTCACTGCCTCAGCCATGGACGAAATATCTTTAGATTTCCTA---GTCAGC
Branchiostoma_floridae|21332       GGCATCTACTTCTTCGCCTCGGCGATGGATGAGAAAGCTGCAGACTTCCTGGCGGATGAG
Branchiostoma_floridae|15501       CCTCAGCAATGGATGAGGTACGGACTTGAACTTCTTCCTGCAGACTTCCTGGCGGATGAG
Danio_rerio|20197                  GGCATCTTTTTTACCGCATCCGGCATGGACGAGATGGCGGTGGAGTTTCTT---CACGAA
Oryzias_latipes|24531              GGGATCTTCTTCACGGCTTCAGGGATGGACGAGATGGCGGTGGAGTTCCTC---CATGAG
Danio_rerio|2021                   GGCATCTTCTTCACTGCGTCTGGAATGGACGAGATGGCTGTAGAATTCCTC---CATGAA
Gasterosteus_aculeatus|6537        GACATCTGTTTCACTGCGTCTGGGATGGATGAGATGGCAGTGGAGTTCCTC---CATGAG
Tetraodon_nigroviridis|8606        GGGATCTTCTTCACTGCCTCTGGGATGGATGAGATGGCAGTGGAATTTCTT---CACGAA
Fugu_rubripes|17860                GGGATCTTCTTCACTGCCTCTGGGATGGATGAGATGGCAGTAGAATTTCTT---CATGAA
Xenopus_tropicalis|7302            GGGATTTATTTTACAGCATCTGGTATGGATGAGATGGCAGTGGAATTCCTT---CATGAG
Dipodomys_ordii|12451              GGCATTTTCTTCACTGCCTCTGGCATGGACGAGATGGCAGTTGAGTTTCTA---CATGAA
Sorex_araneus|5310                 GGCATCTTCTTCACCGCCTCGGGCATGGACGAGATGGCGGTTGAGTTCCTG---CATGAA
Macropus_eugenii|3366              ---------------------------------ATGGCAGTCGAGTTTCTG---GATGAA
Spermophilus_tridecemlineatus|6701 GGCATCTTCTTCACTGCGTCTGGCATGGATGAGATGGCAGTTGAGTTTCTG---CATGAA
Monodelphis_domestica|25546        GGGATTTTCTTCACAGCTTCTGGAATGGATGAGATGGCGGTTGAGTTTCTG---GATGAA
Macropus_eugenii|4860              GGGATTTTCTTCACTGCCTCTGGAATGGATGAGNNNNNNNNNNNNNNNNNN---NNNNNN
Microcebus_murinus|13762           GGGATTTTCTTCACTGCCTCTGGCATGGACGAGNNNNNNNNNNNNNNNNNN---NNNNNN
Tupaia_belangeri|7743              GGGATCTTCTTCACCGCCTCTGGCATGGACGAGNNNNNNNNNNNNNNNNNN---NNNNNN
Anolis_carolinensis|12516          GGCATTTTCTTTACAGCCTCAGGAATGGATGAAATGGCTGTAGaatttctt---catgaa
Ochotona_princeps|9469             GGCATCTTCTTCACGGCCTCTGGCATGGATGAGATGGCCGTGGAGTTTCTG---CATGAA
Echinops_telfairi|11114            GGCATCTTCTTCACCGCCTCGGGCATGGATGAGATGGCGGTTGAGTTCCTG---CATGAA
Mus_musculus|28747                 GGCATCTTCTTCACTGCCTCTGGCATGGACGAGATGGCAGTTGAGTTTCTG---CACGAA
Rattus_norvegicus|27085            GGCATCTTCTTCACTGCGTCTGGCATGGATGAGATGGCAGTTGAGTTTCTG---CATGAA
Cavia_porcellus|11788              GACATCTTCTTCACTGCGTCAGGCATGGATGAGATGGCGGTTGAGTTTCTG---CATGAA
Procavia_capensis|13404            GGGATCTTCTTCACTGCCTCTGGCATGGACGAGATGGCAGTTGAGTTCCTG---CATGAA
Loxodonta_africana|23090           GGGATCTTCTTCACGGCCTCTGGCATGGACGAGATGGCAGTTGAGTTCCTG---CATGAA
Canis_familiaris|3275              GGCATCTTCTTCACGGCCTCGGGCATGGATGAGATGGCAGTTGAGTTTCTG---CATGAG
Erinaceus_europaeus|11688          GGCATCTTCTTCACTGCCTCTGGCATGGATGAGATGGCTGTTGAGTTTCTA---CATGAA
Bos_taurus|25318                   GGCATCTTCTTCACTGCCTCTGGAATGGATGAGATGGCAGTTGAGTTTCTG---CATGAA
Tursiops_truncatus|13214           GGCATCTTCTTCACTGCCTCCGGCATGGATGAGATGGCAGTTGAGTTTCTG---CATGAA
Felis_catus|37221                  GGCATCTTCTTCACTGCCTCTGGAATGGATGAGATGGCAGTTGAATTTCTG---CATGAG
Vicugna_pacos|359                  GGCATCTTCTTCACTGCCTCTGGCATGGATGAGATGGCAGTTGAGTTTCTG---CACGAA
Sus_scrofa|1708                    GGCATCTTCTTCACTGCCTCTGGCATGGATGAGATGGCAGTTGAGTTTCTG---CATGAA
Pteropus_vampyrus|3614             GGCATCTTCTTCACTGCCTCTGGCATGGATGAGATGGCAGTTGAGTTTCTG---CATGAG
Myotis_lucifugus|4915              ---------------------------------ATGGCAGTTGAATTTCTG---CATGAA
Equus_caballus|16216               GGCATCTTCTTCACCGCCTCTGGCATGGATGAGATGGCAGTTGAGTTTCTG---CATGAA
Otolemur_garnettii|6328            GGGATCTTCTTCACTGCCTCCGGCATGGACGAGATGGCAGTTGAATTTCTG---CACGAA
Callithrix_jacchus|47342           ---------------------------------ATGGCAGTTGAATTCCTA---CATGAA
Gorilla_gorilla|9156               ---------------------------------ATGGCAGTTGAATTCCTG---CATGAA
Homo_sapiens|94304                 GGGATCTTCTTCACTGCCTCTGGCATGGATGAGATGGCAGTTGAATTCCTG---CATGAA
Pan_troglodytes|37248              GGGATCTTCTTCACTGCCTCTGGCATGGATGAGATGGCAGTTGAATTCCTG---CATGAA
Pongo_abelii|27904                 GGGATCTTCTTCACTGCCTCTGGCATGGATGAGATGGCAGTTGAATTCCTG---CATGAA
Ornithorhynchus_anatinus|19300     GGGATTTTCTTCACAGCCTCTGGCATGGATGAGATGGCAGTTGAGTTTCTG---CATGAG
Gallus_gallus|23025                GGGATTTTCTTCACGGCTTCTGGCATGGATGAGATGGCTGTGGAATTTCTT---CATGAA
Taeniopygia_guttata|18370          GGCATTTTCTTCACAGCTTCTGGCATGGATGAGATGGCTGTGGAATTTCTA---CATGAA
Choloepus_hoffmanni|8125           GGGATCTTCTTCACTGCCTCTGGCATGGATGAGATGGCAGTTGAGTTTCTG---CATGAG
Dasypus_novemcinctus|11596         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGGCAGTTGAGTTTCTG---CACGAG
Tarsius_syrichta|13515             NNNNTCTTCTTCTCTGCCTCTGTGCTGCAGGAGATGGCAGTGGAATTTCTG---CATGAA
                                                                                               

Nematostella_vectensis|5682        ------------------------------------------------------------
Drosophila_grimshawi|11395         TTACGAGTTCCGTTTATTAAAATTGGCTCAGGCGATGCCAACAATTTTCCACTTCTGACA
Drosophila_melanogaster|15129      CTAAATGTTCCCTTCATCAAAATTGGTTCCGGAGACGCAAACAACTTTCCGCTTCTCAAA
Drosophila_sechellia|3500          CTAAATGTTCCCTTCATCAAAATTGGCTCCGGAGATGCAAACAACTTTCCGCTTCTCAAA
Drosophila_simulans|14756          CTAAATGTTCCCTTCATCAAGATTGGCTCCGGAGATGCAAACAACTTTCCGCTTCTCAAA
Pediculus_humanus|293              CTTGATGTTCCATTTATAAAAATTGGCTCTGGTGATGCTCACAATTTCAAATTACTCAAA
Bombyx_mori|1093                   CTAAAAGTGCCATTTATCAAAATCGGCTCAGGGGACTCGAACAACTTGCTCTTCCTAAAG
Tribolium_castaneum|1099           TTGAACGTTCCGTTTATTAAGATAGGGTCCGGTGATTCTAATAATTTGCTACTGATTCAA
Culex_quinquefasciatus|11186       CTGCGCGTCCCATTCATCAAGATCGGCTCCGGCGACGCCGACAACGTGCCGATGTTACGA
Daphnia_pulex|27157                TTGGGAGTTCCATTCATAAAGATGGGTTCAGGAGATGCCAATAACTTGATTCTGCTGGAG
Branchiostoma_floridae|21332       CTGGATGTTCCGTTCATCAAAGTCGCTTCAGCTGACGCCAACAACCTGCCTTACCTGAAG
Branchiostoma_floridae|15501       CTGGATGTTCCGTTCATCAAAGTCGCTTCAGCTGACGCCAACAACCTGCCTTACCTGAAG
Danio_rerio|20197                  ATAAACGTGCCGTTTTTCAAAGTGGCCTCAGCCGACACCAACAACATCCCCTACCTCGAG
Oryzias_latipes|24531              ATCAACGTGCAATTCTGTTCATGTGGTTCTGGA---------------CTGTTCCTGTCA
Danio_rerio|2021                   CTCGATGTGCCTTTTTTCAAAGTTGGATCTGGAGACACCAACAACTTTCCTTACCTCAAG
Gasterosteus_aculeatus|6537        CTTAATATTCCTTTCTTTAAAGTGGGCTCAGGAGACACCAACAACTTCCCTTATTTGGAG
Tetraodon_nigroviridis|8606        CTCAAAGTGCCTTTTTTCAAAGTCGGCTCTGGAGACACCAACAACTTTCCTTATCTAGAG
Fugu_rubripes|17860                CTCAATGTGCCTTTTTTCAAAGTTGGTTCTGGAGATACCAACAACTTTCCCTATCTGGAA
Xenopus_tropicalis|7302            CTGGAAGTACCTTTTTTCAAAGTGGGTTCAGGGGACACCAATAATTTTCCGTATTTAAAA
Dipodomys_ordii|12451              CTGAACGTTCCATTCTTCAAAGTTGGATCTGGAGACACAAACAATTTTCCATATCTAGAG
Sorex_araneus|5310                 CTGAACGTTCCATTTTTCAAAGTTGGATCTGGGGACACTAACAATTTTCCTTATCTGGAA
Macropus_eugenii|3366              TTGAATGTTCCATTTTTCAAAGTTCGATCTGGAGATACTAACAATTTTCCCTATCTAGAA
Spermophilus_tridecemlineatus|6701 CTGAATGTTCCATTTTTCAAAGTTGGATCTGGGGACACTAACAATTTTCCTTATCTGGAA
Monodelphis_domestica|25546        TTAAATGTTCCATTTTTCAAAGTTGGATCTGGAGACACTAACAACTTTCCATATCTGGAA
Macropus_eugenii|4860              NNNNACGTTCCATTT---AAAGTTGGATCTGGAGATACTAACAATTTTCCCTATCTGGAA
Microcebus_murinus|13762           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|7743              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Anolis_carolinensis|12516          ctggatgttccattttttaaagtagGATCTGGAGACACCAACAATTTCCCATACTTGGAA
Ochotona_princeps|9469             CTGAATGTCCCGTTTTTCAAAGTTGGATCTGGGGACACTAACAATTTTCCTTATCTGGAA
Echinops_telfairi|11114            CTGAACGTCCCCTTTTTCAAAGTTGGATCTGGGGACACTAACAATTTTCCTTATCTGGAA
Mus_musculus|28747                 CTGAATGTTCCCTTTTTCAAAGTTGGATCTGGGGACACTAACAATTTTCCCTACCTGGAA
Rattus_norvegicus|27085            CTGAATGTTCCCTTTTTCAAAGTTGGATCTGGAGACACTAACAATTTTCCCTACCTGGAA
Cavia_porcellus|11788              CTGAATGTTCCATTTTTTAAAGTTGGATCTGGAGACACTAACAATTTCCCTTATCTGGAA
Procavia_capensis|13404            CTGAATGTTCCATTTTTCAAAGTTGGATCTGGGGACACTAACAATTTTCCTTATCTGGAA
Loxodonta_africana|23090           CTGAATGTTCCATTTTTCAAAGTTGGATCTGGAGACACTAACAATTTTCCTTACCTGGAA
Canis_familiaris|3275              CTGAATGTTCCGTTTTTCAAAGTTGGATCTGGGGACACTAATAATTTTCCTTATCTGGAA
Erinaceus_europaeus|11688          CTGAATGTTCCGTTTTTCAAAGTTGGATCTGGAGACACCAATAATTTTCCTTATCTGGAA
Bos_taurus|25318                   CTGAATGTTCCCTTTTTCAAAGTTGGATCTGGGGACACCAACAATTTCCCGTATCTGGAA
Tursiops_truncatus|13214           CTGAATGTTCCATTTTTCAAAGTTGGATCTGGGGACACTAACAACTTCCCTTATCTGGAA
Felis_catus|37221                  CTGAATGTTCCGTTTTTCAAAGTTGGATCTGGGGACACTAACAATTTTCCTTATCTGGAA
Vicugna_pacos|359                  CTGAATGTTCCATTTTTCAAAGTTGGATCTGGGGATACTAACAATTTCCCTTATCTGGAA
Sus_scrofa|1708                    CTGAATGTTCCATTTTTCAAAGTTGGATCTGGGGACACTAATAATTTCCCTTATCTGGAA
Pteropus_vampyrus|3614             CTGAATGTTCCATTTTTCAAAGTTGGATCTGGGGACACTAACAATTTTCCTTACCTGGAA
Myotis_lucifugus|4915              TTGAATGTTCCATTTTTCAAAGTTGGATCTGGGGACACTAACAATTTTCCTTATCTGGAA
Equus_caballus|16216               CTGAATGTTCCGTTTTTCAAAGTTGGATCTGGGGACACTAACAATTTTCCTTATCTGGAA
Otolemur_garnettii|6328            CTGAATGTTCCATTTTTCAAAGTTGGATCTGGGGACACTAACAATTTTCCTTATCTGGAA
Callithrix_jacchus|47342           CTGAATGTTCCATTTTTCAAAGTTGGATCTGGAGATACTAATAATTTTCCTTATCTGGAA
Gorilla_gorilla|9156               CTGAATGTTCCATTTTTCAAAGTTGGATCTGGAGACACTAATAATTTTCCTTATCTGGAA
Homo_sapiens|94304                 CTGAATGTTCCATTTTTCAAAGTTGGATCTGGAGACACTAATAATTTTCCTTATCTGGAA
Pan_troglodytes|37248              CTGAATGTTCCATTTTTCAAAGTTGGATCTGGAGACACTAATAATTTTCCTTATCTGGAA
Pongo_abelii|27904                 CTGAATGTTCCATTTTTCAAAGTTGGATCTGGAGACACTAATAATTTTCCTTATCTGGAA
Ornithorhynchus_anatinus|19300     CTGAATGTTCCCTTTTTCAAAGTAGGATCTGGGGACACTAACAATTTTCCATACCTGGAG
Gallus_gallus|23025                CTGGATGTTCCGTTTTTCAAAGTAGGATCAGGAGATACAAACAATTTTCCATATTTGGAA
Taeniopygia_guttata|18370          CTGGATGTTCCATTTTTCAAAGTAGGATCAGGAGATACAAATAATTTTCCATATTTGGAA
Choloepus_hoffmanni|8125           CTGGATGTTCCGTTTTTCAAAGTTGGATCTGGGGACACTAACAATTTCCCTTATCTGGAA
Dasypus_novemcinctus|11596         CTGGACGTTCCGTTTTTCAAAGTTGGATCAGGAGACACCAACCATTTTCCCTTACCTGAA
Tarsius_syrichta|13515             CTGAATGTTCCGTTTTTCAAAGTTGGATCTGGGGATACTAACAATTTCCCTTATCTGGAA
                                                                                               

Nematostella_vectensis|5682        ------------------------------------------------------------
Drosophila_grimshawi|11395         AAAGCTGCTAGCCTGCAAATA---CCTTTGGTTATATCAACCGGAATGCAAACCATGTCC
Drosophila_melanogaster|15129      AAGGCCGCCAATTTGAACTTG---CCCCTGGTGATCTCCACCGGAATGCAGACTATGCAA
Drosophila_sechellia|3500          AAGGCCGCCAATTTGAACTTG---CCCCTGGTGATCTCCACCGGAATGCAGACTATGCAA
Drosophila_simulans|14756          AAGGCCGCCAATTTGAACTTG---CCCCTGGTGATCTCCACAGGAATGCAGACTATGCAA
Pediculus_humanus|293              TTGGCATCAAGGTTAGGTAAA---CCTTTAATTATTTCAACAGGTATGTCTCACATTAGT
Bombyx_mori|1093                   TACGCTGCTTCGAAAAAGATT---CCTTTAATTATATCAACGGGGATGGTCGACAAAACT
Tribolium_castaneum|1099           GAAGCCGCAGCAATGAATGTG---CCTTTGGTCATATCAACAGGAATGCAAGACCTGGGG
Culex_quinquefasciatus|11186       ACGGCGGCCGCTGCAACCTCCGTACCTTTGATAGTATCAACCGGGATGCAGAGCTGGTCC
Daphnia_pulex|27157                AAAGCTGCTAAGACCAAACTA---CCTATTATATATTCTACAGGAATGCAAGACATGCAA
Branchiostoma_floridae|21332       CACACTGCGAGCAAAGGAAAG---CCGATGATCCTGTCGTCCGGTATGCAGTCCATGGGT
Branchiostoma_floridae|15501       CACACTGCGAGCAAAGGAAAG---CCGATGATCCTGTCGTCCGGTATGCAGTCCATGGGT
Danio_rerio|20197                  AAAACAGCCAAAAAGGGTAAATTTAAGTTGTCAACATTATCAGGTTTAAATAACTTAAGA
Oryzias_latipes|24531              ---------------GGTCGT---CCCATGGTGGTGTCCAGCGGCATGCAGTCCATGGAG
Danio_rerio|2021                   AAAACTGCCCAAAAAGGACGC---CCCATGGTAGTGTCCAGCGGGATGCAGTCCATGGAA
Gasterosteus_aculeatus|6537        AAGACTGCCAAGAAAGGACGG---CCCATGATTGTATCCAGCGGGATGCAGAACATGGAG
Tetraodon_nigroviridis|8606        AAGACTGCCAAGAAAGGACGT---CCCATGGTGGTGTCCAGCGGGATGCAGTCTATGGCG
Fugu_rubripes|17860                AAGACTGCCAAGAAAGGACGT---CCCATGGTGGTGTCTAGCGGGATGCAGTCTATGCAG
Xenopus_tropicalis|7302            AAGATGGCGCAGAAAGGTCGT---CCCATGGTAATATCAAGTGGAATGCAGTCCCTGGAC
Dipodomys_ordii|12451              AAGACAGCCAAGAAAGNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Sorex_araneus|5310                 AAGACGGCCAAGAAAGNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Macropus_eugenii|3366              AAGACAGCCAAGAAATGTCTG------ATGGTTATTTCCAGTGATATGCAGTCCATGGGC
Spermophilus_tridecemlineatus|6701 AAGACAGCC---AAAGGTCGT---CCGATGGTGATCTCCAGCGGGATGCAGTCAATGGAC
Monodelphis_domestica|25546        AAGACAGCGAAAAAAGGTCGT---CCGATGGTTATTTCCAGTGGTATGCAGTCCATGGAC
Macropus_eugenii|4860              AAGACAGCCAAGAAAGGTCGT---CCGATGGTTATTTCCAGTGGTATGCAGTCCATGGAC
Microcebus_murinus|13762           NNNNNNNNNNNNNNNNGTCGC---CCGATGGTGATCTCCAGCGGGATGCAGTCGATGGAC
Tupaia_belangeri|7743              NNNNNNNNNNNNNNNNGTCGT---CCGATGGTGATCTCCAGCGGGATGCAGTCCATGGAC
Anolis_carolinensis|12516          AAGACAGccaaaaaagGCCGT---CCAATGGTGATTTCCAGCGGGATGCAGTCTATGAGC
Ochotona_princeps|9469             AAGACAGCTAGAAAAGGTCGT---CCGATGGTGATCTCCAGCGGGATGCAGTCGATGGAC
Echinops_telfairi|11114            AAGACAGCCAAAAAAGGTCGT---CCAATGGTCATCTCCAGCGGGATGCAGTCCATGGAG
Mus_musculus|28747                 AAGACAGCCAAGAAAGGTCGT---CCTATGGTGATCTCCAGCGGGATGCAGTCAATGGAC
Rattus_norvegicus|27085            AAGACAGCCAAGAAAGGTCGT---CCTATGGTGATCTCCAGTGGGATGCAGTCCATGGAC
Cavia_porcellus|11788              AAGACAGCCAAAAAGGGTCGT---CCAATGGTGATCTCCAGTGGGATGCAATCGATGGAT
Procavia_capensis|13404            AAGACAGCCCAAAAAGGTCGT---CCCATGGTGATCTCCAGTGGGATGCAGTCAATGGAT
Loxodonta_africana|23090           AAGACTGCCAAAAAAGGTCGG---CCAATGGTGATCTCCAGTGGGATGCAGTCAATGGAC
Canis_familiaris|3275              AAGACAGCCAAAAAAGGCCGC---CCAATGGTGATCTCCAGTGGAATGCAGTCGATGGAC
Erinaceus_europaeus|11688          AAGACAGCCAAGAAAGGCCGC---CCGATGGTGATCTCCAGTGGGATGCAGTCGATGGAC
Bos_taurus|25318                   AAGACAGCCAAAAAAGGCCGC---CCAATGGTGATCTCTAGTGGGATGCAGTCCATGGAT
Tursiops_truncatus|13214           AAGACAGCCAGAAAAGGCCGC---CCAATGGTCATCTCCAGTGGGATGCAGTCCATGGAC
Felis_catus|37221                  AAGACCGCCAAAAAAGGCCGC---CCAATGGTGATCTCCAGCGGGATGCAGTCAATGGAC
Vicugna_pacos|359                  AAGACGGCCAAAAAAGGCCGC---CCCATGGTGATCTCCAGTGGGATGCAGTCGATGGAC
Sus_scrofa|1708                    AAGACAGCCAAAAAAGGCCGC---CCAATGGTCATCTCCAGTGGGATGCAGTCAATGGAC
Pteropus_vampyrus|3614             AAGACAGCCAAAAAAGGCCGC---CCCATGGTGATCTCCAGCGGGATGCAGTCAATGGAC
Myotis_lucifugus|4915              AAGACAGCCAAAAAAGGCCGC---CCAATGGTGATCTCCAGCGGGATGCAGTCTATGGAC
Equus_caballus|16216               AAGACAGCCAAAAAAGGCCGT---CCGATGGTGATCTCCAGCGGGATGCAGTCAATGGAC
Otolemur_garnettii|6328            AAGACAGCCAAAAAAGGTCGC---CCGATGGTGATCTCCAGCGGGATGCAGTCGATGGCC
Callithrix_jacchus|47342           AAGACAGCCAAAAAAGGTCGC---CCAATGGTGATCTCCAGCGGGATGCAGTCGATGGAC
Gorilla_gorilla|9156               AAGACAGCCAAAAAAGGTCGC---CCAATGGTGATCTCCAGCGGGATGCAGTCAATGGAC
Homo_sapiens|94304                 AAGACAGCCAAAAAAGGTCGC---CCAATGGTGATCTCCAGTGGGATGCAGTCAATGGAC
Pan_troglodytes|37248              AAGACAGCCAAAAAAGGTCGC---CCAATGGTTATCTCCAGCGGGATGCAGTCAATGGAC
Pongo_abelii|27904                 AAGACAGCCAAAAAAGGTCGC---CCAATGGTGATCTCCAGCGGGATGCAGTCGATGGAC
Ornithorhynchus_anatinus|19300     AAAACTGCAAAAAAAGGTCGT---CCTATGGTTATTTCCAGTGGTATGCAGTCGATGAAC
Gallus_gallus|23025                AAGACTGCAAAGAAAGGACGC---CCAATGGTGATTTCCAGCGGGATGCAGTCGATGAAC
Taeniopygia_guttata|18370          AAGACTGCAAAGAAAGGTCGT---CCAATGGTGATTTCCAGTGGGATGCAGTCCATGAAC
Choloepus_hoffmanni|8125           AAGACAGCCAAGAAAGGCCGC---CCCATGGTGATCTCCAGTGGGATGCAGTCCAGGGAC
Dasypus_novemcinctus|11596         AAGACAGCTAAAAAAGGCCGC---CCGATGGTGATCTCCAGCGGGATGCAGTCCATGGCC
Tarsius_syrichta|13515             AAGACAGCCAAAAAAGGTCGC---CCGATGGTGATCTCCAGCGGGATGCAATCGATGGCC
                                                                                               

Nematostella_vectensis|5682        ---------------------------------------------------AAT---ATT
Drosophila_grimshawi|11395         ACAGTCGATAAGATCGTTGAAATTATGAGCGAGTCACGAAAT---------GAAATGTAT
Drosophila_melanogaster|15129      ACTGTGGAGAGGATTGTGCAAACTATGCGGGAGTCAGGAAAA---------GAGGACTAC
Drosophila_sechellia|3500          ACTGTGGAGAGGATTGTGCAAACTATGAGAGAGTCTGGAAAA---------GAGGACTAC
Drosophila_simulans|14756          ACTGTGGAGAGGATTGTGCAAACTATGAGGGAGTCAGGAAAA---------GAGGACTTC
Pediculus_humanus|293              GATGTTATTGAAATATACAATTTGCTTAAATCAAACCACATG---------AAT---TTT
Bombyx_mori|1093                   GCCGTAAAGACAATTTACGATATCATTTCCTCGGACCACAAG---------CAG---TTC
Tribolium_castaneum|1099           GGTGTGAGAGCCACTTATGAGTGTGTCGCTCAGTATCATAAA---------AAA---TTT
Culex_quinquefasciatus|11186       CAGGTTCAGAACATTTACCCGATCATCAAAGCTCAT---CCG---------TCC---GCC
Daphnia_pulex|27157                ACAGTCAAAACTGCCATGGAAAGAATGAATGCCTGTAATCCC---------CGG---GTC
Branchiostoma_floridae|21332       ATCATGGAGCGGGCTGTGGGCACTGTGACAGAGAACATGCCGGGCGAGAAGCGC---CTT
Branchiostoma_floridae|15501       ATCATGGAGCGGGCTGTGGGCACTGTGACAGAGAACATGCCGGGCGAGAAGCGC---CTT
Danio_rerio|20197                  CTAAAGAAAACTTTTCACACAAATAACTTAAGACTAAATAAA---------ACT---TTT
Oryzias_latipes|24531              ACCATGCGTCGTGTCTACAGAACCGTGAAGGAACACAACCCA---------AAC---TTT
Danio_rerio|2021                   ACCATGCAGCACGTTTATAAGATTGTGAAGGAGCACAATCAG---------AAC---TTT
Gasterosteus_aculeatus|6537        ACGATGCGTCAGGTCTACAAAACCGTGAAGGAGCACAACCCA---------AAC---TTT
Tetraodon_nigroviridis|8606        ACGATGCGTCGAGTATACAAAACGGTGAAAGAGCACAATCAG---------AAC---TTT
Fugu_rubripes|17860                ACAATGCGTCGAGTCTACAAAACAGTGAAGGAGCACAATCCG---------AAA---TTT
Xenopus_tropicalis|7302            ACTATGCGTCGTGTTTATGAAATGGTGAAACCATTGAATCCA---------AAC---TTC
Dipodomys_ordii|12451              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------NNN---NNN
Sorex_araneus|5310                 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------NNN---NNN
Macropus_eugenii|3366              ATGATGAGACAGGTCTACAATATTGTGAAACGT---AACCCA---------AAT---TTC
Spermophilus_tridecemlineatus|6701 TTCATA---CAGGTCTACCAGATCGGGAAGCCCCTCAACCCC---------ATC---TTT
Monodelphis_domestica|25546        ACGATGAGGCAAGTCTACAACATTGTGAAACCCATAAACCCA---------AAC---TTC
Macropus_eugenii|4860              GCGATGAGACAGGTCTACAATATTGTAAAACCTATAAACCCA---------AAC---TTC
Microcebus_murinus|13762           ACCATGAAGCAGGTCTACCGGATCGTGAAGCCGCTCAACCCC---------AAC---TTC
Tupaia_belangeri|7743              ACCATGAAGCAAGTCTATCAGATTGTGAAGCCCCTCAACCCC---------AAC---TTC
Anolis_carolinensis|12516          ACAATGCAGCAGGTTTACAATCTGGTGAAGCCCATCAACCCA---------AAC---TTC
Ochotona_princeps|9469             ACCATGAAGCAAGTCTATCAAATCGTGAAGCCCCTCAACCCT---------AAC---TTC
Echinops_telfairi|11114            ACCATGAAGCAAGTCTACCAGATCGTGAAGCCCCTCAACCCC---------AAC---TTC
Mus_musculus|28747                 ACCATGAAGCAAGTCTATCAGATCGTGAAGCCGCTGAATCCC---------AAC---TTC
Rattus_norvegicus|27085            ACCATGAAGCAAGTCTATCAGATCGTGAAGCCCCTGAATCCC---------AAC---TTC
Cavia_porcellus|11788              ACCATGAAGCAAGTCTACCAGATCGTGAAGCCCCTGAACCCC---------AAC---TTC
Procavia_capensis|13404            ACCATGAAGCAGGTCTACCAGATTGTGAAACCCATCAACCCC---------AAC---TTC
Loxodonta_africana|23090           ACCATGAAGCAGGTCTACCAGATTGTGAAACCTATCAACCCC---------AAC---TTC
Canis_familiaris|3275              ACCATGAAGCAAGTCTATCAGATTGTGAAGCCTCTCAACCCC---------AAC---TTC
Erinaceus_europaeus|11688          ACCATGAAGCAAGTCTATCAGATCGTGAAGCCCCACAACCCC---------AAC---TTC
Bos_taurus|25318                   ACCATGAAGCAAGTCTATCAGATTGTGAAGGCCCTCAACCCC---------AAC---TTC
Tursiops_truncatus|13214           ACCATGAAGCAAGTCTATCAGATTGTGAAGCCCCTCAACCCC---------AAC---TTC
Felis_catus|37221                  ACCATGAAGCAAGTCTATCAGATTGTGAAGCCCCTCAACCCC---------AAC---TTC
Vicugna_pacos|359                  ACCATGAAGCAAGTCTATCAGATTGTGAAGCCCCTCAACCCC---------AAC---TTC
Sus_scrofa|1708                    ACCATGAAGCAAGTCTATCAGATTGTGAAGCCCCTCAACCCC---------AAC---TTC
Pteropus_vampyrus|3614             ACCATGAAGCAAGTCTATCAGATTGTGAAGCCCCTCAACCCC---------AAT---TTC
Myotis_lucifugus|4915              ACCATGAAGCAAGTCTATCAGATTGTGAAGCCCCTCAACCCC---------AAC---TTC
Equus_caballus|16216               ACCATGAAGCAAGTCTATCAGATTGTGAAGCCGCTCAACCCC---------AAC---TTC
Otolemur_garnettii|6328            ACCATGAAGCAGGTCTATCAGATTGTGAAGCCCCTGAACCCC---------AAC---TTC
Callithrix_jacchus|47342           ACCATGAAGCAAGTCTATCAGATCGTGAAGCCCCTCAACCCC---------AAC---TTC
Gorilla_gorilla|9156               ACCATGAAGCAAGTTTATCAGATCGTGAAGCCCCTCAACCCC---------AAC---TTC
Homo_sapiens|94304                 ACCATGAAGCAAGTTTATCAGATCGTGAAGCCCCTCAACCCC---------AAC---TTC
Pan_troglodytes|37248              ACCATGAAGCAAGTTTATCAGATTGTGAAGCCCCTCAACCCC---------AAC---TTC
Pongo_abelii|27904                 ACCATGAAGCAAGTTTATCAGATCGTGAAGCCCCTCAACCCC---------AAC---TTC
Ornithorhynchus_anatinus|19300     ACCATGCGCCAGGTCTATCAAATTGTGAAGCCTATTAATCCC---------AAC---TTC
Gallus_gallus|23025                ACAATGCGCCAGGTTTATCAGATTGTGAAGCCCCTCAATCCA---------AAC---TTC
Taeniopygia_guttata|18370          ACAATGCATCAGGTTTATCAGATTGTGAAGCCCATAAATCCA---------AAC---TTC
Choloepus_hoffmanni|8125           ACCATGAAGCAGGTGTACGAGATCGTGAAACCCCTCAACCCC---------AAC---TTC
Dasypus_novemcinctus|11596         ACCATGAGGCAGGTCTACGAGCTCGTGAAGCCCCTCAACCCC---------AAC---TTC
Tarsius_syrichta|13515             ACCATGAAGCAGGTC---CAGATCGTGAAGCCTCTCAACCCC---------AAC---TTC
                                                                                               

Nematostella_vectensis|5682        GCTTTATTGAAATGCACATCAAGTTATCCAGCACCTATTGAAGAAGCAAATATGTGCATG
Drosophila_grimshawi|11395         GCCCTAATGCACTGCATCTCGGCATATCCGACACCGCCAACTGATTGTAATTTAGGTTTG
Drosophila_melanogaster|15129      GCTCTAATGCACTGCGTTTCATCGTACCCAACTGACCCAAAAGATTGCAGCTTGCAGTTG
Drosophila_sechellia|3500          GCTCTAATGCACTGCGTTTCATCGTACCCAACTGACCCCGAAGATTGCAGCTTGGAGTTG
Drosophila_simulans|14756          GCTCTAATGCACTGCGTTTCATCGTACCCAACTGACCCCGAAGATTGCAGCTTGCAGTTG
Pediculus_humanus|293              TCCTTATTACATTGCACTTCATCTTATCCAGTACCATTTGATGAAATAAATTTAAATGTT
Bombyx_mori|1093                   TGTTTGCTTCATTGCATATCGGCGTATCCGGTGCCATTTGAAGACTGCAATCTGACTGTT
Tribolium_castaneum|1099           GCGCTACTTCATTGCGTTTCTGCATATCCTACACCTCTCCAGGAGATAAATCTTAACGTT
Culex_quinquefasciatus|11186       GCCCTTCTTCACTGCATTTCAGCCTATCCGACGCCACCGGAGCAGTCCCTGCTGAACCTG
Daphnia_pulex|27157                TGCATACTACAGTGCACCTCTTCCTATCCCACTCCAGAGGACCAAGTTCACTTAAGAGTG
Branchiostoma_floridae|21332       GTCGTCATGCAGTGTACCAGCACATACCCCCTCCCTCCAGCCGACGTACATCTGAGGTGT
Branchiostoma_floridae|15501       GTCGTCATGCAGTGTACCAGCACATACCCCCTCCCTCCAGCCGACGTACATCTGAGGTGT
Danio_rerio|20197                  CACACAAGTTGGATATTAAATAATAATAATAATAATAATAATAATAATAATAATATAATA
Oryzias_latipes|24531              GCCATCCTTCAGTGTACCAGTGCGTACCCTTTGGAACCAGAAGATGTCAACCTGAGAGTG
Danio_rerio|2021                   TGCATCCTGCAGTGCACAAGTGCATATCCACTTGAACCTGAGGACGTTAACCTGCGGGTT
Gasterosteus_aculeatus|6537        ACCATCCTGCAGTGCACCAGCGCCTATCCTCTGGAAGCAGAAGATGTCAACCTCAGAGTG
Tetraodon_nigroviridis|8606        GCCATCCTGCAGTGCACCAGTGCCTATCCCCTGGAAGCTGAAGACGTCAACCTCCGAGTG
Fugu_rubripes|17860                GCCATACTGCAGTGCACCAGTGCCTATCCCCTAGAAGCTGAAGACGTCAACCTGAGAGTG
Xenopus_tropicalis|7302            TGCTTTCTGCAGTGCACCAGCACGTACCCACTCCTGCCAGAGGATGTCAACCTCCGTGTC
Dipodomys_ordii|12451              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Sorex_araneus|5310                 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Macropus_eugenii|3366              TGCATTCTGCAGTGCACCGGTGCC---CCACTGCTCCTTGAAGATATCAAC---------
Spermophilus_tridecemlineatus|6701 TTTTATAGAACGCACACCAGCGCCTACCCACTCCAGCCTGAGGACGCCAACCTGCGCGTC
Monodelphis_domestica|25546        TGCATTCTGCAGTGCACCAGTGCCTATCCTCTGCTCCCTGAAGATGTCAATCTTCGAGTG
Macropus_eugenii|4860              TGCATTCTGCAGTGCACCAGTGCCTACCCATTGTTCCCTGAAGATGTCAATCTCCGTGTA
Microcebus_murinus|13762           TGCTTCCTCCAGTGCACCAGCGCCTACCCGCTCCAGCCGGAGGACGTCAACCTGCGTGTC
Tupaia_belangeri|7743              TGCTTCCTGCAGTGCACCAGTGCCTACCCGCTCCTGCCCGAGGACGTCAACCTGCGCGTC
Anolis_carolinensis|12516          TGTTTCCTGCAATGTACAAGTGCTTACCCTCTTCATCCTGAAGACGTCAACCTTCGTATC
Ochotona_princeps|9469             TGCTTCCTGCAGTGCACCAGCGCGTACCCGCTCCAGCCGGAAGACACCAACCTGCGCGTC
Echinops_telfairi|11114            TGCTTCCTCCAGTGCACCAGTGCATACCCGCTTGAGGCCCAGGACGTCAACCTGCGGGTC
Mus_musculus|28747                 TGCTTCCTCCAATGCACCAGCGCGTACCCACTACAGCCCGAGGATGCCAACCTGCGCGTC
Rattus_norvegicus|27085            TGCTTCCTCCAGTGCACCAGTGCGTACCCACTACAGCCTGAGGATGCCAACCTGCGCGTC
Cavia_porcellus|11788              TGTTTCCTACAGTGCACCAGCGCGTACCCGCTCCAGCCTGAGGACGTCAACCTGCGAGTC
Procavia_capensis|13404            TGCTTCCTCCAGTGCACCAGTGCGTACCCGCTGGAGGCCGAGGACGTCAATCTGCGCGTC
Loxodonta_africana|23090           TGCTTCCTCCAGTGCACCAGCGCGTACCCACTCGAGCCTGAGGATGTCAATCTGCGGGTC
Canis_familiaris|3275              TGCTTCCTCCAGTGCACCAGTGCATACCCGCTCCTCCCTGAGGACGTCAACCTGCGCGTC
Erinaceus_europaeus|11688          TGCTTCCTCCAGTGTACCAGCGCCTACCCGCTGCTGCCCGAGGACGTCAACCTGCGTGTC
Bos_taurus|25318                   TGCTTCCTCCAGTGCACCAGTGCCTACCCGCTCCAGCCTGAGGATGTCAACCTGCGTGTC
Tursiops_truncatus|13214           TGCTTCCTCCAGTGCACCAGTGCGTACCCGCTCCAGCCCGAGGACGTCAACCTGTGTGTC
Felis_catus|37221                  TGCTTCCTCCAGTGTACCAGTGCGTACCCGCTCTCCCCCGAGGACGTCAACCTACGCATC
Vicugna_pacos|359                  TGCTTCCTCCAGTGCACCAGTGCATACCCACTCCAGCCTGAGGACGTCAACCTGCGCGTC
Sus_scrofa|1708                    TGCTTCCTCCAGTGCACCAGCGCGTACCCACTCCAACCTGAGGACGTCAACCTGCGTGTC
Pteropus_vampyrus|3614             TGCTTTCTCCAGTGCACCAGTGCATACCCACTCCTGCCTGAGGATGTCAACCTGCGCATC
Myotis_lucifugus|4915              TGCTTCCTGCAGTGCACCAGTGCATACCCGCTCCTCCCTGAGGATGTCAACTTGCGCATC
Equus_caballus|16216               TGCTTCCTACAGTGCACCAGCGCATACCCCCTCCAGCCGGAGGACGTCAACCTGCGTGTC
Otolemur_garnettii|6328            TGCTTCCTCCAGTGCACCAGCGCCTACCCGCTGCAGCCCGAGGACGTCAACCTGCGGGTC
Callithrix_jacchus|47342           TGCTTCTTGCAGTGTACCAGCGCGTACCCACTCCAGCCTGAGGATGTCAACCTGCGGGTC
Gorilla_gorilla|9156               TGCTTCTTGCAGTGTACCAGCGCATACCCGCTCCAGCCTGAGGACGTCAACCTGCGGGTC
Homo_sapiens|94304                 TGCTTCTTGCAGTGTACCAGCGCATACCCGCTCCAGCCTGAGGACGTCAACCTGCGGGTC
Pan_troglodytes|37248              TGCTTCTTGCAGTGTACCAGCGCATACCCGCTCCAGCCTGAGGACGTCAACCTGCGGGTC
Pongo_abelii|27904                 TGCTTCTTGCAGTGTACCAGCGCGTACCCGCTCCAGCCTGAGGACGTCAACTTGCGGGTC
Ornithorhynchus_anatinus|19300     TGCATTCTCCAGTGCACCAGTGCATACCCACTTCCGCCCGAGGATGTCAATCTTCGAATT
Gallus_gallus|23025                TGCTTCCTGCAATGCACCAGTGCCTACCCGCTGCAGCCCGAGGACGTCAATCTCCGTGTT
Taeniopygia_guttata|18370          TGCTTCCTGCAGTGCACCAGCGCGTACCCGCTTCAGCCAGAGGACGTCAATCTCCGTGTC
Choloepus_hoffmanni|8125           TGCTTCCTCCAGTGCACCAGCGCGTACCCGCTCCAGCCCGAGGACGTCAACCTGCGGGTC
Dasypus_novemcinctus|11596         TGCTTCCTGCAGTGCACCAGTGCCTACCCACTCCCACCTGAGGACGTCAACTTGCGGGTC
Tarsius_syrichta|13515             TGCTTCCTACAGTGCACCAGTGCATACCCACTCCAGCCTGAGGACGTCAACCTGCGGGTG
                                                                                               

Nematostella_vectensis|5682        GTAAAGGATTTAGCAGAAAGATTT---AACGTTATTTCTGGACTGTCTGATCACACTATG
Drosophila_grimshawi|11395         ATATCAGTGCTTATGCGACGATTTCCTAATGTGACCATTGGGTACTCTGGCCATGAACTG
Drosophila_melanogaster|15129      ATATCCGTCTTAAGGACACGCTTTCCCAATGTGGCAATTGGGTACTCGGGTCATGAGCTG
Drosophila_sechellia|3500          ATATCCGTCTTAAGGAGGCGCTTTCCCAACGTGGCGATTGGGTACTCGGGTCATGAGCTG
Drosophila_simulans|14756          ATATCCGTCTTAAGGAGGCGCTTTCCCAATGTGGCAATTGGGTACTCGGGTCATGAGCTG
Pediculus_humanus|293              ATAAAAAGTTATAAGAAATTATTTCCTGATATTAATATTGGTTATTCAGGACATGAATTA
Bombyx_mori|1093                   TTACAAGACTATAAGAATACTTTT---GACGTTCCCGTTGGATACTCCGGTCAAGAGCTC
Tribolium_castaneum|1099           ATTAAATTGTACGAGACGGAATTTCCTGATGTTGTGATCGGTTATTCGGGACATGAGCTG
Culex_quinquefasciatus|11186       GTTCCCCTGTACAAGGATCACTTCCCCGAGTTGGTCATCGGATACTCCGGCCACGAATTG
Daphnia_pulex|27157                ATGCAATCCTATAGGGACCACTTTCCAGGATCTCCAGTCGGATATTCCGGTCACGAATTA
Branchiostoma_floridae|21332       ATTAATCTTTTCAAGGAGAAGTTTCCCCACGCCATCATTGGTTACTCTGGGCACGAGTCA
Branchiostoma_floridae|15501       ATTAATCTTTTCAAGGAGAAGTTTCCCCACGCCATCATTGGTTACTCTGGGCACGAGTCA
Danio_rerio|20197                  TTATTAGAGTTCCAGAAGGAGTTTCCGGACATTCCCATCGGATACTCCGGACATGAGACA
Oryzias_latipes|24531              ATCACTGAATACCAGAAGGAGTTTCCTGATATCCCCATTGGCTACTCTGGCCATGAGTCT
Danio_rerio|2021                   ATCACGGAATATCAGAAAGAATTCCCAGACATTCCCATCGGTTACTCGGGTCATGAAAGT
Gasterosteus_aculeatus|6537        CTAACGGAGTACCAGAAGGAATTTCCCGATATTCCCATTGGGTATTCCGGCCATGAGTCT
Tetraodon_nigroviridis|8606        ATAACGGAATACCAGAAGGAGTTTCCTGATATCCCCATCGGGTATTCAGGCCACGAGTCA
Fugu_rubripes|17860                ATAACGGAATACCAGAAGGAGTTTCCCGATATCCCTATTGGGTATTCGGGCCATGAGTCA
Xenopus_tropicalis|7302            ATAAAGGAGTTTCAGTCTACTTTTCCAGATATCCCAATTGGGTACTCTGGTCATGAAACT
Dipodomys_ordii|12451              NNNNNNGAGTATCAGAAGCTTTTCCCTGATATCCCCATAGGGTATTCTGGGCACGAGACG
Sorex_araneus|5310                 NNNNNNGAGTATCAGAAGCTCTTCCCTGACATCCCCATTGGGTACTCCGGGCACGAGACG
Macropus_eugenii|3366              ------GAATATCAGAAAATT---CCTGACATACCCATAGAATATTCTGGGCTTGAAATG
Spermophilus_tridecemlineatus|6701 ATCACGGAATATCAGAAGCTCTTTCCTGATATCCCCATCGGATATTCTGGACATGAGACA
Monodelphis_domestica|25546        ATTACAGAATATCAGAAAGAATTCCCAGACGTCCCTATAGGATATTCTGGGCATGAAACG
Macropus_eugenii|4860              ATTACGGAATATCAGAAAGCATTCCCTGACATCCCCATAGGATATTCTGGGCATGAAACA
Microcebus_murinus|13762           ATCTCGGAATATCAGAAGGTCTTTCCTGACATTCCTATAGGGTATTCTGGACACGAAACA
Tupaia_belangeri|7743              ATCTCTGAATATCAGAAGATCTTCCCTGACATTCCCATAGGGTACTCTGGCCATGAGACA
Anolis_carolinensis|12516          ATAACGAAATATCAGTCAGTCTTCCCAGATATTCCTATTGGCTATTCCGGCCATGAGACA
Ochotona_princeps|9469             ATCTCGGAATATCAGAAGCTCTTTCCTGACATTCCCATAGGGTACTCTGGGCATGAAACG
Echinops_telfairi|11114            ATCTCGGAATATCAGAAGCTCTTTCCGGACATTCCCATAGGCTATTCTGGACATGAGACG
Mus_musculus|28747                 ATCTCGGAATACCAGAAGCTCTTTCCCGACATTCCCATCGGGTATTCCGGGCACGAGACG
Rattus_norvegicus|27085            ATCTCGGAATACCAGAAGCTCTTTCCTGACATTCCCATAGGGTATTCTGGGCACGAGACA
Cavia_porcellus|11788              ATCGCGGAATACCAGAAGCTCTTTCCTGACATTCCCATAGGGTACTCGGGGCACGAAACA
Procavia_capensis|13404            ATCTCGGAGTATCAGAAGCTCTTTCCTGACATTCCCATAGGGTATTCTGGGCATGAAACA
Loxodonta_africana|23090           ATCTCGGAATATCAGAAGCTCTTTCCTGACATTCCCATAGGGTATTCAGGGCATGAAACA
Canis_familiaris|3275              ATCACGGAATATCAGAAGCTCTTTCCTGACATTCCCATAGGGTATTCTGGGCATGAAACA
Erinaceus_europaeus|11688          ATCTCGGAATATCAGAAGCTCTTTCCTGACATCCCTATAGGGTATTCTGGGCACGAGACA
Bos_taurus|25318                   ATCTCGGAATACCAGAAGCTCTTTCCTGACATCCCCATAGGGTATTCTGGGCATGAAACT
Tursiops_truncatus|13214           ATCTCGGAATATCAGAAGCTCTTTCCTGACATTCCCATCGGGTATTCTGGGCATGAAACG
Felis_catus|37221                  ATCACGGAGTATCAGAAGCTCTTTCCTGACATTCCCATAGGGTATTCTGGCCACGAAACA
Vicugna_pacos|359                  ATCTCGGAATATCAGAAGCTCTTTCCTGACATTCCCATAGGGTATTCTGGGCATGAAACA
Sus_scrofa|1708                    ATCTCGGAATATCAGAAGCTCTTTCCTGACATTCCCATAGGGTATTCTGGGCATGAAACA
Pteropus_vampyrus|3614             ATCTCGGAGTATCAGAAGGTCTTTCCTGACATTCCCATAGGGTATTCTGGGCATGAAACA
Myotis_lucifugus|4915              ATCTCGGAATATCAGAAGCTCTTCCCTGACATTCCCATAGGGTATTCTGGGCATGAAACA
Equus_caballus|16216               ATCTCGGAATATCAGAAGCTCTTTCCTGACATTCCCATAGGGTATTCTGGGCATGAAACA
Otolemur_garnettii|6328            ATCTCGGAGTATCAGAAGGTCTTTCCTGACATTCCTATAGGGTACTCTGGACATGAAACA
Callithrix_jacchus|47342           ATCCCGGAATATCAGAAGCTCTTTCCTGACATTCCCATAGGGTATTCTGGGCATGAAACA
Gorilla_gorilla|9156               ATCTCGGAATATCAGAAGCTCTTTCCTGACATTCCCATAGGGTATTCTGGGCATGAAACA
Homo_sapiens|94304                 ATCTCGGAATATCAGAAGCTCTTTCCTGACATTCCCATAGGGTATTCTGGGCATGAAACA
Pan_troglodytes|37248              ATCTCGGAATATCAGAAGCTCTTTCCTGACATTCCCATAGGGTATTCTGGGCATGAAACA
Pongo_abelii|27904                 ATCTCGGAATATCAGAAGCTCTTTCCTGACATTCCCATAGGGTATTCTGGGCATGAAACA
Ornithorhynchus_anatinus|19300     ATCACGGAATATCAGAAAGCATTTCCTGACATTCCCATTGGATATTCTGGACATGAAACG
Gallus_gallus|23025                ATACCGGCGTATCAGTCAGCCTTTCCCGACATCCCCATTGGCTATTCGGGGCATGAAACC
Taeniopygia_guttata|18370          ATATCGGCATATCAGTCAGCTTTTCCTGATATCCCCATTGGCTACTCGGGGCATGAAACT
Choloepus_hoffmanni|8125           ATCTCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dasypus_novemcinctus|11596         ATCACGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|13515             ATCTCGGAATATCAAAAGCTATTTCCTGACATCCCCATTGGGTACTCTGGGCACGAAACA
                                                                          .     .  .           

Nematostella_vectensis|5682        GGAGCAACTGTTCCAATTGTGGCAACTGCATTAGGTGCCAAAATTATTGAAAAACATTTT
Drosophila_grimshawi|11395         GGTGTGTCCATTACAAAGGCAGCAGTTTTGATGGGCGCCCGGATCGTTGAGCGACATTTT
Drosophila_melanogaster|15129      GGAGTGATCATTAGCCAGGCCGCCGTCTTGCTGGGAGCACGCATAGTGGAGCGCCACTTT
Drosophila_sechellia|3500          GGAGTGGTCATTAGTCAGGCCGCCGTTTTGCTGGGGGCACGCATAGTGGAGCGCCACTTC
Drosophila_simulans|14756          GGAGTGGTCATTATCCAGGCAGCCGTTTTGCTGGGAGCACCCATAGTGGAGCGCCACTTT
Pediculus_humanus|293              GGAATAGATGTTCCATTAGGAGCCGTTGCTTTAGGTGCCAAAATAATAGAAAAACATTTT
Bombyx_mori|1093                   GGCACCGCAGTCGCACTGGGTGCGGTTGCTTTAGGCGCAAAGGTGCTAGAAAAACATATA
Tribolium_castaneum|1099           GGGATTGAGGCCAGTGTGGCTGCTGTGGCAGTGGGGGCTAAAATTATTGAGCGTCATGTA
Culex_quinquefasciatus|11186       GGACTACAGCTAAGCGTTGCGAGCGTGCTGGCGGGAGCAAGAATTGTGGAACGACACTTT
Daphnia_pulex|27157                GGACTTTCTATAACTTTAGCCGCTGCAGCTCTGGGAGCTCACGTCATTGAGCGACACGTA
Branchiostoma_floridae|21332       GGTATTGCCATCTCCCTGGCAGCTGTCAGTCTGGGTGCCAAGGTCGTGGAGCGTCACGTG
Branchiostoma_floridae|15501       GGTATTGCCATCTCCCTGGCAGCTGTCAGTCTGGGTGCCAAGGTCGTGGAGCGTCACGTG
Danio_rerio|20197                  GGCATCCATGTGTCTGTAGCTGCTGTGGCTCTCGGAGCAAAAGTCCTGGAGCGTCATGTG
Oryzias_latipes|24531              GGAATCAGCATTTCGGTGGCGGCTGTAGCTCTTGGAGCTAAGGTCCTTGAGCGTCACATA
Danio_rerio|2021                   GGGATCAACATCACAGTCGGGGCAGTTGCTCTGGGAGCCAAAGTTGTGGAGCGGCACGTG
Gasterosteus_aculeatus|6537        GGGATCGTTATTTCTGTTGCGGCCGTAGCAATGGGTGCAAAGGTCGTCGAGCGCCACGTG
Tetraodon_nigroviridis|8606        GGAGTCAGCATTACCGTTGCGGCCGTGGCTCTGGGAGCAAAAATCATCGAGCGCCACGTC
Fugu_rubripes|17860                GGCGTAAGTATTACAGTAGCAGCTGTGGCTCTTGGAGCAAAGATCGTCGAGCGTCATGTG
Xenopus_tropicalis|7302            GGCATTGCTATCACACTGGCTGCTGTTGCCATGGGAGCCAAAGTGGTGGAGCGCCATGTA
Dipodomys_ordii|12451              GGCATAGCAATATCTGTGGCTGCTGTGGCTCTGGGAGCCAAGGTGCTGGAACGTCACATA
Sorex_araneus|5310                 GGCATCGCCATCTCGGTGGCCGCCGTGGCGCTGGGAGCCAAGGTGTTAGAGCGCCACGTG
Macropus_eugenii|3366              GGTATTATGATTTCAGTGGATGCAGTTGCTCTGGGGGCTAAGATACTCAAATGTCATGTG
Spermophilus_tridecemlineatus|6701 ---ATAGCAATATCTGTGGCCGCAGTGGCTCTGGGGGCCAAGGTGTTTGGACGCCAT---
Monodelphis_domestica|25546        GGCATCTCCATCTCAGTGGCTGCAGTTGCTCTAGGGGCCAAGGTATTAGAACGTCACGTG
Macropus_eugenii|4860              GGTATTATGGTTTCAGTGGCTGCAGTTGCTCTGGGGGCTAAGGTACTCGAACGTCACGTG
Microcebus_murinus|13762           GGCATAGCAATATCTGTGGCTGCAGTGGCTCTGGGGGCCAAGGTGGTGGAACGTCACATA
Tupaia_belangeri|7743              GGCATAGCGATATCTGTGGCCGCAGTGGCTTTGGGGGCCAAGGTGCTGGAGCGGCACATA
Anolis_carolinensis|12516          GGCATAGCCATTTCTGTTGCAGCTGTTGCAATGGGAGCTAAAGTGCTGGAGCGCCATATT
Ochotona_princeps|9469             GGCATCGCAATATCTGTGGCTGCCGTGGGCCTGGGGGCCAAGGTGTTGGAGCGTCACATC
Echinops_telfairi|11114            GGCATAGCCATATCCGTGGCCGCCGTGGCACTCGGGGCCAAGGTGTTAGAACGTCACATA
Mus_musculus|28747                 GGCATCGCCATATCTGTGGCCGCCGTGGCTCTGGGGGCCAAGGTGTTGGAACGTCACATA
Rattus_norvegicus|27085            GGCATCGCCATATCTGTAGCTGCAGTGGCCCTGGGGGCCAAGGTGTTGGAACGTCATATA
Cavia_porcellus|11788              GGCATAGCGATATCTGTGGCTGCAGTGGCTTTGGGGGCCAAGGTGTTGGAACGTCACATA
Procavia_capensis|13404            GGCATAGCAATATCTGTGGCTGCAGTTGCTCTGGGGGCCAAGGTGTTAGAACGTCACATA
Loxodonta_africana|23090           GGCATAGCGATATCTGTGGCTGCGGTGGCTCTGGGGGCCAAGGTGTTAGAACGTCACATA
Canis_familiaris|3275              GGCATAGCGATATCTGTGGCCGCAGTGGCTCTGGGTGCCAAGGTGCTGGAGCGTCACATA
Erinaceus_europaeus|11688          GGCATAGCAATATCTGTGGCCGCAGTGGCTCTGGGGGCCAAGGTGCTGGAGCGCCATATA
Bos_taurus|25318                   GGCATAGCAATATCTGTGGCTGCAGTGGCTCTGGGGGCCAAGGTCTTGGAGCGTCACATA
Tursiops_truncatus|13214           GGCATAGTGATATCTGAGGCTTCAGTGGCTCTGGGGGCCAAGGTCTTGGAGCGTCACATA
Felis_catus|37221                  GGCATAGCGATATCTGTGGCCGCAGTGGCTCTGGGCGCCAAGGTTTTGGAGCGCCACATA
Vicugna_pacos|359                  GGCATAGCAATATCTGTGGCCGCGGTGGCTCTGGGGGCCAAAGTCTTGGAGCGTCACATA
Sus_scrofa|1708                    GGCATAGCAATATCTGTGGCTGCCGTGGCTCTGGGAGCCAAGGTCTTGGAGCGTCACATA
Pteropus_vampyrus|3614             GGCATAGCCATATCTGTGGCCGCGGTGGCTTTGGGGGCCAAGGTTTTGGAGCGTCATATA
Myotis_lucifugus|4915              GGAATAGCAATCTCTGTGGCCGCTGTGGCTCTGGGGGCCAAGGTTTTGGAGCGTCATATA
Equus_caballus|16216               GGCATAGCGATCTCTGTGGCCGCGGTGGCTCTGGGCGCCAAGGTGTTGGAGCGTCACATA
Otolemur_garnettii|6328            GGCATAGCCATATCTGTGGCTGCAGTAGCTTTGGGGGCCAAGGTGCTAGAACGTCACATC
Callithrix_jacchus|47342           GGCATAGCGATATCTGTGGCCGCAGTGGCTTTGGGGGCCAAGGTGTTAGAGCGTCACATA
Gorilla_gorilla|9156               GGCATAGCGATATCTGTGGCCGCAGTGGCTCTGGGGGCCAAGGTGTTGGAACGTCACATA
Homo_sapiens|94304                 GGCATAGCGATATCTGTGGCCGCAGTGGCTCTGGGGGCCAAGGTGTTGGAACGTCACATA
Pan_troglodytes|37248              GGCATAGCGATATCTGTGGCCGCAGTGGCTCTGGGGGCCAAGGTGTTGGAACGTCACATA
Pongo_abelii|27904                 GGCATAGCGATATCTGTGGCCGCAGTGGCTCTGGGGGCCAAGGTGTTGGAACGTCACATA
Ornithorhynchus_anatinus|19300     GGCATAGCAATTTCAGTGGCAGCAGTTGCCCTGGGGGCTAAAGTTTTGGAACGTCACGTG
Gallus_gallus|23025                GGCATTGCCATTTCGGTGGCAGCTGTTGCTCTGGGTGCGAAAGTCGTGGAGCGGCATGTG
Taeniopygia_guttata|18370          GGCATAGCCATTTCAGTGGCAGCTGTTGCTATGGGTGCTAAAGTGCTGGAACGCCACGTG
Choloepus_hoffmanni|8125           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dasypus_novemcinctus|11596         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|13515             GGCATAGCGATATCTGTGGCTGCAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                                     .              .. .      .  .             

Nematostella_vectensis|5682        ATTCTGGATAGAAGTATTGGTGGACCAGATGCTTCTTTTTCAATGAATGAAGAAGAATTT
Drosophila_grimshawi|11395         ACCTTGGATAAGAACCAGAAGGGATCAGATCATCGCTGCTCTCTTGAGCCAGCCGAAATG
Drosophila_melanogaster|15129      ACGCTGGACAAGAGTCAGAAGGGCTCCGATCATCGCTGCTCCCTAGAGCCGCAAGAATTA
Drosophila_sechellia|3500          ACGCTGGACAAGAATCAGAAGGGCTCCGATCATCGCTGCTCCCTGGAGCCGCAAGAACTA
Drosophila_simulans|14756          ACGCCGGACAAGATTCAGAAGGGCTCCGATCATCGCTGCTCCCTGGAGCCGCAAGAACTA
Pediculus_humanus|293              ACATTAGATAAATCATTAAAAGGCACTGATCACAAATGTTCTTTGACTCCATTAGAATTT
Bombyx_mori|1093                   ACTCTGGATAAAAGCATGAAGGGAACTGACCACGTTTGTTCATTAACTCCGTCCGAGTTT
Tribolium_castaneum|1099           ACACTTGATAAAACCCAGAAAGGGTCAGACCATCAATGTTCATTAGAACCACAGGAACTT
Culex_quinquefasciatus|11186       ACCCTGGACAAGAGTTGGAAGGGCACCGATCATCGTGCCTCGCTGGATCCGGAGGAGTTT
Daphnia_pulex|27157                ACTTTGGACAAGTCGTGGAAAGGCAACGACCACGCCTGCTCACTTGATCCTTTAGAATTG
Branchiostoma_floridae|21332       ACTCTGGACAAGTCCTGGAAGGGCTCTGACCATGCGGCGTCCCTGACGTTTGATGAGCTG
Branchiostoma_floridae|15501       ACTCTGGACAAGTCCTGGAAGGGCTCTGACCATGCGGCGTCCCTGACGTTTGATGAGCTG
Danio_rerio|20197                  ACTCTGGATAAAAGCTGGAAAGGCAGTGACCATGCGGCCTCGCTGGAGCCTGATGAACTT
Oryzias_latipes|24531              ACCTTGGACAAAACCTGGAAAGGAAGTGACCACGAGGCCTCGTTGGAGCCCTCTGAACTA
Danio_rerio|2021                   ACCCTGGATAAGAGCTGGAAAGGCAGTGATCATGCAGCGTCTCTGGAACCAGAAGAGCTG
Gasterosteus_aculeatus|6537        ACCTTGGACAAGACCTGGAAAGGAAATGACCACGAAGCCTCTCTGGTGCCCAGTGAGCTG
Tetraodon_nigroviridis|8606        ACCCTGGACAAGACTTGGAAAGGAAGCGACCACGCAGCCTCGCTGGAGCCCTCTGAACTG
Fugu_rubripes|17860                ACCCTGGACAAGACATGGAAAGGAAGTGACCATGCAGCCTCCCTGGAGCCACCTGAGCTA
Xenopus_tropicalis|7302            ACACTGGACAAAACTTGGAAAGGCAATGATCACCAAGCATCACTGGAGCCAAACGAACTG
Dipodomys_ordii|12451              ACTCTGGATAAGACCTGGAAGGGAAGTGACCATTCAGCCTCACTGGAGCCTGGAGAGCTG
Sorex_araneus|5310                 ACTCTGGACAAGACCTGGAAGGGCAGTGACCACTCGGCCTCCCTGGAGCCCGGGGAGCTG
Macropus_eugenii|3366              ACTCTGGATAAAACTTGGAAAAGGAGTGACCATCAGGCATCTCTGGAGTTAAATGAATTA
Spermophilus_tridecemlineatus|6701 ACTCTTGACAAGACCTGG---GGGAGTGAACACTCAGCCTCGCTGGAGCCT---GAACTG
Monodelphis_domestica|25546        ACTCTGGATAAAACTTGGAAAGGGAGTGACCATCAGGCATCTCTGGAGCCGAATGAATTA
Macropus_eugenii|4860              ACTCTGGATAAAACTTGGAAAGGGAGTGACCATCAGGCATCTCTGGAGCCAAATGAATTA
Microcebus_murinus|13762           ACTTTGGACAAGACCTGGAAGGGGAGTGACCACTCAGCCTCACTGGAGCCTGGAGAACTG
Tupaia_belangeri|7743              ACCTTGGACAAGACCTGGAAGGGGAGTGACCACTCAGCCTCCCTGGAGCCTGGAGAGCTG
Anolis_carolinensis|12516          ACACTGGACAAGACCTGGAAAGGAAGCGATCATCAGGCCTCCTTGGAGCCCAGTGAATTG
Ochotona_princeps|9469             ACCTTGGATAAGACCTGGAAGGGGAGTGTCCACGCAGCCTCCCTGGAGCCCAGTGAGCTG
Echinops_telfairi|11114            ACTTTGGACAAGACCTGGAAGGGGAGCGACCACTCGGCCTCGTTGGACGCCAGTGAACTG
Mus_musculus|28747                 ACGTTGGACAAGACCTGGAAGGGGAGTGACCACTCAGCCTCGCTGGAGCCTGGGGAGCTG
Rattus_norvegicus|27085            ACTTTGGACAAGACCTGGAAGGGGAGTGACCACTTAGCCTCACTGGAGCCTGGAGAACTG
Cavia_porcellus|11788              ACTTTGGACAAGACCTGGAAGGGGAGTGACCACTCGGCCTCACTGGAACCTGGAGAACTG
Procavia_capensis|13404            ACTTTGGACAAGACCTGGAAGGGGAGTGACCATTCTGCCTCGCTGGATCCTGGGGAGCTG
Loxodonta_africana|23090           ACTTTGGACAAGACTTGGAAGGGGAGTGATCACTCGGCCTCACTGGAGCCTGGAGAGCTG
Canis_familiaris|3275              ACTTTGGACAAGACGTGGAAGGGGAGTGATCACTCAGCCTCGCTGGAGCCCGGAGAGCTG
Erinaceus_europaeus|11688          ACTCTGGACAAAACCTGGAAGGGAAGTGACCACTCAGCCTCGCTGGAGCCCGGAGAGCTG
Bos_taurus|25318                   ACTTTGGACAAGACCTGGAAAGGGAGTGACCACTCGGCCTCTCTGGAACCTGGAGAGCTG
Tursiops_truncatus|13214           ACTTTGGACAAGACCTGGAAGGGGAGTGACCACTCGGCCTCGCTGGAGCCTGTGGAGCTG
Felis_catus|37221                  ACTTTGGACAAGACCTGGAAGGGGAGTGACCACTCTGCCTCGCTGGAGCCTGGAGAGCTG
Vicugna_pacos|359                  ACTTTGGACAAAACCTGGAAAGGGAGTGACCACTCGGCCTCGCTGGAGCCTGGAGAGCTG
Sus_scrofa|1708                    ACTTTGGACAAGACTTGGAAGGGGAGTGACCACTCGGCCTCGCTGGAGCCTGGAGAGCTG
Pteropus_vampyrus|3614             ACTTTGGACAAGACCTGGAAGGGTAGTGACCACTCGGCCTCACTGGAGCCTGGAGAGCTG
Myotis_lucifugus|4915              ACTTTGGACAAGACCTGGAAGGGCAGTGACCACTCGGCCTCGCTGGAGCCTGGAGAGCTG
Equus_caballus|16216               ACTTTGGACAAGACCTGGAAGGGGAGCGACCACTCGGCCTCGCTGGAGCCTGGAGAGCTG
Otolemur_garnettii|6328            ACGTTGGACAAGACCTGGAAGGGGAGTGACCACTCCGCCTCACTGGAGCCTGGAGAACTG
Callithrix_jacchus|47342           ACTTTGGACAAGACTTGGAAGGGGAGTGACCATTCAGCCTCGCTGGAGCCTGGAGAACTG
Gorilla_gorilla|9156               ACTTTGGACAAGACCTGGAAGGGGAGTGACCACTCGGCCTCGCTGGAGCCTGGAGAACTG
Homo_sapiens|94304                 ACTTTGGACAAGACCTGGAAGGGGAGTGACCACTCGGCCTCGCTGGAGCCTGGAGAACTG
Pan_troglodytes|37248              ACTTTGGACAAGACCTGGAAGGGGAGTGACCACTCGGCCTCGCTGGAGCCTGGAGAACTG
Pongo_abelii|27904                 ACTTTGGACAAGACCTGGAAGGGGAGTGACCACTCGGCCTCGCTGGAGCCTGGAGAACTG
Ornithorhynchus_anatinus|19300     ACCTTGGATAAAACCTGGAAAGGGAGCGATCATCAGGCTTCATTGGAGCCGAGCGAGCTA
Gallus_gallus|23025                ACTCTGGACAAAACATGGAAAGGAAGTGACCACCAGGCATCCCTGGAGCCAAAGGAACTG
Taeniopygia_guttata|18370          ACTCTCGACAAAACGTGGAAAGGAAGCGACCACCAAGCATCTCTGGAGCCAAATGAACTG
Choloepus_hoffmanni|8125           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dasypus_novemcinctus|11596         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|13515             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                         .               .    .           .   .          .   . 

Nematostella_vectensis|5682        ACTGCAATGGTTAAAGCAGTTAGA------------------------------------
Drosophila_grimshawi|11395         TGTTCTCTTGTACGCGGTATAGATCAATTTAGGCATAACAAATATCTTCTCAACGCCAAT
Drosophila_melanogaster|15129      AAAGCTCTGACTACAGCCATCACCAACTTCAAA------------CTCTCTTCAGTTCCC
Drosophila_sechellia|3500          AAAGCTCTGACTACAGCCATTACCAACTTTAAA------------CTCTCTTCAGTTCCC
Drosophila_simulans|14756          AAAGCTCTGACTACAGCCATCACCAACTTTAAA------------CTCTCTTCAGTTCCC
Pediculus_humanus|293              AAACAAATGGTTTCCAATATAAGAGATTTTGAAAGAAATAAAATTCAATTAGAAACGATA
Bombyx_mori|1093                   CAGCAACTGGTTCGCGACGTGCGC------------------------------------
Tribolium_castaneum|1099           AAGCTTTTAATTGAAAAAATAAGA------------------------------------
Culex_quinquefasciatus|11186       GGTCGGTTGGTGCGGTACGTGAGA------------------------------------
Daphnia_pulex|27157                AAGTCTCTGGTCGAAGGTATACGT------------------------------------
Branchiostoma_floridae|21332       AAGGATCTTTGTGACAACATCCGG------------------------------------
Branchiostoma_floridae|15501       AAGGATCTTTGTGACAACATCCGG------------------------------------
Danio_rerio|20197                  GCAGAGCTGGTGAAAGCCATCCGG------------------------------------
Oryzias_latipes|24531              GCCGAGCTGGTTCGTTCGGTCCGG------------------------------------
Danio_rerio|2021                   GCTGAGCTGGTGAGGTCCATCCGC------------------------------------
Gasterosteus_aculeatus|6537        GCCGAGTTGGTTCGCTCCATCCGG------------------------------------
Tetraodon_nigroviridis|8606        GCTGAACTGGTTCGCTCCATCCGA------------------------------------
Fugu_rubripes|17860                GCCGAGCTGGTTCGCTCCATTCGA------------------------------------
Xenopus_tropicalis|7302            GCTGAATTGGTCAGCTCCATCCGG------------------------------------
Dipodomys_ordii|12451              GCCGAGCTAGTGCGGTCTGTGCGC------------------------------------
Sorex_araneus|5310                 GCGGAGCTGGTGCGGTCCGTGCGC------------------------------------
Macropus_eugenii|3366              GCAGAGTTGATGAAACCAGTCCGC------------------------------------
Spermophilus_tridecemlineatus|6701 GCTGAACTGGTGCNNNNNNNNNNN------------------------------------
Monodelphis_domestica|25546        GCACAGTTGGTGAAAGAAGTCCGC------------------------------------
Macropus_eugenii|4860              GCAGAGTTGGTGAAAGCAGTCCGC------------------------------------
Microcebus_murinus|13762           GCCGAGCTAGTGCGGTCAGTGCGC------------------------------------
Tupaia_belangeri|7743              GCTGAGCTGGTGCGGTCCGTGCGC------------------------------------
Anolis_carolinensis|12516          GCAGATCTGGTGAAAAGCATCCGC------------------------------------
Ochotona_princeps|9469             GCTGAGCTGGTGCGTTCCGTGCGC------------------------------------
Echinops_telfairi|11114            GCCGAGCTGGTGCGGTCTGTGCGC------------------------------------
Mus_musculus|28747                 GCAGAGCTGGTGCGGTCTGTGCGC------------------------------------
Rattus_norvegicus|27085            GCAGAGCTGGTGCGGTCTGTGCGT------------------------------------
Cavia_porcellus|11788              GCTGAGCTGGTGCGGTCTGTGCGG------------------------------------
Procavia_capensis|13404            GCCGAGCTGGTGCGGTCTGTGCGC------------------------------------
Loxodonta_africana|23090           GCTGAGCTGGTGCAGTCTGTGCGC------------------------------------
Canis_familiaris|3275              GCTGAGCTGGTGCGGTCCGTGCGC------------------------------------
Erinaceus_europaeus|11688          GCTGAGCTGGTGCGGTCCGTTCGC------------------------------------
Bos_taurus|25318                   GCCGAGCTGGTGCGGTCCGTGCGC------------------------------------
Tursiops_truncatus|13214           GCCGAGCTAGTGCGGTCCGTGCGC------------------------------------
Felis_catus|37221                  GCCGAGCTGGTGCGGTCCGTGCGC------------------------------------
Vicugna_pacos|359                  GCCGAGCTGGTGCGGTCCGTGCGC------------------------------------
Sus_scrofa|1708                    GCCGAGCTGGTGCGGTCTGTGCGC------------------------------------
Pteropus_vampyrus|3614             GCTGAGCTGGTGCAGTCCGTGCGC------------------------------------
Myotis_lucifugus|4915              GCCGAGCTGGTACGGTCTGTGCGC------------------------------------
Equus_caballus|16216               GCCGAGCTGGTGCGGTCCGTGCGC------------------------------------
Otolemur_garnettii|6328            GCCGAGCTGGTTCGGGCAGTGCGC------------------------------------
Callithrix_jacchus|47342           GCCGAGCTAGTACGGTCAGTGCGC------------------------------------
Gorilla_gorilla|9156               GCCGAGCTGGTGCGGTCAGTGCGT------------------------------------
Homo_sapiens|94304                 GCCGAGCTGGTGCGGTCAGTGCGT------------------------------------
Pan_troglodytes|37248              GCCGAGCTGGTGCGGTCAGTGCGT------------------------------------
Pongo_abelii|27904                 GCCGAGCTGGTGCGGTCAGTGCAT------------------------------------
Ornithorhynchus_anatinus|19300     GCAGAGCTGGTGAGAGCCATCCGC------------------------------------
Gallus_gallus|23025                GCCGAGTTGGTGAAAGCCATCCGT------------------------------------
Taeniopygia_guttata|18370          GCGGAGTTAGTGAAAGCCATCCGT------------------------------------
Choloepus_hoffmanni|8125           NNNNNNNNNNNNNNNNNNNNNNNN------------------------------------
Dasypus_novemcinctus|11596         NNNNNNNNNNNNNNNNNNNNNNNN------------------------------------
Tarsius_syrichta|13515             NNNNNNNNNNNNNNNNNNNNNNNN------------------------------------
                                          .           .                                        

Nematostella_vectensis|5682        ------------GAAGCAGAA---------------------------------------
Drosophila_grimshawi|11395         TATACTGTTGAGGAAATAATT---------------------------------------
Drosophila_melanogaster|15129      ATGCCTCCACAAGAAATAGTT---------------------------------------
Drosophila_sechellia|3500          ATGTATCCACAAGAAATAGTT---------------------------------------
Drosophila_simulans|14756          ATGTCTCCACAAGAAATAGTT---------------------------------------
Pediculus_humanus|293              TTTAGCAAAGATGAAGTTAAA---------------------------------------
Bombyx_mori|1093                   ------------GTCATCGAA---------------------------------------
Tribolium_castaneum|1099           ------------GAGTTGGAC---------------------------------------
Culex_quinquefasciatus|11186       ------------GCGGTTGAGGGGATGAACGTGGAAGGGGAGCGGATTGTGGAAGTGTTG
Daphnia_pulex|27157                ------------GCAATCGAG---------------------------------------
Branchiostoma_floridae|21332       ------------ATTGTGGAG---------------------------------------
Branchiostoma_floridae|15501       ------------ATTGTGGAG---------------------------------------
Danio_rerio|20197                  ------------GCGGTGGAG---------------------------------------
Oryzias_latipes|24531              ------------TTAGTGGAG---------------------------------------
Danio_rerio|2021                   ------------ATTGTGGAG---------------------------------------
Gasterosteus_aculeatus|6537        ------------CTGGTGGAA---------------------------------------
Tetraodon_nigroviridis|8606        ------------CTGGTGGAG---------------------------------------
Fugu_rubripes|17860                ------------CTGGTAGAG---------------------------------------
Xenopus_tropicalis|7302            ------------CTTATAGAG---------------------------------------
Dipodomys_ordii|12451              ------------CTTGTGGAG---------------------------------------
Sorex_araneus|5310                 ------------CTCGTGGAG---------------------------------------
Macropus_eugenii|3366              ------------CTGGTAGAA---------------------------------------
Spermophilus_tridecemlineatus|6701 ------------NNNNNNNNN---------------------------------------
Monodelphis_domestica|25546        ------------CTCATAGAA---------------------------------------
Macropus_eugenii|4860              ------------CTTGTAGAA---------------------------------------
Microcebus_murinus|13762           ------------CTCGTGGAA---------------------------------------
Tupaia_belangeri|7743              ------------CTCGTGGAG---------------------------------------
Anolis_carolinensis|12516          ------------ATGGTGGAG---------------------------------------
Ochotona_princeps|9469             ------------CTGGTGGAG---------------------------------------
Echinops_telfairi|11114            ------------CTTGTGGAA---------------------------------------
Mus_musculus|28747                 ------------CTGGTGGAG---------------------------------------
Rattus_norvegicus|27085            ------------CTGGTGGAG---------------------------------------
Cavia_porcellus|11788              ------------CTTGTGGAG---------------------------------------
Procavia_capensis|13404            ------------CTTGTGGAG---------------------------------------
Loxodonta_africana|23090           ------------CTTGTGGAA---------------------------------------
Canis_familiaris|3275              ------------CTCGTGGAA---------------------------------------
Erinaceus_europaeus|11688          ------------CTGGTGGAG---------------------------------------
Bos_taurus|25318                   ------------CTCGTGGAG---------------------------------------
Tursiops_truncatus|13214           ------------CTCGTGGAG---------------------------------------
Felis_catus|37221                  ------------CTTGTGGAA---------------------------------------
Vicugna_pacos|359                  ------------CTCGTGGAG---------------------------------------
Sus_scrofa|1708                    ------------CTCGTGGAG---------------------------------------
Pteropus_vampyrus|3614             ------------CTTGTGGAA---------------------------------------
Myotis_lucifugus|4915              ------------CTTGTGGAA---------------------------------------
Equus_caballus|16216               ------------CTAGTGGAA---------------------------------------
Otolemur_garnettii|6328            ------------CTGGTGGAG---------------------------------------
Callithrix_jacchus|47342           ------------CTTGTGGAG---------------------------------------
Gorilla_gorilla|9156               ------------CTTGTGGAG---------------------------------------
Homo_sapiens|94304                 ------------CTTGTGGAG---------------------------------------
Pan_troglodytes|37248              ------------CTTGTGGAG---------------------------------------
Pongo_abelii|27904                 ------------CTTGTGGAG---------------------------------------
Ornithorhynchus_anatinus|19300     ------------CTAGTGGAG---------------------------------------
Gallus_gallus|23025                ------------GCTGTGGAA---------------------------------------
Taeniopygia_guttata|18370          ------------ACTGTGGAA---------------------------------------
Choloepus_hoffmanni|8125           ------------NNNNNNNNN---------------------------------------
Dasypus_novemcinctus|11596         ------------NNNNNNNNN---------------------------------------
Tarsius_syrichta|13515             ------------NNNNNNNNN---------------------------------------
                                                                                               

Nematostella_vectensis|5682        ------------------------------------------------------AAAGCT
Drosophila_grimshawi|11395         ------------------------------------------------------AAGATG
Drosophila_melanogaster|15129      ------------------------------------------------------AAAAAG
Drosophila_sechellia|3500          ------------------------------------------------------CAAAAG
Drosophila_simulans|14756          ------------------------------------------------------CAAAAG
Pediculus_humanus|293              ------------------------------------------------------AAATCA
Bombyx_mori|1093                   ------------------------------------------------------GCCTCA
Tribolium_castaneum|1099           ------------------------------------------------------ATTACT
Culex_quinquefasciatus|11186       TCATCGGTGCTTGAAGCTCGGGACTTTAATGGGGAAGAATTGGCGCTAGCTTTGAGGTCG
Daphnia_pulex|27157                ------------------------------------------------------AAAGCT
Branchiostoma_floridae|21332       ------------------------------------------------------ACGGCT
Branchiostoma_floridae|15501       ------------------------------------------------------ACGGCT
Danio_rerio|20197                  ------------------------------------------------------ATGGCC
Oryzias_latipes|24531              ------------------------------------------------------AAGGCC
Danio_rerio|2021                   ------------------------------------------------------AGAGCT
Gasterosteus_aculeatus|6537        ------------------------------------------------------AGGGCG
Tetraodon_nigroviridis|8606        ------------------------------------------------------AGGGCG
Fugu_rubripes|17860                ------------------------------------------------------AGGGCA
Xenopus_tropicalis|7302            ------------------------------------------------------AAAGCG
Dipodomys_ordii|12451              ------------------------------------------------------AGGGCA
Sorex_araneus|5310                 ------------------------------------------------------AGGGCC
Macropus_eugenii|3366              ------------------------------------------------------AAAGCC
Spermophilus_tridecemlineatus|6701 ------------------------------------------------------NNNNNN
Monodelphis_domestica|25546        ------------------------------------------------------AAAGCC
Macropus_eugenii|4860              ------------------------------------------------------AAAGCC
Microcebus_murinus|13762           ------------------------------------------------------AGGGCC
Tupaia_belangeri|7743              ------------------------------------------------------AAAGCC
Anolis_carolinensis|12516          ------------------------------------------------------AAGGCT
Ochotona_princeps|9469             ------------------------------------------------------CTGGCC
Echinops_telfairi|11114            ------------------------------------------------------AAGGCC
Mus_musculus|28747                 ------------------------------------------------------CGGGCC
Rattus_norvegicus|27085            ------------------------------------------------------CGGGCA
Cavia_porcellus|11788              ------------------------------------------------------AGGGCC
Procavia_capensis|13404            ------------------------------------------------------CAGGCC
Loxodonta_africana|23090           ------------------------------------------------------AGGGCC
Canis_familiaris|3275              ------------------------------------------------------AGGGCC
Erinaceus_europaeus|11688          ------------------------------------------------------AAGGCC
Bos_taurus|25318                   ------------------------------------------------------AGGGCG
Tursiops_truncatus|13214           ------------------------------------------------------AGGGCC
Felis_catus|37221                  ------------------------------------------------------AGGGCC
Vicugna_pacos|359                  ------------------------------------------------------AGGGCC
Sus_scrofa|1708                    ------------------------------------------------------AGGGCC
Pteropus_vampyrus|3614             ------------------------------------------------------AGGGCC
Myotis_lucifugus|4915              ------------------------------------------------------AGGGCC
Equus_caballus|16216               ------------------------------------------------------AGAGCC
Otolemur_garnettii|6328            ------------------------------------------------------AGAGCC
Callithrix_jacchus|47342           ------------------------------------------------------CGTGCC
Gorilla_gorilla|9156               ------------------------------------------------------CGTGCC
Homo_sapiens|94304                 ------------------------------------------------------CGTGCC
Pan_troglodytes|37248              ------------------------------------------------------CGTGCC
Pongo_abelii|27904                 ------------------------------------------------------CGTGCC
Ornithorhynchus_anatinus|19300     ------------------------------------------------------AAGGCC
Gallus_gallus|23025                ------------------------------------------------------AAAGCA
Taeniopygia_guttata|18370          ------------------------------------------------------AAAGCA
Choloepus_hoffmanni|8125           ------------------------------------------------------NNNNNN
Dasypus_novemcinctus|11596         ------------------------------------------------------NNNNNN
Tarsius_syrichta|13515             ------------------------------------------------------NNNNNN
                                                                                               

Nematostella_vectensis|5682        ATAGGAAAT---------------------------------------------------
Drosophila_grimshawi|11395         CTGGGCGGCGGAGATGAGTTGAGAGCAGCGCTGAGCGAAGTTGAAAATAAGGATATTTTA
Drosophila_melanogaster|15129      TTAAATGGAGATGAGGAACTAGAGGCAGCTCTTCAGCACGTTGAGTCTAAAACCATTTTG
Drosophila_sechellia|3500          TTAAATGGAGGTGAGGAACTAGAGGCAGCTCTTCAGCACGTCGAGTCTAAAACCATTTTA
Drosophila_simulans|14756          TTAAATGGAGGTGAGGAACTAGAGGCAGCTCTTCAGCACGTTGAGTCTAAAACCATTTTA
Pediculus_humanus|293              CTTGGGGCTCAT---------------------------------GAAAAAAAATTTCAA
Bombyx_mori|1093                   CTTGGAACTCCC---------------------------------ATTAAAAAAGTAGTG
Tribolium_castaneum|1099           TTAGGTAAGCCT---------------------------------GTAAAGGCTTTTCAA
Culex_quinquefasciatus|11186       GTTACGGGCGAG---------------------------------GATAGAAAGTTGCTG
Daphnia_pulex|27157                CTGGGCTCTGCC---------------------------------GTCAAGTCAAAACAG
Branchiostoma_floridae|21332       CTGGGCAAACCT---------------------------------ATCAAGGAACCGCGC
Branchiostoma_floridae|15501       CTGGGCAAACCT---------------------------------ATCAAGGAACCGCGC
Danio_rerio|20197                  ATGGGGTCACCA---------------------------------GTCAAACAGATGCTG
Oryzias_latipes|24531              CTAGGAAGCGGC---------------------------------ATCAAGCAGATGCTG
Danio_rerio|2021                   TTGGGCACTGGA---------------------------------CTGAAACGCATGCTG
Gasterosteus_aculeatus|6537        CTGGGCAACGGC---------------------------------GTCAAGCAGATGCTT
Tetraodon_nigroviridis|8606        CTGGGGAACGGC---------------------------------GTCAAGAGGATGTTA
Fugu_rubripes|17860                CTGGGGAGTGGC---------------------------------GTCAAGAGGATGTTG
Xenopus_tropicalis|7302            ATGGGCTCCTCT---------------------------------GTCAAACGCCTGTTG
Dipodomys_ordii|12451              CTCGGCTCTCCA---------------------------------AGCAAGCAACTGCTG
Sorex_araneus|5310                 CTGGGCTCCCCG---------------------------------ACCAAGCAGCTGCTG
Macropus_eugenii|3366              TTAGGATCACCA---------------------------------GTTAAACAACTTTTG
Spermophilus_tridecemlineatus|6701 NNNNNNNNNNNN---------------------------------NNNNNNNNNNNNNNN
Monodelphis_domestica|25546        TTGGGATCGCCA---------------------------------GTGAAACGACTTTTG
Macropus_eugenii|4860              TTGGGATCACCA---------------------------------GTTAAACAGCTTTTG
Microcebus_murinus|13762           ATGGGCTCCCCG---------------------------------ACCAAGCAGCTGCTG
Tupaia_belangeri|7743              ATGGGCTCCCCC---------------------------------GCCAAGCAGCTGCTG
Anolis_carolinensis|12516          ATGGGGTCAACG---------------------------------GTCAAACAACTCTTG
Ochotona_princeps|9469             CTAGGCTCCCCA---------------------------------ACCAAGCAGCTGCTG
Echinops_telfairi|11114            CTGGGTTCCCCG---------------------------------ACTAAGCAGCTGCTG
Mus_musculus|28747                 CTGGGCTCCCCA---------------------------------ACCAAGCAGCTGCTG
Rattus_norvegicus|27085            CTGGGCTCCCCA---------------------------------GCCAAGCAGCTCCTG
Cavia_porcellus|11788              CTGGGCTCGCCG---------------------------------ACCAAGCAGATGCTG
Procavia_capensis|13404            CTGGGCTCCCCG---------------------------------GTCAAGCAGCTGCTA
Loxodonta_africana|23090           CTGGGCTCCCCG---------------------------------ACCAAGCAGCTGCTG
Canis_familiaris|3275              ATGGGCTCCCCG---------------------------------ACCAAGCAGTTGCTG
Erinaceus_europaeus|11688          ATGGGATCCCCC---------------------------------ATCAAGCAGCTGCTG
Bos_taurus|25318                   CTGGGCTCCCCG---------------------------------ACCAAGCAGCTGCTG
Tursiops_truncatus|13214           CTGGGCTCCCCG---------------------------------ACCAAGCAGCTGCTG
Felis_catus|37221                  ATGGGCTCCCCG---------------------------------ACCAAGCAGCTGCTG
Vicugna_pacos|359                  CTTGGCTCCCCG---------------------------------AACAAGCAGCTGCTG
Sus_scrofa|1708                    CTGGGCTCCCCA---------------------------------ACCAAGCAGCTGCTG
Pteropus_vampyrus|3614             ATGGGCTCCCCG---------------------------------ACCAAGCAGCTGCTG
Myotis_lucifugus|4915              ATGGGCTCCCCA---------------------------------ACCAAGCAGCTGCTA
Equus_caballus|16216               CTGGGCTCCCCG---------------------------------ACCAAGCAGCTGCTG
Otolemur_garnettii|6328            CTGGGCTCCCCA---------------------------------ACCAAGCAGCTGCTG
Callithrix_jacchus|47342           CTAGGCTCCCCA---------------------------------ACCAAGCAGCTGCTG
Gorilla_gorilla|9156               CTGGGCTCCCCA---------------------------------ACCAAGCAGCTGCTG
Homo_sapiens|94304                 CTGGGCTCCCCA---------------------------------ACCAAGCAGCTGCTG
Pan_troglodytes|37248              CTGGGCTCCCCA---------------------------------ACCAAGCAGCTGCTG
Pongo_abelii|27904                 CTGGGCTCCCCA---------------------------------ACCAAGCAGCTGCTG
Ornithorhynchus_anatinus|19300     ATGGGGTCCCCA---------------------------------ATCAAACAGCTTCTG
Gallus_gallus|23025                ATGGGCTCTCCA---------------------------------ATCAAACAGCTCTTG
Taeniopygia_guttata|18370          ATGGGTTCTCCA---------------------------------ATCAAGCAGCTCCTG
Choloepus_hoffmanni|8125           NNNNNNNNNNNN---------------------------------NNNNNNNNNNNNNNN
Dasypus_novemcinctus|11596         NNNNNNNNNNNN---------------------------------NNNNNNNNNNNNNNN
Tarsius_syrichta|13515             NNNNNNNNNNNN---------------------------------NNNNNNNNNNNNNNN
                                    .                                                          

Nematostella_vectensis|5682        ------------------------------------------------------------
Drosophila_grimshawi|11395         GAGTGTGAG------------------------CTGCCCTGTCGC---------------
Drosophila_melanogaster|15129      CCGTGCGAG------------------------CTGCCCTGCCGA---------------
Drosophila_sechellia|3500          CCCTGCGAG------------------------CTGCCCTGCCGA---------------
Drosophila_simulans|14756          CCCTGCGAG------------------------CTGCCCTGCCGA---------------
Pediculus_humanus|293              AAATCAGAA------------------------AAAACATGTTAT---------------
Bombyx_mori|1093                   ACATCAGAA------------------------ATACCATGCATA---------------
Tribolium_castaneum|1099           GCTTCCGAA------------------------CGTCCGTGTTAT---------------
Culex_quinquefasciatus|11186       GTTTCGGAA------------------------GTGGCCTGCCAT---------------
Daphnia_pulex|27157                CCATCTGAG------------------------GAGCCGTGCCAT---------------
Branchiostoma_floridae|21332       CCCAGTGAG------------------------CAGGGACTCTTT---------------
Branchiostoma_floridae|15501       CCCACAGACATCTTTACCGCAGACCTCACTGTGATAAAATGTTCAATGATCTTCACCAAT
Danio_rerio|20197                  CCCTGTGAG------------------------GCTTCATGCCAC---------------
Oryzias_latipes|24531              GCCTCTGAG------------------------AAGGCCTGCCAT---------------
Danio_rerio|2021                   CCATGTGAG------------------------GTGCCATGCCAT---------------
Gasterosteus_aculeatus|6537        CCTTGTGAG------------------------AAGCCGTGCCAT---------------
Tetraodon_nigroviridis|8606        CCTTGTGAG------------------------AAGCCGTGCCAC---------------
Fugu_rubripes|17860                CCTTGTGAG------------------------AAGCCATGCCAT---------------
Xenopus_tropicalis|7302            CCCTGTGAA------------------------TTGGATTGTCAC---------------
Dipodomys_ordii|12451              CCCTGTGAG------------------------ATGGCCTGCAAT---------------
Sorex_araneus|5310                 CCCTGCGAG------------------------ATGGCCTGCAAC---------------
Macropus_eugenii|3366              CCATGTGAG------------------------GTAGCCTGCAAT---------------
Spermophilus_tridecemlineatus|6701 NNNNNNNNN------------------------NNNNNNNNNNNN---------------
Monodelphis_domestica|25546        CCATGCGAG------------------------GTGCCCTGCAAC---------------
Macropus_eugenii|4860              CCATGTGAG------------------------GTAGCCTGCAAT---------------
Microcebus_murinus|13762           CCCTGCGAG------------------------ATGGCCTGCAAT---------------
Tupaia_belangeri|7743              CCCTGTGAG------------------------ATGGCCTGCAAC---------------
Anolis_carolinensis|12516          CCCTGTGAA------------------------GTTGCCTGCAAT---------------
Ochotona_princeps|9469             CCCTGTGAG------------------------ATGGCCTGCAAC---------------
Echinops_telfairi|11114            GCCTGTGAG------------------------ATGGCCTGCAAT---------------
Mus_musculus|28747                 CCCTGTGAG------------------------ATGGCCTGCAAT---------------
Rattus_norvegicus|27085            CCCTGTGAG------------------------ATGGCCTGCAAC---------------
Cavia_porcellus|11788              CCCTGTGAG------------------------ATGGCGTGCAAT---------------
Procavia_capensis|13404            CCTTGTGAG------------------------ATGGCTTGCAAC---------------
Loxodonta_africana|23090           TCCTGTGAG------------------------ATGGCCTGCAAC---------------
Canis_familiaris|3275              CCTTGTGAG------------------------ATGGCCTGCAAC---------------
Erinaceus_europaeus|11688          CCCTGTGAG------------------------ATGGCCTGCAAT---------------
Bos_taurus|25318                   CCCTGTGAG------------------------ATGGCCTGCAAT---------------
Tursiops_truncatus|13214           CCCTGTGAG------------------------ATGGCCTGCAAC---------------
Felis_catus|37221                  CCCTGTGAG------------------------ATGGCCTGCAAT---------------
Vicugna_pacos|359                  CCCTGTGAG------------------------ATGGCCTGCAAC---------------
Sus_scrofa|1708                    CCCTGTGAG------------------------ATGGCCTGCAAC---------------
Pteropus_vampyrus|3614             CCCTGTGAG------------------------ATGGCCTGCAAC---------------
Myotis_lucifugus|4915              CCCTGTGAA------------------------ATGGCTTGCAAC---------------
Equus_caballus|16216               CCCTGTGAG------------------------ATGGCCTGCAAC---------------
Otolemur_garnettii|6328            CCCTGTGAG------------------------ATGGCCTGCAAT---------------
Callithrix_jacchus|47342           CCCTGTGAA------------------------ATGGCCTGCAAT---------------
Gorilla_gorilla|9156               CCCTGTGAG------------------------ATGGCCTGCAAT---------------
Homo_sapiens|94304                 CCCTGTGAG------------------------ATGGCCTGCAAT---------------
Pan_troglodytes|37248              CCCTGTGAG------------------------ATGGCCTGCAAT---------------
Pongo_abelii|27904                 CCCTGTGAG------------------------ATGGCCTGCAAT---------------
Ornithorhynchus_anatinus|19300     CCATGTGAG------------------------ATGGCCTGTAAT---------------
Gallus_gallus|23025                CCTTGCGAA------------------------ATGGCTTGCAAT---------------
Taeniopygia_guttata|18370          CCCTGTGAA------------------------ATGGCTTGCAAT---------------
Choloepus_hoffmanni|8125           NNNNNNNNN------------------------NNNNNNNNNNNN---------------
Dasypus_novemcinctus|11596         NNNNNNNNN------------------------NNNNNNNNNNNN---------------
Tarsius_syrichta|13515             NNNNNNNNN------------------------NNNNNNNNNNNN---------------
                                                                                               

Nematostella_vectensis|5682        ------------------------------------------------------------
Drosophila_grimshawi|11395         ---TTCAAATTGGGTAAATCAATTGTGGCTGCTCGCGATCTGGATAAGGGCCACAAAATT
Drosophila_melanogaster|15129      ---AATAAACTGGGCAAATCTATTGTGGCAGCTAGGAATCTCAATAAGGGTTACAGGTTG
Drosophila_sechellia|3500          ---AATAAACTGGGTAAATCCATTGTGGCAGCTAGGAATCTCAATAAGGGTTACAGGCTG
Drosophila_simulans|14756          ---AATAAACTGGGTAAATCCATTGTGGCAGCTAGGAACCTCAATAAGGGTTACAGGTTG
Pediculus_humanus|293              ---GAAAAATTAGGGAAAACTGTTGTTGCAGCAAAACCCCTTAAAAAAGGTGATGTCATA
Bombyx_mori|1093                   ---GACAAATTACAAAAATCTCTAGTGATGGGCTCAACTAAAAATAAAGGTGAGATATTA
Tribolium_castaneum|1099           ---GCCAAACTCGGCAAAAGTTTAGTTGCTGCCACAACTCTACGAAAGGGCGATATTTTG
Culex_quinquefasciatus|11186       ---AAGAAGCTGGGGAAATCGTTGGTTTTTGCCGGGGATTTTGCGAAGGGACACAAACTG
Daphnia_pulex|27157                ---CAAAAGTTGGGCAAGTCGGTCGTGTGTACACAAAAATTGGAAGCCGGTGTCCAACTT
Branchiostoma_floridae|21332       ---AAGAAGCTGGGTAAGAGTGTGGTGGCAGCCTGCGCCATTCCAGCCGGGACCAAACTG
Branchiostoma_floridae|15501       GAGGAAAAAACAACTAAATGGACATGCTTGTATATGAATGTGCAGTGTTATGACGTATTT
Danio_rerio|20197                  ---AGCAAGTTGGGTAAATCAGTGGTGGCCCGGAAACCACTAAAAATGGGTGAGACTTTA
Oryzias_latipes|24531              ---GATAAGTTGGGAAAGTCTGTGGTGGCCAAAGTCCGGATCCCCAAAGGTTCCGTGCTG
Danio_rerio|2021                   ---GATAAGCTCGGAAAGTCGGTGGTGGCAAAGACCTCCATTCCAAAAGGTACAGAACTC
Gasterosteus_aculeatus|6537        ---GATAAGCTTGGTAAGTCCTTGGTGGCTAAGGTCAAGATCCCCAAAGGAACTGTCCTG
Tetraodon_nigroviridis|8606        ---GATAAGCTCGGCAAGTCTGTGGTGGCCAAAGTCAGGATCCCTAAAGGAACTGTTCTG
Fugu_rubripes|17860                ---GATAAGCTCGGCAAGTCTGTGGTGGCCAAAACCAAGATCCCGAAAGGAACTGTTCTG
Xenopus_tropicalis|7302            ---AAAAAGCTTGGGAAATCCGTGGTGGCCAACGTTAAGATTCCAGCTGGCACAGTGCTC
Dipodomys_ordii|12451              ---GAGAAGCTGGGCAAGTCTGTGGTGGCCAAGGTGAAAATCCCAGAAGGCACCGTTCTA
Sorex_araneus|5310                 ---GAGAAGCTGGGCAAGTCGGTGGTGGCCAAAGTGAAAATTCCGGAAGGCACCATTCTA
Macropus_eugenii|3366              ---AAGAAGCTGGGTAAATCAGCGGTGGCCAAAGTGAGAATTCCTGAAGGTACCATATTG
Spermophilus_tridecemlineatus|6701 ---NNNNNNCTGGGCAAGTCAGTGGTGGCCAAAGTGAAAATTCCAGAAGGCACCATTCTC
Monodelphis_domestica|25546        ---GATAAGCTGGGTAAATCAGTGGTAGCCAAAGTGCGAATTCCTGAAGGTACCATTTTG
Macropus_eugenii|4860              ---GAGAAGCTGGGCAAATCAGTGGTGGCCAAAGTGAGGATTCCTGAAGGTACCATATTG
Microcebus_murinus|13762           ---GAGAAGCTGGGCAAGTCTGTGGTGGCCAAAGTGAAAATTCCAGAAGGCACCATTCTA
Tupaia_belangeri|7743              ---GAGAAGCTGGGCAAGTCTGTGGTGGCCAAAGTGAAAATTCCAGAAGGCACCATTCTA
Anolis_carolinensis|12516          ---GAGAAGttGGGAAAATCTGTAATTGCCAAAGTCCGGATCCCAGAAGGAACAACGCTC
Ochotona_princeps|9469             ---GAGAAGCTGGGCAAGTCCGAGATGGCCAAAGTGAAGATCCCAGAAGGCACCGTCTTG
Echinops_telfairi|11114            ---GAGAAG---------------------------------------------------
Mus_musculus|28747                 ---GAGAAGCTCGGCAAGTCTGTGGTAGCCAAAGTGAAAATCCCAGCAGGCACCACCCTG
Rattus_norvegicus|27085            ---GAGAAGCTCGGCAAGTCCGTGGTAGCCAAAGTGAAAATCCCAGCAGGCACCATCCTG
Cavia_porcellus|11788              ---GAGAAGCTGGGCAAGTCTGTGGTGGCCAAAGTGAGGATTCCAGAAGGCACTGTCCTC
Procavia_capensis|13404            ---CAGAAGCTGGGTAAGTCTGTGGTGGCCAAGGTGAAAATTCCAGAAGGCACTGTTCTA
Loxodonta_africana|23090           ---CAGAAGCTGGGTAAATCTGTGGTGGCCAAAGTGAAAATTCCAGAAGGCACTGTTATA
Canis_familiaris|3275              ---GAGAAGCTGGGCAAGTCCGTGGTGGCCAAAGTGAGGATTCCAGAAGGCACTGTTCTA
Erinaceus_europaeus|11688          ---GAGAAGTTGGGAAAGTCTGTGGTGGCAAAAGTGAAAATCCCAGAAGGCACCATCCTG
Bos_taurus|25318                   ---GAGAAGCTGGGCAAGTCTGTGGTGGCCAAAGTGAGAATTCCAGAAGGCAGCATTCTG
Tursiops_truncatus|13214           ---GAGAAGCTGGGCAAGTCTGTGGTGGCCAAAGTGAAAATTCCGGAAGGCACCATTCTA
Felis_catus|37221                  ---GAGAAGCTGGGCAAGTCCGTGGTGGCCAAAGTGAAAATTCCAGAAGGCACTGTTCTA
Vicugna_pacos|359                  ---GAAAAACTGGGCAAGTCTGTGGTGGCCAAAGTGAAAATCCCGGAGGGCACCCATTTA
Sus_scrofa|1708                    ---GAGAAGCTGGGCAAGTCTGTGGTGGCCAAAGTGAAAATTCCGGAAGGCACTGTTCTA
Pteropus_vampyrus|3614             ---GAAAAGCTGGGCAAATCTGTGGTGGCCAAAGTGAAAATTCCAGAAGGCACCATTCTG
Myotis_lucifugus|4915              ---GAGAAGCTGGGCAAGTCTGTGGTGGCCAAAGTGAAAATTCCAGAAGGCACCATTCTA
Equus_caballus|16216               ---GAGAAGCTGGGCAAGTCTGTGGTGGCCAAAGTGAAAATTCCAGAAGGCACCATTCTG
Otolemur_garnettii|6328            ---GAGAAGCTGGGCAAGTCTGTGGTGGCTAAAGTGAAAATTCCAGAAGGCACCATTCTG
Callithrix_jacchus|47342           ---GAGAAGCTGGGCAAGTCTGTGGTGGCCAAAGTGAAAATTCCGGAAGGCACCATTCTA
Gorilla_gorilla|9156               ---GAGAAGCTGGGCAAGTCTGTGGTGGCCAAAGTGAAAATTCCGGAAGGCACCATTCTA
Homo_sapiens|94304                 ---GAGAAGCTGGGCAAGTCTGTGGTGGCCAAAGTGAAAATTCCGGAAGGCACCATTCTA
Pan_troglodytes|37248              ---GAGAAGCTGGGCAAGTCTGTGGTGGCCAAAGTGAAAATTCCGGAAGGCACCATTCTA
Pongo_abelii|27904                 ---GAGAAGCTGGGCAAGTCTGTGGTGGCCAAAGTGAAAATTCCGGAAGGCACCATTCTA
Ornithorhynchus_anatinus|19300     ---GAGAAGCTGGGCAAGTCTGTGGTGGCAAAAGTGATGATTCCTGAAGGCACCGTGCTG
Gallus_gallus|23025                ---GAAAAGCTGGGGAAGTCTGTTGTGGCAAAAGTGACCATTCCTGAAGGAACCATACTG
Taeniopygia_guttata|18370          ---GAAAAGCTGGGAAAGTCAGTAGTGGCAAAAGTGGCAATTCCTGAAGGTACAGTATTG
Choloepus_hoffmanni|8125           ---NNNNNNCTGGGCAAGTCTGTGGTGGCCAAGGTGAAGATTCCGGAAGGCACCGTTCTA
Dasypus_novemcinctus|11596         ---NNNNNNCTGGGCAAGTCTGTGGTGGCCAGAGTGAAAATTCCGGAAGGCACCGTCCTC
Tarsius_syrichta|13515             ---NNNNNNCTGGGCAAGTCTGTGGTGGCCAAAGTGAAAATTCCAGAAGGCACTATCCTG
                                                                                               

Nematostella_vectensis|5682        ------------------------------------------------------------
Drosophila_grimshawi|11395         CAAGTCTCCGATTTAACAATTAAGGTCAGTGAGCCGTCGGGTATATCGGCTGAAACATAT
Drosophila_melanogaster|15129      CAATTGGCAGATATGGCCATTAAAGTCAGTGAACCCAGCGGCCTGACAGCGGAGGATTTC
Drosophila_sechellia|3500          CAATTGGCAGATATGGCCATTAAAGTCAGTGAACCCAGCGGCCTGACAGCGGAGGATTAC
Drosophila_simulans|14756          CAATTGGCAGATATGGCCATTAAGGTCAGTGAACCCAGCGGCCTGACAGCGGAGGATTAC
Pediculus_humanus|293              ACTTGGGATAACGTATCCCTTAAGGTTGCCGAACCTAAAGGCATACCTGGAAATTATTTA
Bombyx_mori|1093                   TATCCGGGTGACGTGAAGATCAAGGTCGCGGAACCAAAAGGCCTGAACGCGCTTCACTTG
Tribolium_castaneum|1099           CAACATGAGAATATCAAAATCAAAGTTGCTGAGCCGAAAGGAATCGACGCTTCTTTGCTC
Culex_quinquefasciatus|11186       AGGGAGGAAGATGTTGCTGTGAAGGTCAGCGATCCGCACGGTTTGTCACCGACGTGGTAT
Daphnia_pulex|27157                TGCAGCGAACATTTAACAGTTAAAGTCGGTCAGCCTGTCGGCTGGCCCCCTCAACATCTT
Branchiostoma_floridae|21332       ACTATCGACCACCTGAGCGTGAAGGCAGCCGAACCGTTCGGCATCCCGCCAGACCAGATC
Branchiostoma_floridae|15501       TCTGTATTTTCAGCTGGCGTGAAGGCAGCCGAACCGTTCGGCATCCCGCCAGACCAGATC
Danio_rerio|20197                  ACCCTTGACATGCTGACGGTGAAAGTGGCCGAACCACAAGGTGTGAGACCAGAGAACATC
Oryzias_latipes|24531              ACTTTGGACATGCTGGCGGTGAAGGTGGCCGAGCCCATGGGTTTCCCAGCTGAAGACATC
Danio_rerio|2021                   ACCCTTGACATGCTGACAGTGAAAGTAGCTGAACCCAAGGGTGTAGCTCCAGAAGAAATC
Gasterosteus_aculeatus|6537        ACTCAGGACATGTTGGCGGTGAAGGTGGCCGAACCAATGGGCATCGACGCCGAGGACATC
Tetraodon_nigroviridis|8606        ACCGCAGACATGTTGGCGGTAAAGGTGGCAGAGCCCATGGGCGTCAAGGCTGAGGAAATC
Fugu_rubripes|17860                ACTGCAGACATGTTGACAGTGAAGGTGGCAGAGCCCATGGGGGTCAAGGCTGAGGACATT
Xenopus_tropicalis|7302            ACGCTCAGCATGCTCACAGTGAAAGTGGCTGAGCCCCGTGGCTTCCCCCCGGAAGAAATC
Dipodomys_ordii|12451              ACCCTGGACATGCTCACAGTGAAGGTGGGCGAGCCCAAAGGCTATCCTCCTGAGGATATC
Sorex_araneus|5310                 ACCCTGGACATGCTCACCGTGAAGGTGGGTGAGCCTAAAGGCTACCCCCCTGAAGACATC
Macropus_eugenii|3366              ACAATGGATATGCTCACCGTGAAGGTGGGTCAACCCAAAGGATGTCCTCCTGCAGGCATT
Spermophilus_tridecemlineatus|6701 ACACTGGACATGCTTACTGTGAAGGTCAGTGAGCCCAAAGGGTATCTGCCTGAAGACATC
Monodelphis_domestica|25546        ACAATGGATATGCTCACAGTGAAGGTGGGTGAACCAAAAGGATATCCCCCAGAAGGCATT
Macropus_eugenii|4860              ACAATGGATATGCTCACCGTGAAGGTGGGTGAACCCAAAGGATATCCTCCTGAGGGCATT
Microcebus_murinus|13762           ACACTGGACATGCTCACTGTGAAGGTGGGCGAGCCCAAAGGCTATCCTCCTGAAGACATC
Tupaia_belangeri|7743              ACACTGGACATGCTCACTGTGAAGGTGGGTGAGCCTAAAGGTTATCCTCCTGAAGACATC
Anolis_carolinensis|12516          ACTCTAGACATGCTGACAGTCAAAGTGGGGGAACCCAAAGGATACCCTCCAGAAGAAATC
Ochotona_princeps|9469             TCTCTAGACATGCTCACTGTG---GTGGGGGAGCCCAGAGGTTGTGCCCCCGATGATCTC
Echinops_telfairi|11114            ------------------------------------------------------------
Mus_musculus|28747                 ACCCTGGACATGCTCACTGTGAAGGTGGGGGAGCCCAAAGGCTATCCTCCTGAAGACATC
Rattus_norvegicus|27085            ACCCTGGACATGCTCACTGTGAAGGTGGGGGAACCCAAAGGCTATCCTCCTGAAGACATC
Cavia_porcellus|11788              ACACTGGACATGCTCACTGTGAAGGTCAGTGAGCCCAAAGGCTGTCCTCCTGAAGACATC
Procavia_capensis|13404            ACACTGGACATGCTCACTGTGAAGGTGGGTGAGCCGAAAGGCTATCCCCCTGAAGACATC
Loxodonta_africana|23090           ACACTAGACATGCTCACTGTGAAGGTGGGTGAGCCAAAAGGCTATCCCCCTGAAGACATC
Canis_familiaris|3275              ACATTGGACATGCTCACCGTGAAGGTGGGTGAGCCCAAAGGCTACCCTCCTGAAGACATC
Erinaceus_europaeus|11688          ACACTGGACATGCTCACAGTGAAGGTGGGTGAGCCCAAGGGCTACCCTCCCGAAGACATC
Bos_taurus|25318                   ACACTGGACATGCTCACTGTGAAGGTGGGTGAGCCCAAAGGTTACCCTCCTGAAGACATC
Tursiops_truncatus|13214           ACACTGGACATGCTCACTGTGAAGGTGGGTGAGCCCAAAGGCTACCCTCCTGAAGATATC
Felis_catus|37221                  ACGTTGGACATGCTTACTGTGAAGGTCGGTGAGCCCAAAGGCTACCCTCCTGAAGACATC
Vicugna_pacos|359                  ACACTGGACATGCTCACTGTGAAGGTGGGTGAGCCCAAAGGCTATCCTCCTGAAGACATC
Sus_scrofa|1708                    ACACTGGACATGCTCACTGTGAAGGTGGGTGAACCCAAAGGCTACCCTCCTGAAGACATC
Pteropus_vampyrus|3614             ACATTGGACATGCTCACTGTGAAGGTGGGTGAGCCCAAAGGCTACCCTCCTGAAGACATC
Myotis_lucifugus|4915              ACACTAGACATGCTGACTGTGAAGGTGGGTGAGCCTAAAGGCTACCCTCCTGAAGACATC
Equus_caballus|16216               ACGCTGGACATGCTCACCGTGAAGGTGGGTGAGCCCAAAGGCTACCCTCCTGAAGACATC
Otolemur_garnettii|6328            ACACTGGATATGCTTACTGTGAAGGTGGGCGAACCCAAAGGCTATCCTCCTGAAGACATC
Callithrix_jacchus|47342           ACAATGGACATGCTCACCGTGAAAGTAGGTGAGCCCAAAGGCTATCCTCCTGAAGACATC
Gorilla_gorilla|9156               ACAATGGACATGCTCACCGTGAAGGTGGGTGAGCCCAAAGGCTATCCTCCTGAAGACATC
Homo_sapiens|94304                 ACAATGGACATGCTCACCGTGAAGGTGGGTGAGCCCAAAGGCTATCCTCCTGAAGACATC
Pan_troglodytes|37248              ACAATGGACATGCTCACCGTGAAGGTGGGTGAGCCCAAAGGCTATCCTCCTGAAGACATC
Pongo_abelii|27904                 ACAATGGACATGCTCACCGTGAAGGTGGGTGAGCCCAAAGGCTATCCTCCTGAAGACATC
Ornithorhynchus_anatinus|19300     ACACTGGACATGCTCACAGTGAAAGTGGGTGAGCCTAAAGGATACCCCCCTGAAGACATC
Gallus_gallus|23025                ACACTTGACATGCTGACAGTGAAGGTGGGAGAGCCGAAGGGATTTGCTCCAGAAGCCATC
Taeniopygia_guttata|18370          ACACTTGACATGCTGACGGTGAAGGTGGGAGAACCGAAGGGATTTCCCCCAGAATGCATC
Choloepus_hoffmanni|8125           ACACTGGATATGCTCACTGTGAAGGTGGGTGAGCCCAAAGGCTATCCCCCTGAAGACATC
Dasypus_novemcinctus|11596         ACACTGGATATGCTCACTGTGAAGGTGGGCGAGCCCAAAGGCTATCCCCCCGAGGACATC
Tarsius_syrichta|13515             ACACTGGACATGCTCACTGTGAAGGTGGGTGAGCCCAAAGGCTACCCACCTGAAGACATC
                                                                                               

Nematostella_vectensis|5682        ------------------------------------------------------------
Drosophila_grimshawi|11395         TTTGATATAATTGGCATGCAATTGACGCGAAGTGTTAATCAAGATGAGCCCATAATTGAG
Drosophila_melanogaster|15129      TTGGACTTGGTAGGCAAGGAATTGGCAGACAATATTGGTGAGGATGAACCCATACTTGGG
Drosophila_sechellia|3500          GTGGACTTGGTAGGCAAGGAATTGGCAGACAATATTGGTGAGGATGAACCTATACTTGGG
Drosophila_simulans|14756          CTGGACTTGGTAGGCAAGGAATTGGCAGGCAATATTGGTGAGGATGAACCCATACTTGGG
Pediculus_humanus|293              CACAATATAATTGGAAAAACAATAAATAAAACAGTAGATGAGGATGAGAGTATTTTAGAA
Bombyx_mori|1093                   GAAGACGTTATATACAAAACTCTAGTATACGATAAGAAAGAAGATGAACCCCTTAACGAA
Tribolium_castaneum|1099           AAAGATGTGATAGGGAAACATGTTAAAGGAGTTATTAATGAGGATGAATCAATTTTACAA
Culex_quinquefasciatus|11186       GATCAAGTTGTTGGACGAACCGTTGCACGAGATTGCCGTCAGGATGAACCCATTTGCGGC
Daphnia_pulex|27157                GATCAACTAGTAGGGAAAACTCTTTCTAGAAACGTGGATCAAGACGAAACAATTACCTCG
Branchiostoma_floridae|21332       TACGAGCTGGTTGGTCAGACGGTTACCAAGGCGATCGAAGAGGACGCGACCATTCCGAAA
Branchiostoma_floridae|15501       TACGAGCTGGTTGGTCAGACGGTTACCAAGGCGATCGAAGAGGACGCGACCATTCCGAAA
Danio_rerio|20197                  TTCAAACTGGTTGGCAAGAAAATATCTGTGAACTTGGAGAAAGATGCCACAATTACTGAT
Oryzias_latipes|24531              TTCCAGCTGGTTGGGAAAAAAGTGAAAGAGGACATAGACGAGGACGAGAGCATCACATCG
Danio_rerio|2021                   TTCCAGCTGGTGGGGAAGAAAGTGACCACAGATGTGGAGGAGGACGAGAGCATTACTGAA
Gasterosteus_aculeatus|6537        TTCAAAATGGTTGGAAAGAAGGTCAAAAAGGACGTGGAGGAGGATGAGAGCATCTTGCCA
Tetraodon_nigroviridis|8606        TTCGAGCTGGTCGGTAAGACGGTGATGGAGAACGTGGAGGAGGATGAGAGCGTCGTGCCT
Fugu_rubripes|17860                TTCGAGCTGGTCGGTAATACCATGATGGAGAACGTGGAAGAGGACGAGAGCATTGCGCCT
Xenopus_tropicalis|7302            TATGACCTGGAAGGCAAGACAGTTAAGCGAGAGATAGAGGAAGACGAGTCTGTTACAGAA
Dipodomys_ordii|12451              TTTAATCTGGTGGGCAAGAAGGTTCTGGTCACTGTTGAAGAAGATGATACTATCCTGGAA
Sorex_araneus|5310                 TTCAGCCTGGTGGGCAAGAAGGTCCTGGTCACCGTGGAGGAAGACGACACCCTCATGGAA
Macropus_eugenii|3366              ACCAATCTCATTAGCAAGAAGGCCAAAATGAACATTGAAGAGGATGATACCATCACAGAA
Spermophilus_tridecemlineatus|6701 TTCAATCTGGTGGGCAAGAAGGTTCTGGTCACTATTGAAGAAGATGATACCATCTTAGAA
Monodelphis_domestica|25546        GCTAATCTCATTGGCCAGAAAGTCAAAGTGAACATTGAAGAGGATGATACCATCACAGAA
Macropus_eugenii|4860              GCCAGTCTCATTGGCAAGAAGGCCAAAATGAACATTGAAGAGGATGATACCATCACAGAA
Microcebus_murinus|13762           TTTAATCTCGTGGGCAAGAAGGTCCTTGTCACTGTTGAAGAAGATGATACCATCATGGAA
Tupaia_belangeri|7743              TTTAATCTAGTGGGCAAGAAGGTCCTGGTCACCATTGAAGAAGACGACACTATCATAGAA
Anolis_carolinensis|12516          TTTGACTTGGTTGGAAAGAAAGTCAAGGTGACTATTGAGGAAGACGAAACCATTGTCGAA
Ochotona_princeps|9469             TTTACTCTTGTGGTTCACATGGTGCTGCTCACTATTGAAGAGGATGACACTTTCCTGGAA
Echinops_telfairi|11114            ------------------------------------------------------------
Mus_musculus|28747                 TTCAACCTAGCGGGCAAAAAGGTGCTGGTCACTATCGAAGAAGATGACACGGTCATGGAA
Rattus_norvegicus|27085            TTCAACCTGGTGGGCAAAAAGGTGCTGGTCACTATTGAAGAAGATGACACGGTCATGGAG
Cavia_porcellus|11788              TTCAGTCTAGTGGGCAAGAAGATCCTGGTCACTGTGGAAGAAGATGACACCATCCTAGAA
Procavia_capensis|13404            TTTAATCTGGTGGGCAAGAAGGTCCTAGTCACTATTGAAGAAGATGACACCATCATGGAA
Loxodonta_africana|23090           TTTAATCTGGTGGGCAAGAAGGTCCTAGTCACTGTTGAAGAAGACGACACCATCATGGAA
Canis_familiaris|3275              TTTGGTCTAGTGGGCAAGAAGGTCCTGGTCACTGTTGAAGAAGACGACACCATCTTGGAA
Erinaceus_europaeus|11688          TTCAATCTGGTGGGCAAGAGGGTCCTGGTTACCATAGAAGAAGATGACACCATCATGGAA
Bos_taurus|25318                   TTTAGCCTGGTAGGCAAGAAGGTCCTGGTCACTGTGGAAGAAGACGACACCATCATGGAA
Tursiops_truncatus|13214           TTCAGTCTGGTGGGCAAGAAGGTCCTGGTCACTGTGGAAGAAGACGACACCATCATGGAG
Felis_catus|37221                  TTTAGTCTGGTGGGCAAGAAGGTCCTGGTCACTGTTGAAGAAGATGACACCATCCTGGAA
Vicugna_pacos|359                  TTTAGTCTAGTGGGCAAGAAGGTCCTGGTCACTGTTGAAGAAGACGACACGATCATGGAA
Sus_scrofa|1708                    TTTAGTCTGGTGGGCAAGAAGGTCCTGGTCACTATTGAAGAAGATGATACCATCATGGAA
Pteropus_vampyrus|3614             TTTAGTCTGGTGGGCAAGAAGGTCCTGGTCACTGTCGAAGAAGACGACACCATCAGAGAA
Myotis_lucifugus|4915              TTTAGCCTGGTGGGCAAGAAGGTCCTGGTCACTATTGAAGAAGACGACACCATCATGGAA
Equus_caballus|16216               TTTAGTCTTGTGGGCAAGAAGGTCCTGGTCACTGTTGAAGAAGACGACACCATCCTGGAA
Otolemur_garnettii|6328            TTTAATCTGGTGGGCAAGAAGGTCCTGGTCACTATTGAAGAAGATGATAGCATCATGGAA
Callithrix_jacchus|47342           TTTAATCTAGTGGGCAAGAAGGCCCTGGTCACTATTGAAGAAGATGACACCATCATGGAA
Gorilla_gorilla|9156               TTTAATCTAGTGGGCAAGAAGGTCCTGGTCACTGTTGAAGAGGATGACACCATCATGGAA
Homo_sapiens|94304                 TTTAATCTAGTGGGCAAGAAGGTCCTGGTCACTGTTGAAGAGGATGACACCATCATGGAA
Pan_troglodytes|37248              TTTAATCTAGTGGGCAAGAAGGTCCTGGTCACTGTTGAAGAGGATGACACCATCATGGAA
Pongo_abelii|27904                 TTTAATCTAGTGGGCAAGAAGGTCCTGGTCACTGTTGAAGAGGATGACACCATCATGGAA
Ornithorhynchus_anatinus|19300     TTTGATCTAGTAGGCAAGAAGGTCAAAGGCAATATCGAGGAGGATGAGACCATCACTGAG
Gallus_gallus|23025                TTTGATCTGGTGGGCCAGAAGGTTAAAAAAACAATTGAAGAAGATGAAACCATCACTGAG
Taeniopygia_guttata|18370          TTTGATCTGGTGGGCCAGAAGGTCAAAAAAAATATTGAAGAAGATGAAACCATCACTGAG
Choloepus_hoffmanni|8125           TTCAGTCTGGTGGGCAAGAAGGTCCTGGTCACTGTAGAGGAAGACGACACCATCATGGAA
Dasypus_novemcinctus|11596         TTTAATCTGGTGGGCAAGAAGGTCCTGGTCACCGTTGAGGAAGACGACACCATCCTGGAA
Tarsius_syrichta|13515             TTTAATCTAGTGGGCAAGAAAGTCCTGGCCACTGTTGAAGAAGATGACACCATCATGGAA
                                                                                               

Nematostella_vectensis|5682        ------------------------------------------
Drosophila_grimshawi|11395         AATGTGCTGACGTCA------------------------TAA
Drosophila_melanogaster|15129      AATAGTATAATCAAT------------------------TGA
Drosophila_sechellia|3500          AGTAGTATAATCAAT------------------------TGA
Drosophila_simulans|14756          AGTAGTATAATCAAT------------------------TGA
Pediculus_humanus|293              AATTTTTTCACA---------------------------TAA
Bombyx_mori|1093                   GGTGATTTCTGT---------------------------TAA
Tribolium_castaneum|1099           GAAAATTTGGAA---------------------------TAA
Culex_quinquefasciatus|11186       GAGGACATTGCTGGTTGTTTCGGA---------------TGA
Daphnia_pulex|27157                GACTGTATTATT---------------------------TAA
Branchiostoma_floridae|21332       GAGGCTCTGGCAGCT------------------------TAG
Branchiostoma_floridae|15501       GAGGCTCTGGCAGCT------------------------TAG
Danio_rerio|20197                  GCCATGATTAAAGGCTATTCAAAACGTTTGTCTTTT------
Oryzias_latipes|24531              GAACTGGTGGACAACCACGGCAAGAAGGCCAAGTGC---TGA
Danio_rerio|2021                   GATGTAGTCGACAGCTATGGCAAAAAAGCTAAAGCT---TGA
Gasterosteus_aculeatus|6537        GAGGTGGTGGAAGGGTACTGCAAGAAGAGAAAGTGC---TGA
Tetraodon_nigroviridis|8606        GAGGTGGTGGACAGCTATGGGAAGAAGGCCAAATGT---TGA
Fugu_rubripes|17860                GAGTTGGTGGACAGCTATGGGAAGAAAGCCAAATGT---TGA
Xenopus_tropicalis|7302            GAAGCGATTGAGAATTACAACACTAGAACGAAATGT---TAG
Dipodomys_ordii|12451              GAATCAGTAGAAAATCATGGCAAGAAAATCAAGTCT------
Sorex_araneus|5310                 GACTCGGTAGAAAATCACGGCAAAAAGATCAAGTCT---TAA
Macropus_eugenii|3366              GAAGCAATAGAAAATTTGTCCAAAAAAATAAAATCT---TAA
Spermophilus_tridecemlineatus|6701 GAATCGGTAGAAAATCATGGCAAAAAAATCAAGTCT------
Monodelphis_domestica|25546        GAAGCAATAGAACACTTGTCAAAAAAAATAAAATCT---TAA
Macropus_eugenii|4860              GAAGCAATAGAAAAT---GTCCAAAAAATAAAATCT---TAA
Microcebus_murinus|13762           GAATCAGTAGAAAATCATGGCAAAAAAATAAAGTCT------
Tupaia_belangeri|7743              GAATCAGTAGACAATCATGGCAAAAAAATCAAGTCC------
Anolis_carolinensis|12516          GATGCCATTGAAAACCATGTGAAAAAAGTGAAATGC---TAG
Ochotona_princeps|9469             GAAGCCGTAGAAAATCATGGCAAAACAATCGAGTCTTAC---
Echinops_telfairi|11114            ------------------------------------------
Mus_musculus|28747                 GAATCCGTGGAAAGTCACAGCAAGAAAATCAAGGCT---TAA
Rattus_norvegicus|27085            GAATCCGTGGAAAGTCAAAGCAAGAAAATCAAGGCT---TAA
Cavia_porcellus|11788              GAATCGGTAGAAAACCACGGCAAAAAAATCAGGTCT---TAA
Procavia_capensis|13404            GAATGTGTAGAAAATCATGGCAAAAAAATCAAATTT------
Loxodonta_africana|23090           GAATCGGTAGAAAATCATGGCAAAAAAATCAAA---------
Canis_familiaris|3275              GAATCGGTAGAAAATCATGGCAAAAAAATCAAGTCT---TAA
Erinaceus_europaeus|11688          GAATCAGTCGAAAATCATGGCAAAAAAATCAAGTCT------
Bos_taurus|25318                   GAATTGGTAGAGAATCATGGGAAAAAAATCAGATCT---TAA
Tursiops_truncatus|13214           GAATCGGTAGAAAATCATGGCAAAAAAATCAAGTCT------
Felis_catus|37221                  GAATCGGTAGAAAATCATGGCAAAAAAATCAAGTCT------
Vicugna_pacos|359                  GAATCGGTAGAAAATCATGGCAAAAAAATCAAGTCT------
Sus_scrofa|1708                    GAATCGGTAGAAAATCATGGCAAAAAAATCAAGTCT---TAA
Pteropus_vampyrus|3614             GAATCAGTAGAAAATCATGGCAAAAAAATCAAGTCT------
Myotis_lucifugus|4915              GAATCTGTAGAAAACCATGGCAAAAAAATCAAGTCT------
Equus_caballus|16216               GAATCGGTGGAAAATCATGGCAAAAAAGTCAAGTCT---TAA
Otolemur_garnettii|6328            GAATCTATAGAAAATCATGGCAAAAAAATCAAGTCT------
Callithrix_jacchus|47342           GAACTGGTAGATAATCATGGCAAAAAAATCAAGTCT---TAA
Gorilla_gorilla|9156               GAATTGGTAGATAATCATGGCAAAAAAATCAAGTCT---TAA
Homo_sapiens|94304                 GAATTGGTAGATAATCATGGCAAAAAAATCAAGTCT---TAA
Pan_troglodytes|37248              GAATTGGTAGATAATCATGGCAAAAAAATCAAGTCT---TAA
Pongo_abelii|27904                 GAATTGGTAGATAATCATGGCAAAAAAATCAAGTCT---TAA
Ornithorhynchus_anatinus|19300     GAGGCAATAGAAAATTACGTCAAAAAAATAAAATGC---TAA
Gallus_gallus|23025                CAAGCAGTGGAAAATCACGTCAAGAAAGTGAAGTGC---TAA
Taeniopygia_guttata|18370          CAAGTAGTGGAAAATCATGTTAAAAAAGTGAAGTGC---TAA
Choloepus_hoffmanni|8125           GAATCGGTAGATAATCATGGGAAAAAAATCAAGTCC------
Dasypus_novemcinctus|11596         GAAGTGGTAGAAAATCACGGGAAAAAAATCAAGGCT------
Tarsius_syrichta|13515             AACTTGGTAGAAAAT---------------------------
                                                                             

multiple sequence alignment in CLUSTALW format


Nematostella_vectensis|821         -------------------------------------NH---------------------
Drosophila_grimshawi|3802          ----------MLLLDIMSKKIC---NEVYI-IAEIGQNHQGCPETAKRMILEAKKAGCHC
Drosophila_melanogaster|13887      ----------MLLNDIISGKLV---DSVYI-IAEIGQNHQGCVETAKKMIWEAKKAGCHC
Drosophila_sechellia|13636         ----------MLLNDIISGNEV---DSVYI-IAEIGQNHQGCVETAKKMILEAKKAGCHC
Drosophila_simulans|8661           ----------MLLNDIISGKVV---DSVYI-IAEIGQNHQGCVETAKKMIWEAKKAGCHC
Pediculus_humanus|289              MAGEDVQIKGPNTIRIGNCSAIGPNERCFI-IAEIGQNHQGDINLAKEMILLAKESGADC
Bombyx_mori|2651                   ----------MVEVKITDDIRIGGNNPCFI-IAEAGQNHQGDIEIAKKLIKAAKEAGASC
Tribolium_castaneum|191            ----------MAELQITPKRTIGHNHPTFI-IAEIGQNHQGDVKIAKKLIHLAKESGADC
Culex_quinquefasciatus|14008       --------------MKISGRDVGDGHPVFV-VAEIGQNHQGSLEVAKRMIVKAKELGADC
Daphnia_pulex|25304                --------MTARSFELVNNTWIG--------------------------IKMAKDCGADC
Branchiostoma_floridae|2597        ---------MSVEFELAPGRMVGGDHPCFV-VAEIGQNHQGDINIAKEMIKKAKEAGADA
Branchiostoma_floridae|2596        --------------------MVGGDHPCFV-VAEIGQNHQGDINIAKEMIKKAKEAGADA
Danio_rerio|17283                  ---------MPVEFELCPVRKIGCCFLCFIFINNLFMLKYGILDIIYAIMLSAKDCGADC
Oryzias_latipes|24567              ---------MASVFELCPGRKIGGEHPCFI-IAEIGQNHQGDIETAKKMIQVAKDAGADC
Danio_rerio|19646                  ---------MPLKFELCPGRMIGGNNPCFI-IAEIGQNHQGDIEIAKKMIKMAKDCGADC
Gasterosteus_aculeatus|24344       ---------MPLEFELCPGRMIGGNHPCFI-IAEIGQNHQGDIEIAKKMIKMAKDCGADC
Tetraodon_nigroviridis|8722        ---------MPLEFELCPGRVVGGDHPCFI-IAEIGQNHQGDIEIAKKMIKMAKDCGADC
Fugu_rubripes|39754                ---------MPLEFELCPGRVVGGNHPCFI-IAEIGQNHQGDIEIAKKMIKMAKDCGADC
Xenopus_tropicalis|16055           ---------MPLEFELCPGRKIGGENPCFV-IAEIGQNHQGDLEIAKKMIRMAKDSGADC
Dipodomys_ordii|11724              ---------MPLELELCPGRWVGGQHPCFI-IAEIGQNHQGDLDVAKRMIRTAKECGADC
Sorex_araneus|4725                 ---------MPLELELCPGRWVGGRHPCFI-IAEIGQNHQGDLDVAKRMIRMAKECGADC
Macropus_eugenii|3068              ------------------------------------------------------------
Spermophilus_tridecemlineatus|5991 ------------------------------------------------------ECGADC
Monodelphis_domestica|4284         ---------MPLELELCPGRWVGGNHPCFI-IAEIGQNHQGDIEVAKRMIRMAKECGADC
Macropus_eugenii|4430              ---------MPLELELCPGRWVGGNHPCFI-IAEIGQNHQGDLDVAKRMIRMAKECGADC
Microcebus_murinus|11653           ---------MPLELELCPGRWVGGQHPCFI-IAEIGQNHQGDLDVAKRMIRTAKECGADC
Tupaia_belangeri|6719              ---------MPLELELCPGRWVGGEHPCFI-IAEIGQNHQGDLDVAKRMIRIAKECGADC
Anolis_carolinensis|1979           ---------MPLEIELCPGRRIGGENPCFI-IAEIGQNHQGDLEIAKKMIRVAKECGADC
Ochotona_princeps|8234             ------------------------------------------------------ECGADC
Echinops_telfairi|8772             ---------MPLELELCPGRWVGGQHPCFI-IAEIGQNHQGDLDIAKRMIRTAKECGADC
Mus_musculus|8182                  ---------MPLELELCPGRWVGGKHPCFI-IAEIGQNHQGDIDVAKRMIRTAKECGADC
Rattus_norvegicus|10164            ---------MPLELELCPGRWVGGQHPCFI-IAEIGQNHQGDLDVAKRMIRTAKECGADC
Cavia_porcellus|9222               ---------MPLEVELCPGRWVGGQHPCFI-IAEIGQNHQGDLEVAKRLIRTAKECGADC
Procavia_capensis|12537            ---------MPVELELCPGRWVGGQHPCFI-IAEIGQNHQGDLDVAKRMIRTAKECGADC
Loxodonta_africana|21512           ---------MPLELELCPGRWVGGQHPCFI-IAEIGQNHQGDLDVAKRMIRTAKECGADC
Canis_familiaris|10263             ---------MPLELELCPGRWVGGQHPCFI-IAEIGQNHQGDLEVAKRMIRTAKECGADC
Erinaceus_europaeus|9613           ---------MPLELELCPGRWVGGQHPCFI-IAEIGQNHQGDLDVAKRMIRTAKECGADC
Bos_taurus|405                     ---------MPLELELCPGRWVGGHHPCFI-IAEIGQNHQGDLDVAKRMIRMAKECGADC
Tursiops_truncatus|12503           ---------MPLELELCPGRWVGGQHPCFI-IAEIGQNHQGDLDVAKRMIRMAKECGADC
Felis_catus|2721                   ---------MPLELELCPGRWVGXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXECGADC
Vicugna_pacos|336                  ---------MPLELELCPGRWVGGQHPCFI-IAEIGQNHQGDLDVAKRMIRTAKECGADC
Sus_scrofa|5757                    ---------MPLELELCPGRWVGGQHPCFI-IAEIGQNHQGDLDVAKRMIRMAKECGADC
Pteropus_vampyrus|3400             ---------MPLELELCPGRWVGGQHPCFI-IAEIGQNHQGDLDVAKRMIRVAKECGADC
Myotis_lucifugus|4415              ------------------------------------------------------------
Equus_caballus|14457               ---------------------------------------------------VLQECGADC
Otolemur_garnettii|5446            ---------MPLELELCPGRWVGGQHPCFI-IAEIGQNHQGDLDVAKRMIRTAKECGADC
Callithrix_jacchus|38506           ------------------------------------------------------------
Gorilla_gorilla|7848               ------------------------------------------------------------
Homo_sapiens|6196                  ---------MPLELELCPGRWVGGQHPCFI-IAEIGQNHQGDLDVAKRMIRMAKECGADC
Pan_troglodytes|17523              ---------MPLELELCPGRWVGGQHPCFI-IAEIGQNHQGDLDVAKRMIRMAKECGADC
Pongo_abelii|833                   ---------MPLELELCPGRWVGGQHPCFI-IAEIGQNHQGDLDVAKRMIRMAKECGADC
Ornithorhynchus_anatinus|1192      ---------MPLELELCPGRRVGGAHPCFI-IAEIGQNHQGDLDIAKRMIRMVKDCGADC
Gallus_gallus|13667                -------------------------------------------------XRMAKECGADC
Taeniopygia_guttata|602            ---------MAGEFELCPGRRVGGDQPCFI-IAEIGQNHQGDLEIAKRMIRMVKECGADC
Choloepus_hoffmanni|7165           ------------------------------------------------------ECGADC
Dasypus_novemcinctus|10264         ---------MPLELELCPGRWVGGQHPCFI-IAEIGQNHQGDLDVAKRMIRTAKXXXXXX
Tarsius_syrichta|12387             ---------MPLELELCPGRWVGGQHPCFI-IAEIGQNHQGDLEVAKRMIRTAKXXXXXX
                                                                                               

Nematostella_vectensis|821         ------------------------------------------------------------
Drosophila_grimshawi|3802          VKFQKSDLAAKFTSSALNRKYVSDHAWGSTYGQHKEYLEFSKEVYHLLQ-----DYSREI
Drosophila_melanogaster|13887      VKFQKSDLPAKFTRSALDREYISDHAWGKTYGEHKEYLEFSKDQYLQLQ-----AHCKEL
Drosophila_sechellia|13636         VKFQKSDLPTKFTRSALDREYISDHAWGKTYGEHKEYLEFSKDQYLQLQ-----AHCKEL
Drosophila_simulans|8661           VKFQKSDLPAKFTRSALDREYISDHAWGKTYGEHKEYLEFSKDQYLQLQ-----AHCKEL
Pediculus_humanus|289              VKFQKSHLPSKFNKKALMRPYISPNSWGATYGDHKNYLEFDDNDFIELQ-----NFSHSK
Bombyx_mori|2651                   VKFQKTCLGEKFTKKYLERPYDNPNSWGKTYGEHKSHLEFSDTQYRELF-----RYAQEV
Tribolium_castaneum|191            VKFQKTCLTEKFNKSALDRPYRGPHSWGATYGEHKQFLEFTKEQFRELQ-----SFAAEI
Culex_quinquefasciatus|14008       VKFQKSCLAAKFTRNALRKPYSGDNSWGSTYGEHKAFLEFSLEDYKELQ-----RFCAEQ
Daphnia_pulex|25304                VKFQKSDLHSKFTKSVLARHYESPHAWASTYGEHKTFLEFSEDHYKELM-----AFASLI
Branchiostoma_floridae|2597        AKFQKSELTRRFNRAALARPYTSPNAWGPTYGEHKQHLEFSHDQYKELQ-----AYAKQQ
Branchiostoma_floridae|2596        AKFQKSELTRRFNRAALARPYTSPNAWGPTYGETNSTWSSATISTRSSRLTPNSKASTSL
Danio_rerio|17283                  AKFQKSEIEHRFTRNALDRLYTSPHAWGPTYGAHKHHLEFSHEQYRELQ-----QYATDI
Oryzias_latipes|24567              AKFQKSELEHKFNKRALERPYNSKNSWGKTYGEHKRHLEFSHEQYRELQ-----RFAADV
Danio_rerio|19646                  AKFQKSELEYKFNKKALERPYTSKHSWGKTYGEHKRHLEFSHEQYRELQ-----QYAKQV
Gasterosteus_aculeatus|24344       AKFQKSELDHKFNKKALERPYNSVHSWGKTYGEHKRHLEFSHEQYKELQ-----KYAEEV
Tetraodon_nigroviridis|8722        AKFQKSELEDKFNRRALERPYTSKHSWGKTYGEHKRHLEFSHDQYEELQ-----KYAEEV
Fugu_rubripes|39754                AKFQKSELKYKFNKRALERPYTSKHSWGKTYGEHKHHLEFTHEQYKQLQ-----KYAQEV
Xenopus_tropicalis|16055           AKFQKSALEYKFNKKALERPYNSPHSWGKTYGDHKRHLEFSHDQFRELQ-----KYAKEI
Dipodomys_ordii|11724              AKFQKSELEFKFNRKALQRPYTSKHSWGKTYGEHKRHLEFSHAQYKELQ-----QYAQEI
Sorex_araneus|4725                 AKFQKSELEHKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHAQYKELQ-----SYAQEV
Macropus_eugenii|3068              ------------------------------------------------------------
Spermophilus_tridecemlineatus|5991 AKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQ-----RYAEEI
Monodelphis_domestica|4284         AKFQKSELEHKFNRRALERPYTSKHSWGKTYGDHKRHLEFSHDQYRELQ-----KYAKEI
Macropus_eugenii|4430              AKFQKSELEHKFNRRALERPYASKHSWGKTYGEHKRYLEFSHDQYRELQ-----KYAKEI
Microcebus_murinus|11653           AKFQKSELEFKFNRKALERPYTSKHSWGQTYGEHKRHLEFSHDQYRELQ-----RYAKEV
Tupaia_belangeri|6719              AKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQ-----RYAAEV
Anolis_carolinensis|1979           AKFQKSELEHKFNRKALERPYTSKHSWGKNYGEHKRHLEFSHDQYRELQ-----RYAKEI
Ochotona_princeps|8234             AKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHSQYRELQ-----QYAQEV
Echinops_telfairi|8772             AKFQKSELEYKFNRRALERPYTSKHSWGKTYGEHKRYLEFSHAQYRELQ-----SYASEI
Mus_musculus|8182                  AKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYKELQ-----SYAQEI
Rattus_norvegicus|10164            AKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYKELQ-----SYAQEI
Cavia_porcellus|9222               AKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKQHLEFSHEQYRELQ-----RYAREI
Procavia_capensis|12537            AKFQKSELEYKFNRRALARPYTSKHSWGKTYGEHKRYLEFSHDQYKELQ-----KYAEEI
Loxodonta_africana|21512           AKFQKSELEYKFNRRALERPYTSKHSWGKTYGEHKRHLEFSHAQYKELQ-----KYAEEI
Canis_familiaris|10263             AKFQKSELEYKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHEQYRELQ-----RYAQEV
Erinaceus_europaeus|9613           AKFQKSELEYKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHAQYKELQ-----RYAQEI
Bos_taurus|405                     AKFQKSELEYKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHAQYKELQ-----KYAEEV
Tursiops_truncatus|12503           AKFQKSELEYKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHAQYKELQ-----KYAEEV
Felis_catus|2721                   AKFQKSELEYKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHAQYRELQ-----RYAQEI
Vicugna_pacos|336                  AKFQKSELEYKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHAQYRELQ-----KYAKEV
Sus_scrofa|5757                    AKFQKSELEYKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHAQYRELQ-----KFAEEV
Pteropus_vampyrus|3400             AKFQKSELEYKFNRKALERPYASKHSWGKTYGEHKRHLEFSHAQYKELQ-----RYAEEV
Myotis_lucifugus|4415              ------------------------------------------------------------
Equus_caballus|14457               AKFQKSELEYKFNRKALARPYTSKHSWGQTYGEHKRHLEFSHDQYKELQ-----SYAQEV
Otolemur_garnettii|5446            AKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQ-----RYAEEV
Callithrix_jacchus|38506           ------------------------------------------------------------
Gorilla_gorilla|7848               ------------------------------------------------------------
Homo_sapiens|6196                  AKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQ-----RYAEEV
Pan_troglodytes|17523              AKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQ-----RYAEEV
Pongo_abelii|833                   AKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQ-----RYAEEV
Ornithorhynchus_anatinus|1192      AKFQKSELEHKFNKKALERPYTSQHSWGKTYGEHKRHLEFSHDQYRELQ-----KYAEEI
Gallus_gallus|13667                AKFQKSELEYKFNKKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELK-----KYAEEV
Taeniopygia_guttata|602            AKFQKSELEYKFNKKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELK-----KYAEEI
Choloepus_hoffmanni|7165           AKFQKSELEYKFNRKALERPYPSKHSWGRTYGEHKRHLEFSHAQYRELQ-----SYAAEV
Dasypus_novemcinctus|10264         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXX
Tarsius_syrichta|12387             XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXX
                                                                                               

Nematostella_vectensis|821         ------------------------------------------------------------
Drosophila_grimshawi|3802          GIDFTASAMDERSLEFL-ADLRVPFIKIGSGDANNFPLLTKAASLQI-PLVISTGMQTMS
Drosophila_melanogaster|13887      NVDFTASAMDERSLEFL-SALNVPFIKIGSGDANNFPLLKKAANLNL-PLVISTGMQTMQ
Drosophila_sechellia|13636         NVDFTASAMDERSLQFL-ADLNVPFIKIGSGDANNFPLLKKAANLNL-PLVISTGMQTMQ
Drosophila_simulans|8661           NVDFTASAMDERSLEFL-ADLNVPFIKIGSGDANNFPLLKKAANLNL-PLVISTGMQTMQ
Pediculus_humanus|289              NIIFSSSVMDEVSLNFL-NNLDVPFIKIGSGDAHNFKLLKLASRLGK-PLIISTGMSHIS
Bombyx_mori|2651                   GILFTASAMDMVSFDFL-VNLKVPFIKIGSGDSNNLLFLKYAASKKI-PLIISTGMVDKT
Tribolium_castaneum|191            GILFTASAMDSQSLRFL-ASLNVPFIKIGSGDSNNLLLIQEAAAMNV-PLVISTGMQDLG
Culex_quinquefasciatus|14008       DILFSASAMDPVSLQQL-LELRVPFIKIGSGDADNVPMLRTAAAATSVPLIVSTGMQSWS
Daphnia_pulex|25304                NIHFTASAMDEISLDFL-VSLGVPFIKMGSGDANNLILLEKAAKTKL-PIIYSTGMQDMQ
Branchiostoma_floridae|2597        GIYFFASAMDEKAADFLADELDVPFIKVASADANNLPYLKHTASKGK-PMILSSGMQSMG
Branchiostoma_floridae|2596        PQQWMRYGLELLPADFLADELDVPFIKVASADANNLPYLKHTASKGK-PMILSSGMQSMG
Danio_rerio|17283                  GIFFTASGMDEMAVEFL-HEINVPFFKVASADTNNIPYLEKTAKKGKFKLSTLSGLNNLR
Oryzias_latipes|24567              GIFFTASGMDEMAVEFL-HEINVQFCSCGSG-----LFLS-----GR-PMVVSSGMQSME
Danio_rerio|19646                  GIFFTASGMDEMAVEFL-HELDVPFFKVGSGDTNNFPYLKKTAQKGR-PMVVSSGMQSME
Gasterosteus_aculeatus|24344       DICFTASGMDEMAVEFL-HELNIPFFKVGSGDTNNFPYLEKTAKKGR-PMIVSSGMQNME
Tetraodon_nigroviridis|8722        GIFFTASGMDEMAVEFL-HELKVPFFKVGSGDTNNFPYLEKTAKKGR-PMVVSSGMQSMA
Fugu_rubripes|39754                GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVVSSGMQSMQ
Xenopus_tropicalis|16055           GIYFTASGMDEMAVEFL-HELEVPFFKVGSGDTNNFPYLKKMAQKGR-PMVISSGMQSLD
Dipodomys_ordii|11724              GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKXX-XXXXXXXXXXXX
Sorex_araneus|4725                 GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKXX-XXXXXXXXXXXX
Macropus_eugenii|3068              -----------MAVEFL-DELNVPFFKVRSGDTNNFPYLEKTAKKCL--MVISSDMQSMG
Spermophilus_tridecemlineatus|5991 GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTA-KGR-PMVISSGMQSMD
Monodelphis_domestica|4284         GIFFTASGMDEMAVEFL-DELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Macropus_eugenii|4430              GIFFTASGMDEXXXXXX-XXXXVPF-KVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Microcebus_murinus|11653           GIFFTASGMDEXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXR-PMVISSGMQSMD
Tupaia_belangeri|6719              GIFFTASGMDEXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXR-PMVISSGMQSMD
Anolis_carolinensis|1979           GIFFTASGMDEMAVEFL-HELDVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMS
Ochotona_princeps|8234             GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTARKGR-PMVISSGMQSMD
Echinops_telfairi|8772             GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSME
Mus_musculus|8182                  GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Rattus_norvegicus|10164            GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Cavia_porcellus|9222               DIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Procavia_capensis|12537            GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAQKGR-PMVISSGMQSMD
Loxodonta_africana|21512           GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Canis_familiaris|10263             GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Erinaceus_europaeus|9613           GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Bos_taurus|405                     GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Tursiops_truncatus|12503           GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTARKGR-PMVISSGMQSMD
Felis_catus|2721                   GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Vicugna_pacos|336                  GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Sus_scrofa|5757                    GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Pteropus_vampyrus|3400             GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Myotis_lucifugus|4415              -----------MAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Equus_caballus|14457               GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Otolemur_garnettii|5446            GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMA
Callithrix_jacchus|38506           -----------MAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Gorilla_gorilla|7848               -----------MAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Homo_sapiens|6196                  GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Pan_troglodytes|17523              GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Pongo_abelii|833                   GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMD
Ornithorhynchus_anatinus|1192      GIFFTASGMDEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMN
Gallus_gallus|13667                GIFFTASGMDEMAVEFL-HELDVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMN
Taeniopygia_guttata|602            GIFFTASGMDEMAVEFL-HELDVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMN
Choloepus_hoffmanni|7165           GIFFTASGMDEMAVEFL-HELDVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSRD
Dasypus_novemcinctus|10264         XXXXXXXXXXXMAVEFL-HELDVPFFKVGSGDTNHFPLPEKTAKKGR-PMVISSGMQSMA
Tarsius_syrichta|12387             XXFFSASVLQEMAVEFL-HELNVPFFKVGSGDTNNFPYLEKTAKKGR-PMVISSGMQSMA
                                                                                               

Nematostella_vectensis|821         -----------------N-IALLKCTSSYPAPIEEANMCMVKDLAERF-NVISGLSDHTM
Drosophila_grimshawi|3802          TVDKIVEIMSESRN---EMYALMHCISAYPTPPTDCNLGLISVLMRRFPNVTIGYSGHEL
Drosophila_melanogaster|13887      TVERIVQTMRESGK---EDYALMHCVSSYPTDPKDCSLQLISVLRTRFPNVAIGYSGHEL
Drosophila_sechellia|13636         TVERIVQTMRESGK---EDYALMHCVSSYPTDPEDCSLELISVLRRRFPNVAIGYSGHEL
Drosophila_simulans|8661           TVERIVQTMRESGK---EDFALMHCVSSYPTDPEDCSLQLISVLRRRFPNVAIGYSGHEL
Pediculus_humanus|289              DVIEIYNLLKSNHM---N-FSLLHCTSSYPVPFDEINLNVIKSYKKLFPDINIGYSGHEL
Bombyx_mori|2651                   AVKTIYDIISSDHK---Q-FCLLHCISAYPVPFEDCNLTVLQDYKNTF-DVPVGYSGQEL
Tribolium_castaneum|191            GVRATYECVAQYHK---K-FALLHCVSAYPTPLQEINLNVIKLYETEFPDVVIGYSGHEL
Culex_quinquefasciatus|14008       QVQNIYPIIKAH-P---S-AALLHCISAYPTPPEQSLLNLVPLYKDHFPELVIGYSGHEL
Daphnia_pulex|25304                TVKTAMERMNACNP---R-VCILQCTSSYPTPEDQVHLRVMQSYRDHFPGSPVGYSGHEL
Branchiostoma_floridae|2597        IMERAVGTVTENMPGEKR-LVVMQCTSTYPLPPADVHLRCINLFKEKFPHAIIGYSGHES
Branchiostoma_floridae|2596        IMERAVGTVTENMPGEKR-LVVMQCTSTYPLPPADVHLRCINLFKEKFPHAIIGYSGHES
Danio_rerio|17283                  LKKTFHTNNLRLNK---T-FHTSWILNNNNNNNNNNNNIILLEFQKEFPDIPIGYSGHET
Oryzias_latipes|24567              TMRRVYRTVKEHNP---N-FAILQCTSAYPLEPEDVNLRVITEYQKEFPDIPIGYSGHES
Danio_rerio|19646                  TMQHVYKIVKEHNQ---N-FCILQCTSAYPLEPEDVNLRVITEYQKEFPDIPIGYSGHES
Gasterosteus_aculeatus|24344       TMRQVYKTVKEHNP---N-FTILQCTSAYPLEAEDVNLRVLTEYQKEFPDIPIGYSGHES
Tetraodon_nigroviridis|8722        TMRRVYKTVKEHNQ---N-FAILQCTSAYPLEAEDVNLRVITEYQKEFPDIPIGYSGHES
Fugu_rubripes|39754                TMRRVYKTVKEHNP---K-FAILQCTSAYPLEAEDVNLRVITEYQKEFPDIPIGYSGHES
Xenopus_tropicalis|16055           TMRRVYEMVKPLNP---N-FCFLQCTSTYPLLPEDVNLRVIKEFQSTFPDIPIGYSGHET
Dipodomys_ordii|11724              XXXXXXXXXXXXXX---X-XXXXXXXXXXXXXXXXXXXXXXXEYQKLFPDIPIGYSGHET
Sorex_araneus|4725                 XXXXXXXXXXXXXX---X-XXXXXXXXXXXXXXXXXXXXXXXEYQKLFPDIPIGYSGHET
Macropus_eugenii|3068              MMRQVYNIVKR-NP---N-FCILQCTGA-PLLLEDIN-----EYQKI-PDIPIEYSGLEM
Spermophilus_tridecemlineatus|5991 FI-QVYQIGKPLNP---I-FFYRTHTSAYPLQPEDANLRVITEYQKLFPDIPIGYSGHET
Monodelphis_domestica|4284         TMRQVYNIVKPINP---N-FCILQCTSAYPLLPEDVNLRVITEYQKEFPDVPIGYSGHET
Macropus_eugenii|4430              AMRQVYNIVKPINP---N-FCILQCTSAYPLFPEDVNLRVITEYQKAFPDIPIGYSGHET
Microcebus_murinus|11653           TMKQVYRIVKPLNP---N-FCFLQCTSAYPLQPEDVNLRVISEYQKVFPDIPIGYSGHET
Tupaia_belangeri|6719              TMKQVYQIVKPLNP---N-FCFLQCTSAYPLLPEDVNLRVISEYQKIFPDIPIGYSGHET
Anolis_carolinensis|1979           TMQQVYNLVKPINP---N-FCFLQCTSAYPLHPEDVNLRIITKYQSVFPDIPIGYSGHET
Ochotona_princeps|8234             TMKQVYQIVKPLNP---N-FCFLQCTSAYPLQPEDTNLRVISEYQKLFPDIPIGYSGHET
Echinops_telfairi|8772             TMKQVYQIVKPLNP---N-FCFLQCTSAYPLEAQDVNLRVISEYQKLFPDIPIGYSGHET
Mus_musculus|8182                  TMKQVYQIVKPLNP---N-FCFLQCTSAYPLQPEDANLRVISEYQKLFPDIPIGYSGHET
Rattus_norvegicus|10164            TMKQVYQIVKPLNP---N-FCFLQCTSAYPLQPEDANLRVISEYQKLFPDIPIGYSGHET
Cavia_porcellus|9222               TMKQVYQIVKPLNP---N-FCFLQCTSAYPLQPEDVNLRVIAEYQKLFPDIPIGYSGHET
Procavia_capensis|12537            TMKQVYQIVKPINP---N-FCFLQCTSAYPLEAEDVNLRVISEYQKLFPDIPIGYSGHET
Loxodonta_africana|21512           TMKQVYQIVKPINP---N-FCFLQCTSAYPLEPEDVNLRVISEYQKLFPDIPIGYSGHET
Canis_familiaris|10263             TMKQVYQIVKPLNP---N-FCFLQCTSAYPLLPEDVNLRVITEYQKLFPDIPIGYSGHET
Erinaceus_europaeus|9613           TMKQVYQIVKPHNP---N-FCFLQCTSAYPLLPEDVNLRVISEYQKLFPDIPIGYSGHET
Bos_taurus|405                     TMKQVYQIVKALNP---N-FCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHET
Tursiops_truncatus|12503           TMKQVYQIVKPLNP---N-FCFLQCTSAYPLQPEDVNLCVISEYQKLFPDIPIGYSGHET
Felis_catus|2721                   TMKQVYQIVKPLNP---N-FCFLQCTSAYPLSPEDVNLRIITEYQKLFPDIPIGYSGHET
Vicugna_pacos|336                  TMKQVYQIVKPLNP---N-FCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHET
Sus_scrofa|5757                    TMKQVYQIVKPLNP---N-FCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHET
Pteropus_vampyrus|3400             TMKQVYQIVKPLNP---N-FCFLQCTSAYPLLPEDVNLRIISEYQKVFPDIPIGYSGHET
Myotis_lucifugus|4415              TMKQVYQIVKPLNP---N-FCFLQCTSAYPLLPEDVNLRIISEYQKLFPDIPIGYSGHET
Equus_caballus|14457               TMKQVYQIVKPLNP---N-FCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHET
Otolemur_garnettii|5446            TMKQVYQIVKPLNP---N-FCFLQCTSAYPLQPEDVNLRVISEYQKVFPDIPIGYSGHET
Callithrix_jacchus|38506           TMKQVYQIVKPLNP---N-FCFLQCTSAYPLQPEDVNLRVIPEYQKLFPDIPIGYSGHET
Gorilla_gorilla|7848               TMKQVYQIVKPLNP---N-FCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHET
Homo_sapiens|6196                  TMKQVYQIVKPLNP---N-FCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHET
Pan_troglodytes|17523              TMKQVYQIVKPLNP---N-FCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHET
Pongo_abelii|833                   TMKQVYQIVKPLNP---N-FCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHET
Ornithorhynchus_anatinus|1192      TMRQVYQIVKPINP---N-FCILQCTSAYPLPPEDVNLRIITEYQKAFPDIPIGYSGHET
Gallus_gallus|13667                TMRQVYQIVKPLNP---N-FCFLQCTSAYPLQPEDVNLRVIPAYQSAFPDIPIGYSGHET
Taeniopygia_guttata|602            TMHQVYQIVKPINP---N-FCFLQCTSAYPLQPEDVNLRVISAYQSAFPDIPIGYSGHET
Choloepus_hoffmanni|7165           TMKQVYEIVKPLNP---N-FCFLQCTSAYPLQPEDVNLRVISXXXXXXXXXXXXXXXXXX
Dasypus_novemcinctus|10264         TMRQVYELVKPLNP---N-FCFLQCTSAYPLPPEDVNLRVITXXXXXXXXXXXXXXXXXX
Tarsius_syrichta|12387             TMKQV-QIVKPLNP---N-FCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHET
                                                                                               

Nematostella_vectensis|821         GATVPIVATALGAKIIEKHFILDRSIGGPDASFSMNEEEFTAMVKAVR------------
Drosophila_grimshawi|3802          GVSITKAAVLMGARIVERHFTLDKNQKGSDHRCSLEPAEMCSLVRGIDQFRHNKYLLNAN
Drosophila_melanogaster|13887      GVIISQAAVLLGARIVERHFTLDKSQKGSDHRCSLEPQELKALTTAITNFK----LSSVP
Drosophila_sechellia|13636         GVVISQAAVLLGARIVERHFTLDKNQKGSDHRCSLEPQELKALTTAITNFK----LSSVP
Drosophila_simulans|8661           GVVIIQAAVLLGAPIVERHFTPDKIQKGSDHRCSLEPQELKALTTAITNFK----LSSVP
Pediculus_humanus|289              GIDVPLGAVALGAKIIEKHFTLDKSLKGTDHKCSLTPLEFKQMVSNIRDFERNKIQLETI
Bombyx_mori|2651                   GTAVALGAVALGAKVLEKHITLDKSMKGTDHVCSLTPSEFQQLVRDVR------------
Tribolium_castaneum|191            GIEASVAAVAVGAKIIERHVTLDKTQKGSDHQCSLEPQELKLLIEKIR------------
Culex_quinquefasciatus|14008       GLQLSVASVLAGARIVERHFTLDKSWKGTDHRASLDPEEFGRLVRYVR------------
Daphnia_pulex|25304                GLSITLAAAALGAHVIERHVTLDKSWKGNDHACSLDPLELKSLVEGIR------------
Branchiostoma_floridae|2597        GIAISLAAVSLGAKVVERHVTLDKSWKGSDHAASLTFDELKDLCDNIR------------
Branchiostoma_floridae|2596        GIAISLAAVSLGAKVVERHVTLDKSWKGSDHAASLTFDELKDLCDNIR------------
Danio_rerio|17283                  GIHVSVAAVALGAKVLERHVTLDKSWKGSDHAASLEPDELAELVKAIR------------
Oryzias_latipes|24567              GISISVAAVALGAKVLERHITLDKTWKGSDHEASLEPSELAELVRSVR------------
Danio_rerio|19646                  GINITVGAVALGAKVVERHVTLDKSWKGSDHAASLEPEELAELVRSIR------------
Gasterosteus_aculeatus|24344       GIVISVAAVAMGAKVVERHVTLDKTWKGNDHEASLVPSELAELVRSIR------------
Tetraodon_nigroviridis|8722        GVSITVAAVALGAKIIERHVTLDKTWKGSDHAASLEPSELAELVRSIR------------
Fugu_rubripes|39754                GVSITVAAVALGAKIVERHVTLDKTWKGSDHAASLEPPELAELVRSIR------------
Xenopus_tropicalis|16055           GIAITLAAVAMGAKVVERHVTLDKTWKGNDHQASLEPNELAELVSSIR------------
Dipodomys_ordii|11724              GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVR------------
Sorex_araneus|4725                 GIAISVAAVALGAKVLERHVTLDKTWKGSDHSASLEPGELAELVRSVR------------
Macropus_eugenii|3068              GIMISVDAVALGAKILKCHVTLDKTWKRSDHQASLELNELAELMKPVR------------
Spermophilus_tridecemlineatus|5991 -IAISVAAVALGAKVFGRH-TLDKTW-GSEHSASLEP-ELAELVXXXX------------
Monodelphis_domestica|4284         GISISVAAVALGAKVLERHVTLDKTWKGSDHQASLEPNELAQLVKEVR------------
Macropus_eugenii|4430              GIMVSVAAVALGAKVLERHVTLDKTWKGSDHQASLEPNELAELVKAVR------------
Microcebus_murinus|11653           GIAISVAAVALGAKVVERHITLDKTWKGSDHSASLEPGELAELVRSVR------------
Tupaia_belangeri|6719              GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVR------------
Anolis_carolinensis|1979           GIAISVAAVAMGAKVLERHITLDKTWKGSDHQASLEPSELADLVKSIR------------
Ochotona_princeps|8234             GIAISVAAVGLGAKVLERHITLDKTWKGSVHAASLEPSELAELVRSVR------------
Echinops_telfairi|8772             GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLDASELAELVRSVR------------
Mus_musculus|8182                  GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVR------------
Rattus_norvegicus|10164            GIAISVAAVALGAKVLERHITLDKTWKGSDHLASLEPGELAELVRSVR------------
Cavia_porcellus|9222               GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVR------------
Procavia_capensis|12537            GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLDPGELAELVRSVR------------
Loxodonta_africana|21512           GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVQSVR------------
Canis_familiaris|10263             GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVR------------
Erinaceus_europaeus|9613           GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVR------------
Bos_taurus|405                     GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVR------------
Tursiops_truncatus|12503           GIVISEASVALGAKVLERHITLDKTWKGSDHSASLEPVELAELVRSVR------------
Felis_catus|2721                   GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVR------------
Vicugna_pacos|336                  GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVR------------
Sus_scrofa|5757                    GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVR------------
Pteropus_vampyrus|3400             GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVQSVR------------
Myotis_lucifugus|4415              GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVR------------
Equus_caballus|14457               GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVR------------
Otolemur_garnettii|5446            GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRAVR------------
Callithrix_jacchus|38506           GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVR------------
Gorilla_gorilla|7848               GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVR------------
Homo_sapiens|6196                  GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVR------------
Pan_troglodytes|17523              GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVR------------
Pongo_abelii|833                   GIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVH------------
Ornithorhynchus_anatinus|1192      GIAISVAAVALGAKVLERHVTLDKTWKGSDHQASLEPSELAELVRAIR------------
Gallus_gallus|13667                GIAISVAAVALGAKVVERHVTLDKTWKGSDHQASLEPKELAELVKAIR------------
Taeniopygia_guttata|602            GIAISVAAVAMGAKVLERHVTLDKTWKGSDHQASLEPNELAELVKAIR------------
Choloepus_hoffmanni|7165           XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------------
Dasypus_novemcinctus|10264         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------------
Tarsius_syrichta|12387             GIAISVAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------------
                                                                                               

Nematostella_vectensis|821         ----EAE-------------------------------KAIGN-----------------
Drosophila_grimshawi|3802          YTVEEII-------------------------------KMLGGGDELRAALSEVENKDIL
Drosophila_melanogaster|13887      MPPQEIV-------------------------------KKLNGDEELEAALQHVESKTIL
Drosophila_sechellia|13636         MYPQEIV-------------------------------QKLNGGEELEAALQHVESKTIL
Drosophila_simulans|8661           MSPQEIV-------------------------------QKLNGGEELEAALQHVESKTIL
Pediculus_humanus|289              FSKDEVK-------------------------------KSLGAH-----------EKKFQ
Bombyx_mori|2651                   ----VIE-------------------------------ASLGTP-----------IKKVV
Tribolium_castaneum|191            ----ELD-------------------------------ITLGKP-----------VKAFQ
Culex_quinquefasciatus|14008       ----AVEGMNVEGERIVEVLSSVLEARDFNGEELALALRSVTGE-----------DRKLL
Daphnia_pulex|25304                ----AIE-------------------------------KALGSA-----------VKSKQ
Branchiostoma_floridae|2597        ----IVE-------------------------------TALGKP-----------IKEPR
Branchiostoma_floridae|2596        ----IVE-------------------------------TALGKP-----------IKEPR
Danio_rerio|17283                  ----AVE-------------------------------MAMGSP-----------VKQML
Oryzias_latipes|24567              ----LVE-------------------------------KALGSG-----------IKQML
Danio_rerio|19646                  ----IVE-------------------------------RALGTG-----------LKRML
Gasterosteus_aculeatus|24344       ----LVE-------------------------------RALGNG-----------VKQML
Tetraodon_nigroviridis|8722        ----LVE-------------------------------RALGNG-----------VKRML
Fugu_rubripes|39754                ----LVE-------------------------------RALGSG-----------VKRML
Xenopus_tropicalis|16055           ----LIE-------------------------------KAMGSS-----------VKRLL
Dipodomys_ordii|11724              ----LVE-------------------------------RALGSP-----------SKQLL
Sorex_araneus|4725                 ----LVE-------------------------------RALGSP-----------TKQLL
Macropus_eugenii|3068              ----LVE-------------------------------KALGSP-----------VKQLL
Spermophilus_tridecemlineatus|5991 ----XXX-------------------------------XXXXXX-----------XXXXX
Monodelphis_domestica|4284         ----LIE-------------------------------KALGSP-----------VKRLL
Macropus_eugenii|4430              ----LVE-------------------------------KALGSP-----------VKQLL
Microcebus_murinus|11653           ----LVE-------------------------------RAMGSP-----------TKQLL
Tupaia_belangeri|6719              ----LVE-------------------------------KAMGSP-----------AKQLL
Anolis_carolinensis|1979           ----MVE-------------------------------KAMGST-----------VKQLL
Ochotona_princeps|8234             ----LVE-------------------------------LALGSP-----------TKQLL
Echinops_telfairi|8772             ----LVE-------------------------------KALGSP-----------TKQLL
Mus_musculus|8182                  ----LVE-------------------------------RALGSP-----------TKQLL
Rattus_norvegicus|10164            ----LVE-------------------------------RALGSP-----------AKQLL
Cavia_porcellus|9222               ----LVE-------------------------------RALGSP-----------TKQML
Procavia_capensis|12537            ----LVE-------------------------------QALGSP-----------VKQLL
Loxodonta_africana|21512           ----LVE-------------------------------RALGSP-----------TKQLL
Canis_familiaris|10263             ----LVE-------------------------------RAMGSP-----------TKQLL
Erinaceus_europaeus|9613           ----LVE-------------------------------KAMGSP-----------IKQLL
Bos_taurus|405                     ----LVE-------------------------------RALGSP-----------TKQLL
Tursiops_truncatus|12503           ----LVE-------------------------------RALGSP-----------TKQLL
Felis_catus|2721                   ----LVE-------------------------------RAMGSP-----------TKQLL
Vicugna_pacos|336                  ----LVE-------------------------------RALGSP-----------NKQLL
Sus_scrofa|5757                    ----LVE-------------------------------RALGSP-----------TKQLL
Pteropus_vampyrus|3400             ----LVE-------------------------------RAMGSP-----------TKQLL
Myotis_lucifugus|4415              ----LVE-------------------------------RAMGSP-----------TKQLL
Equus_caballus|14457               ----LVE-------------------------------RALGSP-----------TKQLL
Otolemur_garnettii|5446            ----LVE-------------------------------RALGSP-----------TKQLL
Callithrix_jacchus|38506           ----LVE-------------------------------RALGSP-----------TKQLL
Gorilla_gorilla|7848               ----LVE-------------------------------RALGSP-----------TKQLL
Homo_sapiens|6196                  ----LVE-------------------------------RALGSP-----------TKQLL
Pan_troglodytes|17523              ----LVE-------------------------------RALGSP-----------TKQLL
Pongo_abelii|833                   ----LVE-------------------------------RALGSP-----------TKQLL
Ornithorhynchus_anatinus|1192      ----LVE-------------------------------KAMGSP-----------IKQLL
Gallus_gallus|13667                ----AVE-------------------------------KAMGSP-----------IKQLL
Taeniopygia_guttata|602            ----TVE-------------------------------KAMGSP-----------IKQLL
Choloepus_hoffmanni|7165           ----XXX-------------------------------XXXXXX-----------XXXXX
Dasypus_novemcinctus|10264         ----XXX-------------------------------XXXXXX-----------XXXXX
Tarsius_syrichta|12387             ----XXX-------------------------------XXXXXX-----------XXXXX
                                                                                               

Nematostella_vectensis|821         ------------------------------------------------------------
Drosophila_grimshawi|3802          ECE--------LPCR------FKLGKSIVAARDLDKGHKIQVSDLTIKVSEPSGISAETY
Drosophila_melanogaster|13887      PCE--------LPCR------NKLGKSIVAARNLNKGYRLQLADMAIKVSEPSGLTAEDF
Drosophila_sechellia|13636         PCE--------LPCR------NKLGKSIVAARNLNKGYRLQLADMAIKVSEPSGLTAEDY
Drosophila_simulans|8661           PCE--------LPCR------NKLGKSIVAARNLNKGYRLQLADMAIKVSEPSGLTAEDY
Pediculus_humanus|289              KSE--------KTCY------EKLGKTVVAAKPLKKGDVITWDNVSLKVAEPKGIPGNYL
Bombyx_mori|2651                   TSE--------IPCI------DKLQKSLVMGSTKNKGEILYPGDVKIKVAEPKGLNALHL
Tribolium_castaneum|191            ASE--------RPCY------AKLGKSLVAATTLRKGDILQHENIKIKVAEPKGIDASLL
Culex_quinquefasciatus|14008       VSE--------VACH------KKLGKSLVFAGDFAKGHKLREEDVAVKVSDPHGLSPTWY
Daphnia_pulex|25304                PSE--------EPCH------QKLGKSVVCTQKLEAGVQLCSEHLTVKVGQPVGWPPQHL
Branchiostoma_floridae|2597        PSE--------QGLF------KKLGKSVVAACAIPAGTKLTIDHLSVKAAEPFGIPPDQI
Branchiostoma_floridae|2596        PTDIFTADLTVIKCSMIFTNEEKTTKWTCLYMNVQCYDVFSVFSAGVKAAEPFGIPPDQI
Danio_rerio|17283                  PCE--------ASCH------SKLGKSVVARKPLKMGETLTLDMLTVKVAEPQGVRPENI
Oryzias_latipes|24567              ASE--------KACH------DKLGKSVVAKVRIPKGSVLTLDMLAVKVAEPMGFPAEDI
Danio_rerio|19646                  PCE--------VPCH------DKLGKSVVAKTSIPKGTELTLDMLTVKVAEPKGVAPEEI
Gasterosteus_aculeatus|24344       PCE--------KPCH------DKLGKSLVAKVKIPKGTVLTQDMLAVKVAEPMGIDAEDI
Tetraodon_nigroviridis|8722        PCE--------KPCH------DKLGKSVVAKVRIPKGTVLTADMLAVKVAEPMGVKAEEI
Fugu_rubripes|39754                PCE--------KPCH------DKLGKSVVAKTKIPKGTVLTADMLTVKVAEPMGVKAEDI
Xenopus_tropicalis|16055           PCE--------LDCH------KKLGKSVVANVKIPAGTVLTLSMLTVKVAEPRGFPPEEI
Dipodomys_ordii|11724              PCE--------MACN------EKLGKSVVAKVKIPEGTVLTLDMLTVKVGEPKGYPPEDI
Sorex_araneus|4725                 PCE--------MACN------EKLGKSVVAKVKIPEGTILTLDMLTVKVGEPKGYPPEDI
Macropus_eugenii|3068              PCE--------VACN------KKLGKSAVAKVRIPEGTILTMDMLTVKVGQPKGCPPAGI
Spermophilus_tridecemlineatus|5991 XXX--------XXXX------XXLGKSVVAKVKIPEGTILTLDMLTVKVSEPKGYLPEDI
Monodelphis_domestica|4284         PCE--------VPCN------DKLGKSVVAKVRIPEGTILTMDMLTVKVGEPKGYPPEGI
Macropus_eugenii|4430              PCE--------VACN------EKLGKSVVAKVRIPEGTILTMDMLTVKVGEPKGYPPEGI
Microcebus_murinus|11653           PCE--------MACN------EKLGKSVVAKVKIPEGTILTLDMLTVKVGEPKGYPPEDI
Tupaia_belangeri|6719              PCE--------MACN------EKLGKSVVAKVKIPEGTILTLDMLTVKVGEPKGYPPEDI
Anolis_carolinensis|1979           PCE--------VACN------EKLGKSVIAKVRIPEGTTLTLDMLTVKVGEPKGYPPEEI
Ochotona_princeps|8234             PCE--------MACN------EKLGKSEMAKVKIPEGTVLSLDMLTV-VGEPRGCAPDDL
Echinops_telfairi|8772             ACE--------MACN------EK-------------------------------------
Mus_musculus|8182                  PCE--------MACN------EKLGKSVVAKVKIPAGTTLTLDMLTVKVGEPKGYPPEDI
Rattus_norvegicus|10164            PCE--------MACN------EKLGKSVVAKVKIPAGTILTLDMLTVKVGEPKGYPPEDI
Cavia_porcellus|9222               PCE--------MACN------EKLGKSVVAKVRIPEGTVLTLDMLTVKVSEPKGCPPEDI
Procavia_capensis|12537            PCE--------MACN------QKLGKSVVAKVKIPEGTVLTLDMLTVKVGEPKGYPPEDI
Loxodonta_africana|21512           SCE--------MACN------QKLGKSVVAKVKIPEGTVITLDMLTVKVGEPKGYPPEDI
Canis_familiaris|10263             PCE--------MACN------EKLGKSVVAKVRIPEGTVLTLDMLTVKVGEPKGYPPEDI
Erinaceus_europaeus|9613           PCE--------MACN------EKLGKSVVAKVKIPEGTILTLDMLTVKVGEPKGYPPEDI
Bos_taurus|405                     PCE--------MACN------EKLGKSVVAKVRIPEGSILTLDMLTVKVGEPKGYPPEDI
Tursiops_truncatus|12503           PCE--------MACN------EKLGKSVVAKVKIPEGTILTLDMLTVKVGEPKGYPPEDI
Felis_catus|2721                   PCE--------MACN------EKLGKSVVAKVKIPEGTVLTLDMLTVKVGEPKGYPPEDI
Vicugna_pacos|336                  PCE--------MACN------EKLGKSVVAKVKIPEGTHLTLDMLTVKVGEPKGYPPEDI
Sus_scrofa|5757                    PCE--------MACN------EKLGKSVVAKVKIPEGTVLTLDMLTVKVGEPKGYPPEDI
Pteropus_vampyrus|3400             PCE--------MACN------EKLGKSVVAKVKIPEGTILTLDMLTVKVGEPKGYPPEDI
Myotis_lucifugus|4415              PCE--------MACN------EKLGKSVVAKVKIPEGTILTLDMLTVKVGEPKGYPPEDI
Equus_caballus|14457               PCE--------MACN------EKLGKSVVAKVKIPEGTILTLDMLTVKVGEPKGYPPEDI
Otolemur_garnettii|5446            PCE--------MACN------EKLGKSVVAKVKIPEGTILTLDMLTVKVGEPKGYPPEDI
Callithrix_jacchus|38506           PCE--------MACN------EKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDI
Gorilla_gorilla|7848               PCE--------MACN------EKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDI
Homo_sapiens|6196                  PCE--------MACN------EKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDI
Pan_troglodytes|17523              PCE--------MACN------EKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDI
Pongo_abelii|833                   PCE--------MACN------EKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDI
Ornithorhynchus_anatinus|1192      PCE--------MACN------EKLGKSVVAKVMIPEGTVLTLDMLTVKVGEPKGYPPEDI
Gallus_gallus|13667                PCE--------MACN------EKLGKSVVAKVTIPEGTILTLDMLTVKVGEPKGFAPEAI
Taeniopygia_guttata|602            PCE--------MACN------EKLGKSVVAKVAIPEGTVLTLDMLTVKVGEPKGFPPECI
Choloepus_hoffmanni|7165           XXX--------XXXX------XXLGKSVVAKVKIPEGTVLTLDMLTVKVGEPKGYPPEDI
Dasypus_novemcinctus|10264         XXX--------XXXX------XXLGKSVVARVKIPEGTVLTLDMLTVKVGEPKGYPPEDI
Tarsius_syrichta|12387             XXX--------XXXX------XXLGKSVVAKVKIPEGTILTLDMLTVKVGEPKGYPPEDI
                                                                                               

Nematostella_vectensis|821         ---------------------------------
Drosophila_grimshawi|3802          FDIIGMQLTRSVNQDEPIIENVLTS--------
Drosophila_melanogaster|13887      LDLVGKELADNIGEDEPILGNSIIN--------
Drosophila_sechellia|13636         VDLVGKELADNIGEDEPILGSSIIN--------
Drosophila_simulans|8661           LDLVGKELAGNIGEDEPILGSSIIN--------
Pediculus_humanus|289              HNIIGKTINKTVDEDESILENFFT---------
Bombyx_mori|2651                   EDVIYKTLVYDKKEDEPLNEGDFC---------
Tribolium_castaneum|191            KDVIGKHVKGVINEDESILQENLE---------
Culex_quinquefasciatus|14008       DQVVGRTVARDCRQDEPICGEDIAGCFG-----
Daphnia_pulex|25304                DQLVGKTLSRNVDQDETITSDCII---------
Branchiostoma_floridae|2597        YELVGQTVTKAIEEDATIPKEALAA--------
Branchiostoma_floridae|2596        YELVGQTVTKAIEEDATIPKEALAA--------
Danio_rerio|17283                  FKLVGKKISVNLEKDATITDAMIKGYSKRLSF-
Oryzias_latipes|24567              FQLVGKKVKEDIDEDESITSELVDNHGKKAKC-
Danio_rerio|19646                  FQLVGKKVTTDVEEDESITEDVVDSYGKKAKA-
Gasterosteus_aculeatus|24344       FKMVGKKVKKDVEEDESILPEVVEGYCKKRKC-
Tetraodon_nigroviridis|8722        FELVGKTVMENVEEDESVVPEVVDSYGKKAKC-
Fugu_rubripes|39754                FELVGNTMMENVEEDESIAPELVDSYGKKAKC-
Xenopus_tropicalis|16055           YDLEGKTVKREIEEDESVTEEAIENYNTRTKC-
Dipodomys_ordii|11724              FNLVGKKVLVTVEEDDTILEESVENHGKKIKS-
Sorex_araneus|4725                 FSLVGKKVLVTVEEDDTLMEDSVENHGKKIKS-
Macropus_eugenii|3068              TNLISKKAKMNIEEDDTITEEAIENLSKKIKS-
Spermophilus_tridecemlineatus|5991 FNLVGKKVLVTIEEDDTILEESVENHGKKIKS-
Monodelphis_domestica|4284         ANLIGQKVKVNIEEDDTITEEAIEHLSKKIKS-
Macropus_eugenii|4430              ASLIGKKAKMNIEEDDTITEEAIEN-VQKIKS-
Microcebus_murinus|11653           FNLVGKKVLVTVEEDDTIMEESVENHGKKIKS-
Tupaia_belangeri|6719              FNLVGKKVLVTIEEDDTIIEESVDNHGKKIKS-
Anolis_carolinensis|1979           FDLVGKKVKVTIEEDETIVEDAIENHVKKVKC-
Ochotona_princeps|8234             FTLVVHMVLLTIEEDDTFLEEAVENHGKTIESY
Echinops_telfairi|8772             ---------------------------------
Mus_musculus|8182                  FNLAGKKVLVTIEEDDTVMEESVESHSKKIKA-
Rattus_norvegicus|10164            FNLVGKKVLVTIEEDDTVMEESVESQSKKIKA-
Cavia_porcellus|9222               FSLVGKKILVTVEEDDTILEESVENHGKKIRS-
Procavia_capensis|12537            FNLVGKKVLVTIEEDDTIMEECVENHGKKIKF-
Loxodonta_africana|21512           FNLVGKKVLVTVEEDDTIMEESVENHGKKIK--
Canis_familiaris|10263             FGLVGKKVLVTVEEDDTILEESVENHGKKIKS-
Erinaceus_europaeus|9613           FNLVGKRVLVTIEEDDTIMEESVENHGKKIKS-
Bos_taurus|405                     FSLVGKKVLVTVEEDDTIMEELVENHGKKIRS-
Tursiops_truncatus|12503           FSLVGKKVLVTVEEDDTIMEESVENHGKKIKS-
Felis_catus|2721                   FSLVGKKVLVTVEEDDTILEESVENHGKKIKS-
Vicugna_pacos|336                  FSLVGKKVLVTVEEDDTIMEESVENHGKKIKS-
Sus_scrofa|5757                    FSLVGKKVLVTIEEDDTIMEESVENHGKKIKS-
Pteropus_vampyrus|3400             FSLVGKKVLVTVEEDDTIREESVENHGKKIKS-
Myotis_lucifugus|4415              FSLVGKKVLVTIEEDDTIMEESVENHGKKIKS-
Equus_caballus|14457               FSLVGKKVLVTVEEDDTILEESVENHGKKVKS-
Otolemur_garnettii|5446            FNLVGKKVLVTIEEDDSIMEESIENHGKKIKS-
Callithrix_jacchus|38506           FNLVGKKALVTIEEDDTIMEELVDNHGKKIKS-
Gorilla_gorilla|7848               FNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS-
Homo_sapiens|6196                  FNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS-
Pan_troglodytes|17523              FNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS-
Pongo_abelii|833                   FNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS-
Ornithorhynchus_anatinus|1192      FDLVGKKVKGNIEEDETITEEAIENYVKKIKC-
Gallus_gallus|13667                FDLVGQKVKKTIEEDETITEQAVENHVKKVKC-
Taeniopygia_guttata|602            FDLVGQKVKKNIEEDETITEQVVENHVKKVKC-
Choloepus_hoffmanni|7165           FSLVGKKVLVTVEEDDTIMEESVDNHGKKIKS-
Dasypus_novemcinctus|10264         FNLVGKKVLVTVEEDDTILEEVVENHGKKIKA-
Tarsius_syrichta|12387             FNLVGKKVLATVEEDDTIMENLVEN--------