Orthologs Set ID: EOG4006CM


Orthology Database
OrthoDB4
Gene Symbol(s)
ISL2

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Anolis carolinensis 1277 331, 557, 964, 1494, 1758
Apis mellifera 33486 334, 557, 982, 1446, 1770
Bombyx mori 3274 557, 694, 786, 982, 1217, 1542
Bos taurus 12652 331, 557, 964, 1494, 1758
Bos taurus 13136 331, 557, 982, 1206, 1494, 1758
Branchiostoma floridae 41009 331, 557, 964, 1389, 1437, 1758, 1842
Caenorhabditis elegans 1417 328, 385, 450, 557, 708, 956, 1449, 1686
Callithrix jacchus 44206 331, 557, 583, 964, 1494, 1758
Callithrix jacchus 46809 331, 557, 757, 982, 1457, 1503, 1660, 1924, 2102, 2130, 2153, 2212
Canis familiaris 21922 326, 554, 964, 1494, 1915
Cavia porcellus 12331 331, 557, 964, 1494, 1758
Cavia porcellus 24856 331, 557, 982, 1494, 1758
Choloepus hoffmanni 12539 331, 557, 964, 1494, 1758
Choloepus hoffmanni 1405 754, 806, 963, 1494, 1608, 1758
Culex quinquefasciatus 15641 331, 557, 694, 982, 1217, 1449, 1770
Danio rerio 20797 331, 557, 982, 1494, 1758
Danio rerio 26298 331, 557, 964, 1494, 1758
Danio rerio 29046 331, 557, 964, 1494, 1758
Danio rerio 3280 331, 557, 910, 1542, 1758
Daphnia pulex 19417 557, 952, 1449, 1621
Dasypus novemcinctus 10026 557, 982, 1494
Dasypus novemcinctus 4895 331, 557, 964, 1494, 1758
Dipodomys ordii 15885 331, 557, 964, 1494, 1758, 2097
Drosophila melanogaster 3349 331, 557, 694, 982, 1217, 1446, 1770, 2002
Drosophila persimilis 16405 331, 557, 694, 982, 1217, 1446, 1770, 2002
Drosophila sechellia 11762 331, 557, 694, 982, 1217, 1449, 1770, 2002
Drosophila simulans 4567 331, 557, 694, 982, 1217, 1449, 1770, 2002
Drosophila yakuba 7048 331, 557, 694, 982, 1217, 1446, 1770, 2002
Echinops telfairi 13551 331, 557, 964, 1494, 1758
Echinops telfairi 972 331, 557, 982, 1046, 1217, 1242, 1260, 1263, 1281, 1287, 1293, 1304, 1320, 1327, 1338, 1345, 1352, 1356, 1363, 1494, 1758
Equus caballus 1290 331, 557, 982, 1494, 1758
Equus caballus 14099 331, 557, 964, 1494, 1758
Erinaceus europaeus 8777 331, 557, 964, 1494, 1758
Felis catus 40996 331, 557, 982, 1189, 1494, 1758
Felis catus 42581 331, 557, 585, 964, 1186, 1494
Fugu rubripes 1098 331, 557, 982, 1530, 1758
Fugu rubripes 30053 331, 557, 964, 1506, 1758
Fugu rubripes 7786 331, 557, 964, 1758
Gallus gallus 22550 331, 557, 580, 666, 909, 1039, 1061, 1494, 1758
Gasterosteus aculeatus 19757 331, 554, 964, 1494, 1758
Gasterosteus aculeatus 22884 557, 982, 1530, 1758, 2102
Gasterosteus aculeatus 2399 331, 557, 921, 1494, 1758
Gorilla gorilla 16948 331, 557, 771, 807, 982, 1494, 1758
Gorilla gorilla 31558 331, 557, 1051, 1240, 1276, 1503, 1758
Homo sapiens 29496 331, 557, 982, 1494, 1758
Ixodes scapularis 17836 139, 557, 1193
Ixodes scapularis 17839 729, 1770, 1909
Linepithema humile 6941 334, 557, 982, 1446, 1770
Loxodonta africana 24792 331, 557, 964, 1494, 1758
Macropus eugenii 7357 331, 557, 964, 1494, 1758
Macropus eugenii 9432 331, 557, 964, 1494, 1655, 1758, 2046
Microcebus murinus 2006 331, 557, 964, 1321, 1494
Microcebus murinus 9605 331, 557, 982, 1494, 1758
Monodelphis domestica 13648 231, 323, 331, 557, 964, 1494, 1758
Monodelphis domestica 57 331, 557, 982, 1494, 1758
Mus musculus 11820 331, 557, 964, 1494, 1758
Mus musculus 44064 331, 557, 982, 1494, 1758
Nasonia vitripennis 9293 334, 557, 982, 1446, 1770
Nematostella vectensis 12483 557, 964, 1344, 1758
Ochotona princeps 15487 331, 557, 982, 1162, 1494, 1758, 2012
Ochotona princeps 513 331, 557, 964, 990, 1041, 1053, 1161, 1194, 1283, 1494, 1758
Ornithorhynchus anatinus 25838 331, 557, 964, 1494, 1758
Ornithorhynchus anatinus 28681 557, 646, 656, 1494, 1609
Oryctolagus cuniculus 21892 331, 557, 982, 1494, 1758
Oryctolagus cuniculus 2869 331, 557, 964, 1494, 1758
Oryzias latipes 15600 539, 964, 1506
Oryzias latipes 18527 331, 557, 982, 1506, 1758
Otolemur garnettii 13561 331, 557, 765, 964, 1242, 1286, 1296, 1305, 1335, 1347, 1350, 1353, 1455, 1758
Otolemur garnettii 1567 1494, 1758
Otolemur garnettii 2070 331, 557, 982, 1494, 1758
Pan troglodytes 13247 331, 557, 982, 1494, 1758
Pan troglodytes 29600 331, 557, 964, 1494, 1758
Pediculus humanus 2973 331, 557, 982, 1075, 1449, 1896
Pogonomyrmex barbatus 2673 114, 337, 557
Pogonomyrmex barbatus 2677 1446, 1770
Pongo abelii 22055 331, 380, 433, 440, 455, 466, 476, 495, 518, 526, 542, 557, 924, 961, 964, 1055, 1170, 1196, 1230, 1235, 1242, 1303, 1358, 1449, 1454, 1494, 1665, 1673, 1758, 2032, 2043
Pongo abelii 9734 331, 557, 982, 1494, 1758
Procavia capensis 12972 331, 557, 654, 964, 1494, 1758
Procavia capensis 16748 331, 557, 982, 1494, 1758
Pteropus vampyrus 10382 331, 557, 982
Pteropus vampyrus 9384 331, 557, 964, 1168, 1199, 1215, 1228, 1249, 1261, 1494
Rattus norvegicus 17976 331, 557, 964, 1494, 1758
Rattus norvegicus 33962 331, 557, 982, 1494, 1758
Rhesus macaque 32038 326, 557, 606, 644, 683, 695, 761, 781, 1494, 1758
Rhesus macaque 34621 331, 557, 982, 1494, 1758
Sorex araneus 14424 331, 557, 964, 1494, 1758
Spermophilus tridecemlineatus 13317 331, 557, 964, 1494, 1758
Spermophilus tridecemlineatus 5969 557, 982, 1494, 1758
Sus scrofa 7945 331, 557, 964, 1494, 1758
Taeniopygia guttata 18817 331, 557, 964, 1494, 1758
Tarsius syrichta 14472 331, 557, 964, 1191, 1287, 1494, 1758
Tetraodon nigroviridis 13830 331, 557, 1005, 1494, 1599, 1758
Tetraodon nigroviridis 4572 331, 557, 982, 1494, 1758
Tupaia belangeri 12837 331, 557, 684, 795, 982, 1494
Tupaia belangeri 2263 557, 964, 1494, 1758
Tursiops truncatus 10256 324, 489, 544, 557, 982, 1494, 1758
Tursiops truncatus 5249 331, 557, 964, 1494, 1758
Xenopus tropicalis 17501 331
Xenopus tropicalis 705 331, 557, 785, 940, 1494, 1758

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 1277 ENSACAT00000004427 100558652 ENSACAG00000004390 isl1 anoCar1
Apis mellifera 33486 GB12465-PA apiMel3
Bombyx mori 3274 BGIBMGA013872-TA v2.0
Bos taurus 12652 ENSBTAT00000001638 614040 ENSBTAG00000001241 ISL1 bosTau4
Bos taurus 13136 ENSBTAT00000022147 786913 ENSBTAG00000016651 ISL2 bosTau4
Branchiostoma floridae 41009 estExt_fgenesh2_kg.C_1460001 braFlo1
Caenorhabditis elegans 1417 C04F1.3, NM_059267 172236 WBGene00002989 lim-7 ce6
Callithrix jacchus 44206 ENSCJAT00000002818 100385297 ENSCJAG00000001490 ISL1 calJac3
Callithrix jacchus 46809 ENSCJAT00000021146 100404151 ENSCJAG00000010855 ISL2 calJac3
Canis familiaris 21922 ENSCAFT00000029303 612954 ENSCAFG00000018449 LOC612954 canFam2
Cavia porcellus 24856 ENSCPOT00000010148 100731802 ENSCPOG00000010057 ISL2 cavPor3
Cavia porcellus 12331 ENSCPOT00000005844 100728707 ENSCPOG00000005782 ISL1 cavPor3
Choloepus hoffmanni 12539 ENSCHOT00000012535 ENSCHOG00000012504 ISL1 choHof1
Choloepus hoffmanni 1405 ENSCHOT00000001404 ENSCHOG00000001402 ISL2 choHof1
Culex quinquefasciatus 15641 CPIJ012632-RA 6045155 CPIJ012632 CpipJ1
Danio rerio 3280 ENSDART00000011987, NM_001002043 415131 ENSDARG00000021055 isl1l danRer6
Danio rerio 20797 ENSDART00000012862 30157 ENSDARG00000003971 isl2a danRer6
Danio rerio 26298 ENSDART00000010896 30147 ENSDARG00000004023 isl1 danRer6
Danio rerio 29046 ENSDART00000055936, NM_130964 30151 ENSDARG00000053499 isl2b danRer6
Daphnia pulex 19417 e_gw1.23.21.1 1.1
Dasypus novemcinctus 4895 ENSDNOT00000019121 101414626 ENSDNOG00000019122 ISL1 dasNov2
Dasypus novemcinctus 10026 ENSDNOT00000017622 101441966 ENSDNOG00000017623 ISL2 dasNov2
Dipodomys ordii 15885 ENSDORT00000016645 ENSDORG00000016645 Isl1 dipOrd1
Drosophila melanogaster 3349 FBtr0081111, NM_057427 35147 FBgn0003896 tup dm3
Drosophila persimilis 16405 FBtr0184440 6588798 FBgn0156426 GL18825 droPer1
Drosophila sechellia 11762 FBtr0200038 6614604 FBgn0171965 GM17053 droSec1
Drosophila simulans 4567 FBtr0221711 6732730 FBgn0193221 GD21801 droSim1
Drosophila yakuba 7048 FBtr0259214 6529631 FBgn0230421 GE12696 droYak2
Echinops telfairi 972 ENSETET00000000948 101639569 ENSETEG00000000946 ISL2 TENREC
Echinops telfairi 13551 ENSETET00000013196 101651971 ENSETEG00000013197 ISL1 TENREC
Equus caballus 14099 ENSECAT00000003316 100052482 ENSECAG00000002264 ISL1 equCab2
Equus caballus 1290 ENSECAT00000009905 100050804 ENSECAG00000009523 ISL2 equCab2
Erinaceus europaeus 8777 ENSEEUT00000007886 ENSEEUG00000007909 ISL1 eriEur1
Felis catus 42581 ENSFCAT00000011473 101090235 ENSFCAG00000011470 ISL1 felCat3
Felis catus 40996 ENSFCAT00000000065 101095829 ENSFCAG00000000066 ISL2 felCat3
Fugu rubripes 30053 ENSTRUT00000013821 101079976 ENSTRUG00000005679 isl2b fr2
Fugu rubripes 7786 ENSTRUT00000035435 ENSTRUG00000013818 isl1 fr2
Fugu rubripes 1098 ENSTRUT00000021927 101079671 ENSTRUG00000008697 isl2a fr2
Gallus gallus 22550 ENSGALT00000038907 396383 ENSGALG00000014884 ISL1 galGal3
Gasterosteus aculeatus 22884 ENSGACT00000013952 ENSGACG00000010533 isl2a gasAcu1
Gasterosteus aculeatus 2399 ENSGACT00000021707 ENSGACG00000016405 isl2b gasAcu1
Gasterosteus aculeatus 19757 ENSGACT00000005095 ENSGACG00000003872 isl1 gasAcu1
Gorilla gorilla 16948 ENSGGOT00000034752 101125662 ENSGGOG00000024385 ISL2 gorGor3
Gorilla gorilla 31558 ENSGGOT00000031024 ENSGGOG00000009588 ISL1 gorGor3
Homo sapiens 29496 ENST00000290759, NM_145805 64843 ENSG00000159556 ISL2 hg19,GRCh37
Ixodes scapularis 17836 ISCW021826-RA ISCW021826 IscaW1
Ixodes scapularis 17839 ISCW021829-RA ISCW021829 IscaW1
Linepithema humile 6941 LH15889-RA 1.2
Loxodonta africana 24792 ENSLAFT00000017756 100664449 ENSLAFG00000017758 ISL1 loxAfr3
Macropus eugenii 9432 ENSMEUT00000009427 ENSMEUG00000009405 ISL1 Meug_1.0
Macropus eugenii 7357 ENSMEUT00000007353 ENSMEUG00000007339 ISL2 Meug_1.0
Microcebus murinus 9605 ENSMICT00000008938 ENSMICG00000008943 ISL2 micMur1
Microcebus murinus 2006 ENSMICT00000001869 ENSMICG00000001868 ISL1 micMur1
Monodelphis domestica 57 ENSMODT00000015289 100012103 ENSMODG00000011982 ISL2 monDom5
Monodelphis domestica 13648 ENSMODT00000024679 100016167 ENSMODG00000019439 ISL1 monDom5
Mus musculus 11820 ENSMUST00000036060 16392 ENSMUSG00000042258 Isl1 mm9
Mus musculus 44064 ENSMUST00000034869 104360 ENSMUSG00000032318 Isl2 mm9
Nasonia vitripennis 9293 NV18000-RA 1.2
Nematostella vectensis 12483 estExt_gwp.C_240293 Nemve1
Ochotona princeps 15487 ENSOPRT00000000768 101530229 ENSOPRG00000000770 ISL2 OchPri2.0
Ochotona princeps 513 ENSOPRT00000003082 101519851 ENSOPRG00000003082 ISL1 OchPri2.0
Ornithorhynchus anatinus 25838 ENSOANT00000017078 ENSOANG00000010771 ISL1 ornAna1
Ornithorhynchus anatinus 28681 ENSOANT00000012028 ENSOANG00000007547 ISL1 ornAna1
Oryctolagus cuniculus 21892 ENSOCUT00000015010 ENSOCUG00000015011 ISL2 oryCun2.0
Oryctolagus cuniculus 2869 ENSOCUT00000023929 100344068 ENSOCUG00000027605 ISL1 oryCun2.0
Oryzias latipes 15600 ENSORLT00000015477 ENSORLG00000012362 ISL2 oryLat2
Oryzias latipes 18527 ENSORLT00000009844 101169602 ENSORLG00000007859 isl2a oryLat2
Otolemur garnettii 13561 ENSOGAT00000013034 ENSOGAG00000013031 ISL1 otoGar1
Otolemur garnettii 1567 ENSOGAT00000001510 ENSOGAG00000001509 otoGar1
Otolemur garnettii 2070 ENSOGAT00000001991 100965901 ENSOGAG00000001991 ISL2 otoGar1
Pan troglodytes 13247 ENSPTRT00000013493 738258 ENSPTRG00000007315 ISL2 panTro2
Pan troglodytes 29600 ENSPTRT00000031273 461881 ENSPTRG00000016858 ISL1 panTro2
Pediculus humanus 2973 PHUM202210-RA 8238502 PHUM202210 PhumU1
Pogonomyrmex barbatus 2673 PB15516-RA 1.2
Pogonomyrmex barbatus 2677 PB15514-RA 1.2
Pongo abelii 9734 ENSPPYT00000007882 100445770 ENSPPYG00000006676 ISL2 ponAbe2
Pongo abelii 22055 ENSPPYT00000017964 ENSPPYG00000015449 ISL1 ponAbe2
Procavia capensis 12972 ENSPCAT00000013025 ENSPCAG00000013037 ISL1 proCap1
Procavia capensis 16748 ENSPCAT00000002394 ENSPCAG00000002431 ISL2 proCap1
Pteropus vampyrus 10382 ENSPVAT00000014820 ENSPVAG00000014821 ISL2 pteVam1
Pteropus vampyrus 9384 ENSPVAT00000008768 ENSPVAG00000008769 ISL1 pteVam1
Rattus norvegicus 17976 ENSRNOT00000017305, NM_017339 64444 ENSRNOG00000012556 Isl1 rn4
Rattus norvegicus 33962 ENSRNOT00000021074 57233 ENSRNOG00000015336 Isl2 rn4
Rhesus macaque 34621 ENSMMUT00000028939 707916 ENSMMUG00000020567 ISL2 rheMac2
Rhesus macaque 32038 ENSMMUT00000005645 ENSMMUG00000003984 ISL1 rheMac2
Sorex araneus 14424 ENSSART00000014193 101547151 ENSSARG00000014194 ISL1 sorAra1
Spermophilus tridecemlineatus 13317 ENSSTOT00000013318 101966385 ENSSTOG00000013320 Isl1 speTri1
Spermophilus tridecemlineatus 5969 ENSSTOT00000005970 101955037 ENSSTOG00000005974 Isl2 speTri1
Sus scrofa 7945 ENSSSCT00000018387 100511417 ENSSSCG00000016883 ISL1 susScr2
Taeniopygia guttata 18817 ENSTGUT00000002470 100231918 ENSTGUG00000002375 ISL1 taeGut1
Tarsius syrichta 14472 ENSTSYT00000007902 ENSTSYG00000007943 ISL1 tarSyr1
Tetraodon nigroviridis 13830 ENSTNIT00000014500 ENSTNIG00000011357 isl2b tetNig2
Tetraodon nigroviridis 4572 ENSTNIT00000011398 ENSTNIG00000008382 isl2a tetNig2
Tupaia belangeri 2263 ENSTBET00000002264 ENSTBEG00000002277 ISL1 tupBel1
Tupaia belangeri 12837 ENSTBET00000012838 ENSTBEG00000012844 ISL2 tupBel1
Tursiops truncatus 10256 ENSTTRT00000012863 ENSTTRG00000012864 ISL2 turTru1
Tursiops truncatus 5249 ENSTTRT00000010833 101323295 ENSTTRG00000010834 ISL1 turTru1
Xenopus tropicalis 705 ENSXETT00000033504 100306962 ENSXETG00000015323 isl2 xenTro2
Xenopus tropicalis 17501 ENSXETT00000009078 ENSXETG00000004188 isl1 xenTro2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 4238 ENSACAP00000004327 100558652 ENSACAG00000004390 isl1 anoCar1
Apis mellifera 2463 GB12465 apiMel3
Bombyx mori 13872 BGIBMGA013872-PA v2.0
Bos taurus 9391 ENSBTAP00000022147 786913 ENSBTAG00000016651 ISL2 bosTau4
Bos taurus 4813 ENSBTAP00000001638 614040 ENSBTAG00000001241 ISL1 bosTau4
Branchiostoma floridae 19376 estExt_fgenesh2_kg.C_1460001 braFlo1
Caenorhabditis elegans 84 C04F1.3 172236 WBGene00002989 lim-7 ce6
Callithrix jacchus 35497 ENSCJAP00000002670 100385297 ENSCJAG00000001490 ISL1 calJac3
Callithrix jacchus 37997 ENSCJAP00000020012 100404151 ENSCJAG00000010855 ISL2 calJac3
Canis familiaris 22072 ENSCAFP00000027248 612954 ENSCAFG00000018449 LOC612954 canFam2
Cavia porcellus 19710 ENSCPOP00000009030 100731802 ENSCPOG00000010057 ISL2 cavPor3
Cavia porcellus 9667 ENSCPOP00000005215 100728707 ENSCPOG00000005782 ISL1 cavPor3
Choloepus hoffmanni 11074 ENSCHOP00000011070 ENSCHOG00000012504 ISL1 choHof1
Choloepus hoffmanni 1246 ENSCHOP00000001244 ENSCHOG00000001402 ISL2 choHof1
Culex quinquefasciatus 10734 CPIJ012632 CpipJ1
Danio rerio 11764 ENSDARP00000055935 30151 ENSDARG00000053499 isl2b danRer6
Danio rerio 2328 ENSDARP00000025628 415131 ENSDARG00000021055 isl1l danRer6
Danio rerio 19468 ENSDARP00000012903 30147 ENSDARG00000004023 isl1 danRer6
Danio rerio 21693 ENSDARP00000020636 30157 ENSDARG00000003971 isl2a danRer6
Daphnia pulex 16039 JGI_V11_50562 1.1
Dasypus novemcinctus 4325 ENSDNOP00000014827 101414626 ENSDNOG00000019122 ISL1 dasNov2
Dasypus novemcinctus 8862 ENSDNOP00000013669 101441966 ENSDNOG00000017623 ISL2 dasNov2
Dipodomys ordii 14931 ENSDORP00000015659 ENSDORG00000016645 Isl1 dipOrd1
Drosophila melanogaster 3130 FBpp0080661 35147 FBgn0003896 tup dm3
Drosophila persimilis 8604 FBpp0182932 6588798 FBgn0156426 GL18825 droPer1
Drosophila sechellia 6924 FBpp0198530 6614604 FBgn0171965 GM17053 droSec1
Drosophila simulans 11447 FBpp0220203 6732730 FBgn0193221 GD21801 droSim1
Drosophila yakuba 3316 FBpp0257706 6529631 FBgn0230421 GE12696 droYak2
Echinops telfairi 766 ENSETEP00000000769 101639569 ENSETEG00000000946 ISL2 TENREC
Echinops telfairi 10689 ENSETEP00000010703 101651971 ENSETEG00000013197 ISL1 TENREC
Equus caballus 1718 ENSECAP00000002355 100052482 ENSECAG00000002264 ISL1 equCab2
Equus caballus 7556 ENSECAP00000007594 100050804 ENSECAG00000009523 ISL2 equCab2
Erinaceus europaeus 7209 ENSEEUP00000007184 ENSEEUG00000007909 ISL1 eriEur1
Felis catus 6793 ENSFCAP00000000059 101095829 ENSFCAG00000000066 ISL2 felCat3
Felis catus 8482 ENSFCAP00000010656 101090235 ENSFCAG00000011470 ISL1 felCat3
Fugu rubripes 13758 ENSTRUP00000013758 101079976 ENSTRUG00000005679 isl2b fr2
Fugu rubripes 21838 ENSTRUP00000021838 101079671 ENSTRUG00000008697 isl2a fr2
Fugu rubripes 35307 ENSTRUP00000035307 ENSTRUG00000013818 isl1 fr2
Gallus gallus 9266 ENSGALP00000038117 396383 ENSGALG00000014884 ISL1 galGal3
Gasterosteus aculeatus 13403 ENSGACP00000013927 ENSGACG00000010533 isl2a gasAcu1
Gasterosteus aculeatus 4909 ENSGACP00000005080 ENSGACG00000003872 isl1 gasAcu1
Gasterosteus aculeatus 21208 ENSGACP00000021666 ENSGACG00000016405 isl2b gasAcu1
Gorilla gorilla 24369 ENSGGOP00000026409 ENSGGOG00000009588 ISL1 gorGor3
Gorilla gorilla 13585 ENSGGOP00000027528 101125662 ENSGGOG00000024385 ISL2 gorGor3
Homo sapiens 23012 ENSP00000290759 64843 ENSG00000159556 ISL2 hg19,GRCh37
Ixodes scapularis 17834 ISCW021826-PA ISCW021826 IscaW1
Ixodes scapularis 17837 ISCW021829-PA ISCW021829 IscaW1
Linepithema humile 6918 LH15889-PA 1.2
Loxodonta africana 9521 ENSLAFP00000014889 100664449 ENSLAFG00000017758 ISL1 loxAfr3
Macropus eugenii 8588 ENSMEUP00000008580 ENSMEUG00000009405 ISL1 Meug_1.0
Macropus eugenii 6705 ENSMEUP00000006697 ENSMEUG00000007339 ISL2 Meug_1.0
Microcebus murinus 1702 ENSMICP00000001703 ENSMICG00000001868 ISL1 micMur1
Microcebus murinus 8143 ENSMICP00000008140 ENSMICG00000008943 ISL2 micMur1
Monodelphis domestica 441 ENSMODP00000024250 100016167 ENSMODG00000019439 ISL1 monDom5
Monodelphis domestica 591 ENSMODP00000015014 100012103 ENSMODG00000011982 ISL2 monDom5
Mus musculus 12459 ENSMUSP00000034869 104360 ENSMUSG00000032318 Isl2 mm9
Mus musculus 52277 ENSMUSP00000044879 16392 ENSMUSG00000042258 Isl1 mm9
Nasonia vitripennis 7892 NV18000-PA 1.2
Nematostella vectensis 14408 estExt_gwp.C_240293 Nemve1
Ochotona princeps 13499 ENSOPRP00000000701 101530229 ENSOPRG00000000770 ISL2 OchPri2.0
Ochotona princeps 436 ENSOPRP00000002838 101519851 ENSOPRG00000003082 ISL1 OchPri2.0
Ornithorhynchus anatinus 2623 ENSOANP00000012026 ENSOANG00000007547 ISL1 ornAna1
Ornithorhynchus anatinus 17528 ENSOANP00000017075 ENSOANG00000010771 ISL1 ornAna1
Oryctolagus cuniculus 10154 ENSOCUP00000012898 ENSOCUG00000015011 ISL2 oryCun2.0
Oryctolagus cuniculus 10385 ENSOCUP00000020036 100344068 ENSOCUG00000027605 ISL1 oryCun2.0
Oryzias latipes 9233 ENSORLP00000009843 101169602 ENSORLG00000007859 isl2a oryLat2
Oryzias latipes 14606 ENSORLP00000015476 ENSORLG00000012362 ISL2 oryLat2
Otolemur garnettii 11673 ENSOGAP00000011674 ENSOGAG00000013031 ISL1 otoGar1
Otolemur garnettii 1777 ENSOGAP00000001776 100965901 ENSOGAG00000001991 ISL2 otoGar1
Otolemur garnettii 1341 ENSOGAP00000001342 ENSOGAG00000001509 otoGar1
Pan troglodytes 12240 ENSPTRP00000028882 461881 ENSPTRG00000016858 ISL1 panTro2
Pan troglodytes 17006 ENSPTRP00000012508 738258 ENSPTRG00000007315 ISL2 panTro2
Pediculus humanus 2908 PHUM202210-PA 8238502 PHUM202210 PhumU1
Pogonomyrmex barbatus 5514 PB15514-PA 1.2
Pogonomyrmex barbatus 5516 PB15516-PA 1.2
Pongo abelii 7917 ENSPPYP00000007574 100445770 ENSPPYG00000006676 ISL2 ponAbe2
Pongo abelii 15144 ENSPPYP00000017263 ENSPPYG00000015449 ISL1 ponAbe2
Procavia capensis 15670 ENSPCAP00000002254 ENSPCAG00000002431 ISL2 proCap1
Procavia capensis 12134 ENSPCAP00000012168 ENSPCAG00000013037 ISL1 proCap1
Pteropus vampyrus 8843 ENSPVAP00000008277 ENSPVAG00000008769 ISL1 pteVam1
Pteropus vampyrus 9781 ENSPVAP00000013968 ENSPVAG00000014821 ISL2 pteVam1
Rattus norvegicus 21885 ENSRNOP00000021074 57233 ENSRNOG00000015336 Isl2 rn4
Rattus norvegicus 24527 ENSRNOP00000017305 64444 ENSRNOG00000012556 Isl1 rn4
Rhesus macaque 29107 ENSMMUP00000027082 707916 ENSMMUG00000020567 ISL2 rheMac2
Rhesus macaque 24217 ENSMMUP00000005313 ENSMMUG00000003984 ISL1 rheMac2
Sorex araneus 12834 ENSSARP00000012833 101547151 ENSSARG00000014194 ISL1 sorAra1
Spermophilus tridecemlineatus 11941 ENSSTOP00000011938 101966385 ENSSTOG00000013320 Isl1 speTri1
Spermophilus tridecemlineatus 5344 ENSSTOP00000005338 101955037 ENSSTOG00000005974 Isl2 speTri1
Sus scrofa 17831 ENSSSCP00000017891 100511417 ENSSSCG00000016883 ISL1 susScr2
Taeniopygia guttata 4223 ENSTGUP00000002446 100231918 ENSTGUG00000002375 ISL1 taeGut1
Tarsius syrichta 13267 ENSTSYP00000007240 ENSTSYG00000007943 ISL1 tarSyr1
Tetraodon nigroviridis 8806 ENSTNIP00000011216 ENSTNIG00000008382 isl2a tetNig2
Tetraodon nigroviridis 3623 ENSTNIP00000014302 ENSTNIG00000011357 isl2b tetNig2
Tupaia belangeri 1972 ENSTBEP00000001959 ENSTBEG00000002277 ISL1 tupBel1
Tupaia belangeri 11132 ENSTBEP00000011124 ENSTBEG00000012844 ISL2 tupBel1
Tursiops truncatus 9697 ENSTTRP00000012201 ENSTTRG00000012864 ISL2 turTru1
Tursiops truncatus 4947 ENSTTRP00000010273 101323295 ENSTTRG00000010834 ISL1 turTru1
Xenopus tropicalis 22256 ENSXETP00000009078 ENSXETG00000004188 isl1 xenTro2
Xenopus tropicalis 24488 ENSXETP00000033504 100306962 ENSXETG00000015323 isl2 xenTro2

multiple sequence alignment in CLUSTALW format


Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         ------------------------------------------------------------
Danio_rerio|3280                    ------------------------------------------------------------
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        ------------------------------------------------------------
Tarsius_syrichta|14472              ------------------------------------------------------------
Erinaceus_europaeus|8777            ------------------------------------------------------------
Gorilla_gorilla|31558               ------------------------------------------------------------
Gallus_gallus|22550                 ------------------------------------------------------------
Fugu_rubripes|7786                  ------------------------------------------------------------
Rhesus_macaque|32038                ATAAGGAAGAGAGGTGCCCGAGCCGCGCCGAGTCCGCCGCCGCCGCAGCGCCTCCGCTCC
Otolemur_garnettii|13561            ------------------------------------------------------------
Felis_catus|42581                   ------------------------------------------------------------
Microcebus_murinus|2006             ------------------------------------------------------------
Macropus_eugenii|9432               ------------------------------------------------------------
Tupaia_belangeri|2263               ------------------------------------------------------------
Canis_familiaris|21922              ATAAGGAAGAGAGGTGCCCGAGCCGCGCCGAGTCCGCCGCCGCCGCAGCGCGTCTGCTCC
Monodelphis_domestica|13648         ------------------------------------------------------------
Gasterosteus_aculeatus|19757        ------------------------------------------------------------
Callithrix_jacchus|44206            ------------------------------------------------------------
Ornithorhynchus_anatinus|25838      ------------------------------------------------------------
Danio_rerio|26298                   ------------------------------------------------------------
Anolis_carolinensis|1277            ------------------------------------------------------------
Sorex_araneus|14424                 ------------------------------------------------------------
Pteropus_vampyrus|9384              ------------------------------------------------------------
Taeniopygia_guttata|18817           ------------------------------------------------------------
Pongo_abelii|22055                  ------------------------------------------------------------
Ochotona_princeps|513               ------------------------------------------------------------
Dipodomys_ordii|15885               ------------------------------------------------------------
Procavia_capensis|12972             ------------------------------------------------------------
Equus_caballus|14099                ------------------------------------------------------------
Dasypus_novemcinctus|4895           ------------------------------------------------------------
Bos_taurus|12652                    ------------------------------------------------------------
Sus_scrofa|7945                     ------------------------------------------------------------
Oryctolagus_cuniculus|2869          ------------------------------------------------------------
Choloepus_hoffmanni|12539           ------------------------------------------------------------
Cavia_porcellus|12331               ------------------------------------------------------------
Echinops_telfairi|13551             ------------------------------------------------------------
Loxodonta_africana|24792            ------------------------------------------------------------
Mus_musculus|11820                  ------------------------------------------------------------
Pan_troglodytes|29600               ------------------------------------------------------------
Rattus_norvegicus|17976             ------------------------------------------------------------
Spermophilus_tridecemlineatus|13317 ------------------------------------------------------------
Tursiops_truncatus|5249             ------------------------------------------------------------
Ornithorhynchus_anatinus|28681      ------------------------------------------------------------
Macropus_eugenii|7357               ------------------------------------------------------------
Xenopus_tropicalis|705              ------------------------------------------------------------
Oryzias_latipes|15600               ------------------------------------------------------------
Felis_catus|40996                   ------------------------------------------------------------
Callithrix_jacchus|46809            ------------------------------------------------------------
Microcebus_murinus|9605             ------------------------------------------------------------
Danio_rerio|29046                   ------------------------------------------------------------
Oryzias_latipes|18527               ------------------------------------------------------------
Gasterosteus_aculeatus|2399         ------------------------------------------------------------
Tetraodon_nigroviridis|13830        ------------------------------------------------------------
Fugu_rubripes|30053                 ------------------------------------------------------------
Tetraodon_nigroviridis|4572         ------------------------------------------------------------
Fugu_rubripes|1098                  ------------------------------------------------------------
Gasterosteus_aculeatus|22884        ------------------------------------------------------------
Danio_rerio|20797                   ------------------------------------------------------------
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            ------------------------------------------------------------
Echinops_telfairi|972               ------------------------------------------------------------
Gorilla_gorilla|16948               ------------------------------------------------------------
Cavia_porcellus|24856               ------------------------------------------------------------
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------------------------------------
Otolemur_garnettii|2070             ------------------------------------------------------------
Ochotona_princeps|15487             ------------------------------------------------------------
Mus_musculus|44064                  ------------------------------------------------------------
Rattus_norvegicus|33962             ------------------------------------------------------------
Procavia_capensis|16748             ------------------------------------------------------------
Oryctolagus_cuniculus|21892         ------------------------------------------------------------
Equus_caballus|1290                 ------------------------------------------------------------
Homo_sapiens|29496                  ------------------------------------------------------------
Pongo_abelii|9734                   ------------------------------------------------------------
Pan_troglodytes|13247               ------------------------------------------------------------
Rhesus_macaque|34621                ------------------------------------------------------------
Bos_taurus|13136                    ------------------------------------------------------------
Spermophilus_tridecemlineatus|5969  ------------------------------------------------------------
Dasypus_novemcinctus|10026          ------------------------------------------------------------
Choloepus_hoffmanni|1405            ------------------------------------------------------------
Tursiops_truncatus|10256            ------------------------------------------------------------
Nematostella_vectensis|12483        ------------------------------------------------------------
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 ------------------------------------------------------------
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              ------------------------------------------------------------
Nasonia_vitripennis|9293            ------------------------------------------------------------
Apis_mellifera|33486                ------------------------------------------------------------
Linepithema_humile|6941             ------------------------------------------------------------
Pogonomyrmex_barbatus|2677          ------------------------------------------------------------
Culex_quinquefasciatus|15641        ------------------------------------------------------------
Bombyx_mori|3274                    ------------------------------------------------------------
Drosophila_persimilis|16405         ------------------------------------------------------------
Drosophila_yakuba|7048              ------------------------------------------------------------
Drosophila_melanogaster|3349        ------------------------------------------------------------
Drosophila_simulans|4567            ------------------------------------------------------------
Drosophila_sechellia|11762          ------------------------------------------------------------
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         ------------------------------------ATGAACATCTGTATGCGAAATGGT
Danio_rerio|3280                    ------------------------------------------------------------
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        ------------------------------------------------------------
Tarsius_syrichta|14472              ------------------------------------------------------------
Erinaceus_europaeus|8777            ------------------------------------------------------------
Gorilla_gorilla|31558               ------------------------------------------------------------
Gallus_gallus|22550                 ------------------------------------------------------------
Fugu_rubripes|7786                  ---------------------------------------------------------GCT
Rhesus_macaque|32038                ACCAACTCCGCCGGCTTAAATTGGACTCCCAGATCCGCGAGGGCGCTGCGCAGCCGAGCA
Otolemur_garnettii|13561            ------------------------------------------------------------
Felis_catus|42581                   ------------------------------------------------------------
Microcebus_murinus|2006             ------------------------------------------------------------
Macropus_eugenii|9432               ------------------------------------------------------------
Tupaia_belangeri|2263               ------------------------------------------------------------
Canis_familiaris|21922              GCCAGCTCCGCCGGCTTAAGTTGGACTCCCCGACCCGCGAGGGCGCGGCGCAGCCGGGCA
Monodelphis_domestica|13648         ------------------------------------TCAGCGAGAGCGCCGCACAGCCCC
Gasterosteus_aculeatus|19757        ------------------------------------------------------------
Callithrix_jacchus|44206            ------------------------------------------------------------
Ornithorhynchus_anatinus|25838      ------------------------------------------------------------
Danio_rerio|26298                   ------------------------------------------------------------
Anolis_carolinensis|1277            ------------------------------------------------------------
Sorex_araneus|14424                 ------------------------------------------------------------
Pteropus_vampyrus|9384              ------------------------------------------------------------
Taeniopygia_guttata|18817           ------------------------------------------------------------
Pongo_abelii|22055                  ------------------------------------------------------------
Ochotona_princeps|513               ------------------------------------------------------------
Dipodomys_ordii|15885               ------------------------------------------------------------
Procavia_capensis|12972             ------------------------------------------------------------
Equus_caballus|14099                ------------------------------------------------------------
Dasypus_novemcinctus|4895           ------------------------------------------------------------
Bos_taurus|12652                    ------------------------------------------------------------
Sus_scrofa|7945                     ------------------------------------------------------------
Oryctolagus_cuniculus|2869          ------------------------------------------------------------
Choloepus_hoffmanni|12539           ------------------------------------------------------------
Cavia_porcellus|12331               ------------------------------------------------------------
Echinops_telfairi|13551             ------------------------------------------------------------
Loxodonta_africana|24792            ------------------------------------------------------------
Mus_musculus|11820                  ------------------------------------------------------------
Pan_troglodytes|29600               ------------------------------------------------------------
Rattus_norvegicus|17976             ------------------------------------------------------------
Spermophilus_tridecemlineatus|13317 ------------------------------------------------------------
Tursiops_truncatus|5249             ------------------------------------------------------------
Ornithorhynchus_anatinus|28681      ------------------------------------------------------------
Macropus_eugenii|7357               ------------------------------------------------------------
Xenopus_tropicalis|705              ------------------------------------------------------------
Oryzias_latipes|15600               ------------------------------------------------------------
Felis_catus|40996                   ------------------------------------------------------------
Callithrix_jacchus|46809            ------------------------------------------------------------
Microcebus_murinus|9605             ------------------------------------------------------------
Danio_rerio|29046                   ------------------------------------------------------------
Oryzias_latipes|18527               ------------------------------------------------------------
Gasterosteus_aculeatus|2399         ------------------------------------------------------------
Tetraodon_nigroviridis|13830        ------------------------------------------------------------
Fugu_rubripes|30053                 ------------------------------------------------------------
Tetraodon_nigroviridis|4572         ------------------------------------------------------------
Fugu_rubripes|1098                  ------------------------------------------------------------
Gasterosteus_aculeatus|22884        ------------------------------------------------------------
Danio_rerio|20797                   ------------------------------------------------------------
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            ------------------------------------------------------------
Echinops_telfairi|972               ------------------------------------------------------------
Gorilla_gorilla|16948               ------------------------------------------------------------
Cavia_porcellus|24856               ------------------------------------------------------------
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------------------------------------
Otolemur_garnettii|2070             ------------------------------------------------------------
Ochotona_princeps|15487             ------------------------------------------------------------
Mus_musculus|44064                  ------------------------------------------------------------
Rattus_norvegicus|33962             ------------------------------------------------------------
Procavia_capensis|16748             ------------------------------------------------------------
Oryctolagus_cuniculus|21892         ------------------------------------------------------------
Equus_caballus|1290                 ------------------------------------------------------------
Homo_sapiens|29496                  ------------------------------------------------------------
Pongo_abelii|9734                   ------------------------------------------------------------
Pan_troglodytes|13247               ------------------------------------------------------------
Rhesus_macaque|34621                ------------------------------------------------------------
Bos_taurus|13136                    ------------------------------------------------------------
Spermophilus_tridecemlineatus|5969  ------------------------------------------------------------
Dasypus_novemcinctus|10026          ------------------------------------------------------------
Choloepus_hoffmanni|1405            ------------------------------------------------------------
Tursiops_truncatus|10256            ------------------------------------------------------------
Nematostella_vectensis|12483        ------------------------------------------------------------
Pogonomyrmex_barbatus|2673          ------------------------------------------------ATGAAGGTTTTA
Daphnia_pulex|19417                 ------------------------------------------------------------
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              ------------------------------------------------------------
Nasonia_vitripennis|9293            ------ATGCAGAGACCGGCCGCCGCTGGCGGTGGGCCCGGGCCCATTGGCCTACAGGGC
Apis_mellifera|33486                ------------------------------------------------------------
Linepithema_humile|6941             ------------------------------------------------------------
Pogonomyrmex_barbatus|2677          ------------------------------------------------------------
Culex_quinquefasciatus|15641        ------------------------------------------------------------
Bombyx_mori|3274                    ------------------------------------------------------------
Drosophila_persimilis|16405         ------------------------------------ATGGTAATGGCAGAGATTGGTGGC
Drosophila_yakuba|7048              ------------------------------------ATGGTAATGGCAGAGATTGGTGGC
Drosophila_melanogaster|3349        ------------------------------------ATGGTAATGGCAGAGATTGGTGGC
Drosophila_simulans|4567            ------------------------------------ATGGTAATGGCAGAGATTGGTGGC
Drosophila_sechellia|11762          ------------------------------------ATGGTAATGGCAGAGATTGGTGGC
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         TATGAGCAATTCTCACTGACATCTCCAGGAACATCGGATCTCGAAATTGGTGGATCATTT
Danio_rerio|3280                    ------------------------------ATGCTTCTGTCTGACATGGGA---------
Xenopus_tropicalis|17501            ------------------------------------ATGGGAGACATGGGA---------
Branchiostoma_floridae|41009        ---------ATGAACCACTCACCACCCATCGAGTCAGCAGCGATGCCCGGC---------
Tarsius_syrichta|14472              ------------------------------------ATGGGAGACATGGGA---------
Erinaceus_europaeus|8777            ------------------------------------ATGGGAGACATGGGA---------
Gorilla_gorilla|31558               ------------------------------------ATGGGAGACATGGGA---------
Gallus_gallus|22550                 ------------------------------------ATGGGAGACATGGGA---------
Fugu_rubripes|7786                  GTGACGGTGGACCTGACTTCGCCTTACTGTGAGGACATGGGAGACATGGGG---------
Rhesus_macaque|32038                GCGGCTCTTTCAGCTTTGGCAACCCCAGGGGCCACTATTTCCCACTTAGCC---------
Otolemur_garnettii|13561            ------------------------------------ATGGGAGACATGGGA---------
Felis_catus|42581                   ------------------------------------ATGGGAGACATGGGC---------
Microcebus_murinus|2006             ------------------------------------ATGGGAGACATGGGA---------
Macropus_eugenii|9432               ------------------------------------ATGGGAGACATGGGA---------
Tupaia_belangeri|2263               ------------------------------------------------------------
Canis_familiaris|21922              GCGGCCCCCCGAGCCTTGGCAGCCCCACGCGCCACTGTCTCCCACTTAGCC---------
Monodelphis_domestica|13648         GCAGCGTTTCTCACCCTTGCAACACCAGTGACCAATATTTCACACTTAGCA---------
Gasterosteus_aculeatus|19757        ------------------------------------ATGGGAGACATGGGG---------
Callithrix_jacchus|44206            ------------------------------------ATGGGAGACATGGGA---------
Ornithorhynchus_anatinus|25838      ------------------------------------GCTGGCACACTCCAA---------
Danio_rerio|26298                   ------------------------------------ATGGGAGACATGGGG---------
Anolis_carolinensis|1277            ------------------------------------ATGGGAGATATGGGA---------
Sorex_araneus|14424                 ------------------------------------ATGGGAGACATGGGA---------
Pteropus_vampyrus|9384              ------------------------------------ATGGGAGACATGGGA---------
Taeniopygia_guttata|18817           ------------------------------------ATGGGAGACATGGGA---------
Pongo_abelii|22055                  ------------------------------------ATGGGAGACATGGGA---------
Ochotona_princeps|513               ------------------------------------ATGGGAGACATGGGA---------
Dipodomys_ordii|15885               ------------------------------------ATGGGAGACATGGGC---------
Procavia_capensis|12972             ------------------------------------ATGGGAGACATGGGA---------
Equus_caballus|14099                ------------------------------------ATGGGAGACATGGGA---------
Dasypus_novemcinctus|4895           ------------------------------------ATGGGAGACATGGGA---------
Bos_taurus|12652                    ------TCACTGTGGACATTACTCCCTGTTACAGATATGGGAGACATGGGA---------
Sus_scrofa|7945                     ------TCACTGTGGACATTACTCCCTGTTACAGATATGGGAGACATGGGA---------
Oryctolagus_cuniculus|2869          ------TCACTGTGGACATTACTCCCTCTCACAGATATGGGAGACATGGGA---------
Choloepus_hoffmanni|12539           ------------------------------------ATGGGAGACATGGGA---------
Cavia_porcellus|12331               ------------------------------------ATGGGAGACATGGGA---------
Echinops_telfairi|13551             ------------------------------------ATGGGAGACATGGGA---------
Loxodonta_africana|24792            ------------------------------------ATGGGAGACATGGGA---------
Mus_musculus|11820                  ------------------------------------ATGGGAGACATGGGC---------
Pan_troglodytes|29600               ------------------------------------ATGGGAGACATGGGA---------
Rattus_norvegicus|17976             ------------------------------------ATGGGAGACATGGGC---------
Spermophilus_tridecemlineatus|13317 ------------------------------------ATGGGAGACATGGGA---------
Tursiops_truncatus|5249             ------------------------------------ATGGGAGACATGGGA---------
Ornithorhynchus_anatinus|28681      ---------------------TGCTCATTTCCCCTGGTAGAAAAGCCCGGG---------
Macropus_eugenii|7357               ---------GTGGATATTATTTTTAATTATCCTTTTCTGGGTGCTATGGGG---------
Xenopus_tropicalis|705              ------ATGGTGGATCCTATCTTGCCCTGCCCGCTCTCGGCTGCTATGGGA---------
Oryzias_latipes|15600               ------ATGGTGGATATTATTTTCAGCTCTTCTTTCTTGGATGATATGGGG---------
Felis_catus|40996                   ------ATGGTGGATATTATTTTTCATTATCCTTTTCTGGGTGCTATGGGG---------
Callithrix_jacchus|46809            ---------------------------------------------ATGGGT---------
Microcebus_murinus|9605             ------ATGGTGGATATTATTTTTCACTGTCCTTTTCTGGGTGCTATGGGG---------
Danio_rerio|29046                   ------ATGGTGGATATAATATTCAGCTCTTCTTTTTTGGATGATATGGGG---------
Oryzias_latipes|18527               ------ATGGTAGACATCCTCCTCAACACCTCCTTCTTGGATGATATGGGG---------
Gasterosteus_aculeatus|2399         ------ATGGTGGATATTATTTTCAGCTCTTCTTTCTTGGGTGATATGGGG---------
Tetraodon_nigroviridis|13830        ------ATGGTGGATATTATCTTCAGCTCTTCTTTCTTGGGTGATATGGGG---------
Fugu_rubripes|30053                 ------ATGGTGGATATTATCTTTAGCTCTTCTTTCTTGGGTGATATGGGG---------
Tetraodon_nigroviridis|4572         ------ATGCTGGACATCCTGCTCAACACTTCTTTCTTGGATGATATGGGG---------
Fugu_rubripes|1098                  ------ATGCTGGACATCCTGCTCAACACTTCTTTCTTGGATGATATGGGG---------
Gasterosteus_aculeatus|22884        ------------------------------------------------------------
Danio_rerio|20797                   ------ATGGTGGATATTCTACCGCATCCTTCTTTCTTGGGTGATATGGGG---------
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            ------ATGGTGGATATTATTTTTAATTATCCTTTTCTGGGTGCTATGGGG---------
Echinops_telfairi|972               ------ATGGTGGATATTATTTTTTCTTATCCTTTTCTGGGTGCTATGGGG---------
Gorilla_gorilla|16948               ------ATGGTGGATATTATTTTTCATTATCCTTTTCTGGGTGCTATGGGT---------
Cavia_porcellus|24856               ------ATGGTGGATCTGCTTCTCCAGTGTCCTTTCCCGGGTGCTATGGGG---------
Pteropus_vampyrus|10382             ------ATGGTGGACGTTATTTTTCACTATCCTTTTCTGGGTGCTATGGGG---------
Tupaia_belangeri|12837              ------ATGGTGGATATTATTTTTCATTATCCTTTTCTGGGTGCTATGGGG---------
Otolemur_garnettii|2070             ------ATGGTGGATATTATTTTTCATTATCCTTTTCTGGGTGCTATGGGG---------
Ochotona_princeps|15487             ------ATGGTGGATATTCTTTTTCATTATCCTTTCCTGGGTGCTATGGGG---------
Mus_musculus|44064                  ------ATGGTGGATATTATTTTTCATTATCCTTTTCTGGGTGCTATGGGG---------
Rattus_norvegicus|33962             ------ATGGTGGATATTATTTTTCATTATCCTTTTCTGGGTGCTATGGGG---------
Procavia_capensis|16748             ------ATGGTGGATATTATTTTTCACTATCCTTTTCTGGGTGCTATGGGG---------
Oryctolagus_cuniculus|21892         ------ATGGTGGATATTATTTTTCCTTATCCCTTTCTGGGTGCTATGGGG---------
Equus_caballus|1290                 ------ATGGTGGATATTATTTTTCATTATCCTTTTCTGGGTGCTATGGGG---------
Homo_sapiens|29496                  ------ATGGTGGATATTATTTTTCATTATCCTTTTCTGGGTGCTATGGGT---------
Pongo_abelii|9734                   ------ATGGTGGATATTATTTTTCATTATCCTTTTCTGGGTGCTATGGGT---------
Pan_troglodytes|13247               ------ATGGTGGATATTATTTTTCATTATCCTTTTCTGGGTGCTATGGGT---------
Rhesus_macaque|34621                ------ATGGTGGATATTATTTTTCATTATCCTTTTCTGGGTGCTATGGGT---------
Bos_taurus|13136                    ------ATGGTGGATATTATTTTTCACTATCCTTTTCTAGGTACTATGGGG---------
Spermophilus_tridecemlineatus|5969  ------------------------------------------------------------
Dasypus_novemcinctus|10026          ------------------------------------------------------------
Choloepus_hoffmanni|1405            ------------------------------------------------------------
Tursiops_truncatus|10256            ------ATGGTGGATATTATTTTTCATTATCCTTTTCTGGGTACTATGGGG---------
Nematostella_vectensis|12483        ---------------------------ATGCCGATTTGTTGTTCTTTCTCT---------
Pogonomyrmex_barbatus|2673          TATTACGAATATACTAATTGTGAAGCTAATCTGTTTTCCAATTTCGATAAA---------
Daphnia_pulex|19417                 ------------------------------------------------------------
Ixodes_scapularis|17836             ------------ATGTTGGTGTGCGGCTCGGCGTCGTCGGACAAGCACGGC---------
Pediculus_humanus|2973              ------------------------------------------------------------
Nasonia_vitripennis|9293            CCGCCCAGGTCAATCAAGATCTCGCCGGTCAAGATACAGGACGAGCCCGGC---------
Apis_mellifera|33486                ------------------------------------ATGGATGGATCATCT---------
Linepithema_humile|6941             ------------------------------ATGACTAATGGTCAATGTTGC---------
Pogonomyrmex_barbatus|2677          ---------------------------------ATGCTTGCAGATTCTGGA---------
Culex_quinquefasciatus|15641        ------------ATGGCCGTCCTGCAGTCCCATAAACTTGGTGAACATAAT---------
Bombyx_mori|3274                    ------------------------------------------------------------
Drosophila_persimilis|16405         CATTTGGCTCACCAGCTACCATTGCACAATCACAACCACAATCAAACTGGATTACAGCCG
Drosophila_yakuba|7048              CATTTGGCTCACCAGCTACCGTTGCACAATCACAACCACAATCAAACTGGATTACAGCCA
Drosophila_melanogaster|3349        CATTTGGCTCACCAGCTACCGTTGCACAATCACAACCACAATCAAACTGGATTACAGCCA
Drosophila_simulans|4567            CATTTGGCTCACCAGCTACCGTTGCACAATCACAACCACAATCAAACTGGATTACAGCCA
Drosophila_sechellia|11762          CATTTGGCTCACCAGCTACCGTTGCACAATCACAACCACAATCAAACTGGATTACAGCCA
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         TGGAAAGACGAACCGGATACCAAGTACTTGTGCCTTGATTCTCCT---------------
Danio_rerio|3280                    ------------------------------------GAGCAACAA---------------
Xenopus_tropicalis|17501            ------------------------------------GACCCACCA---------------
Branchiostoma_floridae|41009        ------------------------------------GACCCTCCT---------------
Tarsius_syrichta|14472              ------------------------------------GATCCACCA---------------
Erinaceus_europaeus|8777            ------------------------------------GATCCACCC---------------
Gorilla_gorilla|31558               ------------------------------------GATCCACCA---------------
Gallus_gallus|22550                 ------------------------------------GACCCACCA---------------
Fugu_rubripes|7786                  ------------------------------------GACCCGCCG---------------
Rhesus_macaque|32038                ------------------------------------ACAGCTCCAGCATCCTCTCTGTGG
Otolemur_garnettii|13561            ------------------------------------GATCCACCA---------------
Felis_catus|42581                   ------------------------------------GATCCACCA---------------
Microcebus_murinus|2006             ------------------------------------GATCCACCA---------------
Macropus_eugenii|9432               ------------------------------------GATCCACCA---------------
Tupaia_belangeri|2263               ------------------------------------------------------------
Canis_familiaris|21922              ------------------------------------ACAGCTCCAGCATCCTCTCTGTGG
Monodelphis_domestica|13648         ------------------------------------ACAGCTCCAACCTCCCTCTGGTCT
Gasterosteus_aculeatus|19757        ------------------------------------GATCCGCCG---------------
Callithrix_jacchus|44206            ------------------------------------GATCCACCA---------------
Ornithorhynchus_anatinus|25838      ------------------------------------TTACCACCC---------------
Danio_rerio|26298                   ------------------------------------GATCCACCG---------------
Anolis_carolinensis|1277            ------------------------------------GACCCACCG---------------
Sorex_araneus|14424                 ------------------------------------GATCCACCA---------------
Pteropus_vampyrus|9384              ------------------------------------GATCCACCA---------------
Taeniopygia_guttata|18817           ------------------------------------GACCCACCA---------------
Pongo_abelii|22055                  ------------------------------------GATCCACCA---------------
Ochotona_princeps|513               ------------------------------------GATCCACCA---------------
Dipodomys_ordii|15885               ------------------------------------GATCCACCA---------------
Procavia_capensis|12972             ------------------------------------GATCCACCA---------------
Equus_caballus|14099                ------------------------------------GATCCACCA---------------
Dasypus_novemcinctus|4895           ------------------------------------GATCCACCA---------------
Bos_taurus|12652                    ------------------------------------GATCCACCA---------------
Sus_scrofa|7945                     ------------------------------------GATCCACCA---------------
Oryctolagus_cuniculus|2869          ------------------------------------GATCCACCA---------------
Choloepus_hoffmanni|12539           ------------------------------------GATCCACCA---------------
Cavia_porcellus|12331               ------------------------------------GATCCACCA---------------
Echinops_telfairi|13551             ------------------------------------GATCCACCA---------------
Loxodonta_africana|24792            ------------------------------------GATCCACCA---------------
Mus_musculus|11820                  ------------------------------------GATCCACCA---------------
Pan_troglodytes|29600               ------------------------------------GATCCACCA---------------
Rattus_norvegicus|17976             ------------------------------------GATCCACCA---------------
Spermophilus_tridecemlineatus|13317 ------------------------------------GATCCACCA---------------
Tursiops_truncatus|5249             ------------------------------------GATCCACCA---------------
Ornithorhynchus_anatinus|28681      ------------------------------------------------------------
Macropus_eugenii|7357               ------------------------------------GATCATTCC---------------
Xenopus_tropicalis|705              ------------------------------------GAGCATCCC---------------
Oryzias_latipes|15600               ------------------------------------GATCATTCC---------------
Felis_catus|40996                   ------------------------------------GATCATTCC---------------
Callithrix_jacchus|46809            ------------------------------------GATCATTCA---------------
Microcebus_murinus|9605             ------------------------------------GATCATCCC---------------
Danio_rerio|29046                   ------------------------------------GATCATTCC---------------
Oryzias_latipes|18527               ------------------------------------GATCATTCA---------------
Gasterosteus_aculeatus|2399         ------------------------------------GATCATTCC---------------
Tetraodon_nigroviridis|13830        ------------------------------------GATCATTCC---------------
Fugu_rubripes|30053                 ------------------------------------GATCATTCC---------------
Tetraodon_nigroviridis|4572         ------------------------------------GATCATTCA---------------
Fugu_rubripes|1098                  ------------------------------------GATCATTCA---------------
Gasterosteus_aculeatus|22884        ------------------------------------------------------------
Danio_rerio|20797                   ------------------------------------GATCATTCA---------------
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            ------------------------------------GATCATTCC---------------
Echinops_telfairi|972               ------------------------------------GATCATTCC---------------
Gorilla_gorilla|16948               ------------------------------------GATCATTCC---------------
Cavia_porcellus|24856               ------------------------------------GACCCCTCC---------------
Pteropus_vampyrus|10382             ------------------------------------GATCATTCC---------------
Tupaia_belangeri|12837              ------------------------------------GATCATTCC---------------
Otolemur_garnettii|2070             ------------------------------------GATCATTCC---------------
Ochotona_princeps|15487             ------------------------------------GATCATCCC---------------
Mus_musculus|44064                  ------------------------------------GATCATTCC---------------
Rattus_norvegicus|33962             ------------------------------------GATCATTCC---------------
Procavia_capensis|16748             ------------------------------------GATCATTCC---------------
Oryctolagus_cuniculus|21892         ------------------------------------GATCCTTCC---------------
Equus_caballus|1290                 ------------------------------------GATCATTCC---------------
Homo_sapiens|29496                  ------------------------------------GATCATTCC---------------
Pongo_abelii|9734                   ------------------------------------GATCATTCC---------------
Pan_troglodytes|13247               ------------------------------------GATCATTCC---------------
Rhesus_macaque|34621                ------------------------------------GATCATTCC---------------
Bos_taurus|13136                    ------------------------------------GATCATTCC---------------
Spermophilus_tridecemlineatus|5969  ------------------------------------------------------------
Dasypus_novemcinctus|10026          ------------------------------------------------------------
Choloepus_hoffmanni|1405            ------------------------------------------------------------
Tursiops_truncatus|10256            ------------------------------------GATCATTCC---------------
Nematostella_vectensis|12483        ------------------------------------------------------------
Pogonomyrmex_barbatus|2673          ------------------------------------TCCTCGGCG---------------
Daphnia_pulex|19417                 ------------------------------------------------------------
Ixodes_scapularis|17836             ---------------------------------GTGACGCACTGC---------------
Pediculus_humanus|2973              ------------------------------------------------------------
Nasonia_vitripennis|9293            ------------------------------------GATCCCATG---------------
Apis_mellifera|33486                ------------------------------------------------------------
Linepithema_humile|6941             ------------------------------------------------------------
Pogonomyrmex_barbatus|2677          ------------------------------------TCCGAGAGC---------------
Culex_quinquefasciatus|15641        ------------------------------------GTGCCCGGG---------------
Bombyx_mori|3274                    ------------------------------------------------------------
Drosophila_persimilis|16405         TCGCTGGTGATGAACCATCACCTGGACTTGGATTGTCATGGGCAT---------------
Drosophila_yakuba|7048              TCGCTGGTGATGAACCATCACCTGGATTTGGATTGCCACGGACAC---------------
Drosophila_melanogaster|3349        TCGCTGGTGATGAACCATCACCTGGATTTGGATTGCCATGGACAC---------------
Drosophila_simulans|4567            TCGCTGGTGATGAACCATCACCTGGATTTGGATTGCCATGGACAC---------------
Drosophila_sechellia|11762          TCGCTGGTGATGAACCATCACCTGGATTTGGATTGCCACGGACAC---------------
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         ------------------------------------------------------------
Danio_rerio|3280                    ------------------------------------------------------------
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        ------------------------------------------------------------
Tarsius_syrichta|14472              ------------------------------------------------------------
Erinaceus_europaeus|8777            ------------------------------------------------------------
Gorilla_gorilla|31558               ------------------------------------------------------------
Gallus_gallus|22550                 ------------------------------------------------------------
Fugu_rubripes|7786                  ------------------------------------------------------------
Rhesus_macaque|32038                GCTGTTCACCAACTGTACAACCACCATTTCACTGTGGACATTACTCCCTCTTACAGATAT
Otolemur_garnettii|13561            ------------------------------------------------------------
Felis_catus|42581                   ------------------------------------------------------------
Microcebus_murinus|2006             ------------------------------------------------------------
Macropus_eugenii|9432               ------------------------------------------------------------
Tupaia_belangeri|2263               ------------------------------------------------------------
Canis_familiaris|21922              GCTGGTCACCAACTGTACAACCACCATTTCACTGTGGACATTACTCCCTCTTACAGATAT
Monodelphis_domestica|13648         TTTAGTCAACTGTACAACCACCATTTCACTGTGGACATTACACCCTCTTACAGATATGGG
Gasterosteus_aculeatus|19757        ------------------------------------------------------------
Callithrix_jacchus|44206            ------------------------------------------------------------
Ornithorhynchus_anatinus|25838      ------------------------------------------------------------
Danio_rerio|26298                   ------------------------------------------------------------
Anolis_carolinensis|1277            ------------------------------------------------------------
Sorex_araneus|14424                 ------------------------------------------------------------
Pteropus_vampyrus|9384              ------------------------------------------------------------
Taeniopygia_guttata|18817           ------------------------------------------------------------
Pongo_abelii|22055                  ------------------------------------------------------------
Ochotona_princeps|513               ------------------------------------------------------------
Dipodomys_ordii|15885               ------------------------------------------------------------
Procavia_capensis|12972             ------------------------------------------------------------
Equus_caballus|14099                ------------------------------------------------------------
Dasypus_novemcinctus|4895           ------------------------------------------------------------
Bos_taurus|12652                    ------------------------------------------------------------
Sus_scrofa|7945                     ------------------------------------------------------------
Oryctolagus_cuniculus|2869          ------------------------------------------------------------
Choloepus_hoffmanni|12539           ------------------------------------------------------------
Cavia_porcellus|12331               ------------------------------------------------------------
Echinops_telfairi|13551             ------------------------------------------------------------
Loxodonta_africana|24792            ------------------------------------------------------------
Mus_musculus|11820                  ------------------------------------------------------------
Pan_troglodytes|29600               ------------------------------------------------------------
Rattus_norvegicus|17976             ------------------------------------------------------------
Spermophilus_tridecemlineatus|13317 ------------------------------------------------------------
Tursiops_truncatus|5249             ------------------------------------------------------------
Ornithorhynchus_anatinus|28681      ------------------------------------------------------------
Macropus_eugenii|7357               ------------------------------------------------------------
Xenopus_tropicalis|705              ------------------------------------------------------------
Oryzias_latipes|15600               ------------------------------------------------------------
Felis_catus|40996                   ------------------------------------------------------------
Callithrix_jacchus|46809            ------------------------------------------------------------
Microcebus_murinus|9605             ------------------------------------------------------------
Danio_rerio|29046                   ------------------------------------------------------------
Oryzias_latipes|18527               ------------------------------------------------------------
Gasterosteus_aculeatus|2399         ------------------------------------------------------------
Tetraodon_nigroviridis|13830        ------------------------------------------------------------
Fugu_rubripes|30053                 ------------------------------------------------------------
Tetraodon_nigroviridis|4572         ------------------------------------------------------------
Fugu_rubripes|1098                  ------------------------------------------------------------
Gasterosteus_aculeatus|22884        ------------------------------------------------------------
Danio_rerio|20797                   ------------------------------------------------------------
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            ------------------------------------------------------------
Echinops_telfairi|972               ------------------------------------------------------------
Gorilla_gorilla|16948               ------------------------------------------------------------
Cavia_porcellus|24856               ------------------------------------------------------------
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------------------------------------
Otolemur_garnettii|2070             ------------------------------------------------------------
Ochotona_princeps|15487             ------------------------------------------------------------
Mus_musculus|44064                  ------------------------------------------------------------
Rattus_norvegicus|33962             ------------------------------------------------------------
Procavia_capensis|16748             ------------------------------------------------------------
Oryctolagus_cuniculus|21892         ------------------------------------------------------------
Equus_caballus|1290                 ------------------------------------------------------------
Homo_sapiens|29496                  ------------------------------------------------------------
Pongo_abelii|9734                   ------------------------------------------------------------
Pan_troglodytes|13247               ------------------------------------------------------------
Rhesus_macaque|34621                ------------------------------------------------------------
Bos_taurus|13136                    ------------------------------------------------------------
Spermophilus_tridecemlineatus|5969  ------------------------------------------------------------
Dasypus_novemcinctus|10026          ------------------------------------------------------------
Choloepus_hoffmanni|1405            ------------------------------------------------------------
Tursiops_truncatus|10256            ------------------------------------------------------------
Nematostella_vectensis|12483        ------------------------------------------------------------
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 ------------------------------------------------------------
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              ------------------------------------------------------------
Nasonia_vitripennis|9293            ------------------------------------------------------------
Apis_mellifera|33486                ------------------------------------------------------------
Linepithema_humile|6941             ------------------------------------------------------------
Pogonomyrmex_barbatus|2677          ------------------------------------------------------------
Culex_quinquefasciatus|15641        ------------------------------------------------------------
Bombyx_mori|3274                    ------------------------------------------------------------
Drosophila_persimilis|16405         ------------------------------------------------------------
Drosophila_yakuba|7048              ------------------------------------------------------------
Drosophila_melanogaster|3349        ------------------------------------------------------------
Drosophila_simulans|4567            ------------------------------------------------------------
Drosophila_sechellia|11762          ------------------------------------------------------------
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         ---------------------GTTGAACAACGTCAGCACCAACCACCGATGGCAGTTTGT
Danio_rerio|3280                    ---------------------AAC------AGAACCAAGCTG------TCTTCATTCTGC
Xenopus_tropicalis|17501            ---------------------AAA------AAAAAGCGCCTG------ATTTCCCTGTGT
Branchiostoma_floridae|41009        ---------------------AAA------AAAAATCGCCGT------AATGCCATGTGT
Tarsius_syrichta|14472              ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Erinaceus_europaeus|8777            ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Gorilla_gorilla|31558               ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Gallus_gallus|22550                 ---------------------AAA------AGTGGTGGAATT------CCTTCCCTATGT
Fugu_rubripes|7786                  ---------------------AAA------AAGAAGCGGCTG------GTATCTCTGTGC
Rhesus_macaque|32038                GGGAGACATGGGAGATCCACCAAAAATTCAGAAAAACGTCTG------ATTTCCCTATGT
Otolemur_garnettii|13561            ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Felis_catus|42581                   ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Microcebus_murinus|2006             ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Macropus_eugenii|9432               ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Tupaia_belangeri|2263               ---------------------------------AAACGTCTG------ATTTCCCTATGT
Canis_familiaris|21922              GGGAGACATGGGAGATCCACCAAAAATTCAGAAAAACGTCTG------ATTTCCCTATGT
Monodelphis_domestica|13648         AGACATGGGAGATCCACCAAAAAC------GAAAAACGTCTG------ATTTCCCTATGT
Gasterosteus_aculeatus|19757        ---------------------AAA------AAAAAGCGGCTG------ATATCTCTGTGC
Callithrix_jacchus|44206            ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Ornithorhynchus_anatinus|25838      ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Danio_rerio|26298                   ---------------------AAA------AAAAAGCGTCTA------ATCTCGTTGTGT
Anolis_carolinensis|1277            ---------------------AAA------AAGAAGCGGCTG------ATCTCCCTCTGC
Sorex_araneus|14424                 ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Pteropus_vampyrus|9384              ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Taeniopygia_guttata|18817           ---------------------AAA------AaaaaacgTCTG------ATTTCCCTATGT
Pongo_abelii|22055                  ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Ochotona_princeps|513               ---------------------AAA------AAAAAGCGTCTG------ATTTCCCTATGT
Dipodomys_ordii|15885               ---------------------AAA------AAAAAACGTCTG------ATTTCCTTATGT
Procavia_capensis|12972             ---------------------AAA------AAAAAACGTCTG------ATTTCCCTGTGT
Equus_caballus|14099                ---------------------AAA------AAAAAACGTCTG------ATTTCCTTATGT
Dasypus_novemcinctus|4895           ---------------------AAA------AAAAAACGTCTG------ATTTCCTTATGT
Bos_taurus|12652                    ---------------------AAA------AAAAAACGTCTG------ATTTCCCTGTGT
Sus_scrofa|7945                     ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Oryctolagus_cuniculus|2869          ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Choloepus_hoffmanni|12539           ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Cavia_porcellus|12331               ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Echinops_telfairi|13551             ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Loxodonta_africana|24792            ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Mus_musculus|11820                  ---------------------AAA------AAAAAACGTCTG------ATTTCCCTGTGT
Pan_troglodytes|29600               ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Rattus_norvegicus|17976             ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Spermophilus_tridecemlineatus|13317 ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Tursiops_truncatus|5249             ---------------------AAA------AAAAAACGTCTG------ATTTCCCTATGT
Ornithorhynchus_anatinus|28681      ------------------------------------------------ATTGCCATGTGT
Macropus_eugenii|7357               ---------------------AAG------AAAAAGCCCGGG------ATTGCCATGTGT
Xenopus_tropicalis|705              ---------------------AAA------AAGAAGGCCGGC------CTGGCCGTGTGT
Oryzias_latipes|15600               ------------------------------AAAAGTAAGTAC------GCGGCTCTGTgc
Felis_catus|40996                   ---------------------AAG------ANNNNNNNNNNN------NNNNNNNNNNNN
Callithrix_jacchus|46809            ---------------------AAG------AAGAAGCCCGGG------ACTGCCATGTGC
Microcebus_murinus|9605             ---------------------AAG------ANNNNNNNNNNN------NNNNNNNNNNNN
Danio_rerio|29046                   ---------------------AAA------AAGAAGTCCGGA------CTTGCGATGTGC
Oryzias_latipes|18527               ---------------------AAG------AAGAAGTCAGGA------ATCGCAATGTGT
Gasterosteus_aculeatus|2399         ---------------------AAA------AAGAAGTCAGGA------TTCGCAATGTGC
Tetraodon_nigroviridis|13830        ---------------------AAA------AAGAAGCAAGGA------TTCGCCATGTGT
Fugu_rubripes|30053                 ---------------------AAA------AAGAAGCAAGGA------TTCGCCATGTGT
Tetraodon_nigroviridis|4572         ---------------------AAA------AAGAAGTCAGGA------ATTGCGATGTGC
Fugu_rubripes|1098                  ---------------------AAA------AAGAAGTCAGGA------ATTGCGATGTGC
Gasterosteus_aculeatus|22884        ------------------------------------------------------ATGTGT
Danio_rerio|20797                   ---------------------AAA------AAGAAGTCTGGA------ATCGCCATGTGT
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            ---------------------AAG------AAAAAGCCCGGG------ATTGCCATGTGT
Echinops_telfairi|972               ---------------------AAG------AAGAAGCCCGGG------ACGGCCATGTGC
Gorilla_gorilla|16948               ---------------------AAG------AAGAAGCCCGGG------ACGGCCATGTGC
Cavia_porcellus|24856               ---------------------AAG------AAGAAGCCCGGG------ACGGCTATGTGC
Pteropus_vampyrus|10382             ---------------------AAG------AAGAAGCCGGGC------ACCGCCACGTGC
Tupaia_belangeri|12837              ---------------------AAG------AAGAAGCCCGGG------ACCGCCATGTGC
Otolemur_garnettii|2070             ---------------------AAG------ANNNNNNNNNNN------NNNNNNNNNNNN
Ochotona_princeps|15487             ---------------------AAG------AAGAAGCCCGGG------ACGGCCATGTGC
Mus_musculus|44064                  ---------------------AAG------AAGAAGCCCGGG------ACGGCCATGTGC
Rattus_norvegicus|33962             ---------------------AAG------AAGAAGCCCGGG------ACGGCCATGTGC
Procavia_capensis|16748             ---------------------AAG------AAGAAGCCCGGG------ACGGCCATGTGC
Oryctolagus_cuniculus|21892         ---------------------AAG------AAGAAGCCCGGG------ACGGCCATGTGC
Equus_caballus|1290                 ---------------------AAG------AAGAAGCCCGGG------ACCGCCATGTGC
Homo_sapiens|29496                  ---------------------AAG------AAGAAGCCCGGG------ACGGCCATGTGC
Pongo_abelii|9734                   ---------------------AAG------AAGAAGCCCGGG------ACGGCCATGTGC
Pan_troglodytes|13247               ---------------------AAG------AAGAAGCCCGGG------ACGGCCATGTGC
Rhesus_macaque|34621                ---------------------AAG------AAGAAGCCCGGG------ACGGCCATGTGC
Bos_taurus|13136                    ---------------------AAG------AAGAAGCCCGGG------ACGGCCATGTGC
Spermophilus_tridecemlineatus|5969  ---------------------------------AAGCCCGGG------ACCGCCATGTGC
Dasypus_novemcinctus|10026          ---------------------------------AAGCCCGGG------ACCGCCATGTGC
Choloepus_hoffmanni|1405            ------------------------------------------------------------
Tursiops_truncatus|10256            ---------------------AAG------------------------------------
Nematostella_vectensis|12483        ---------------------GCA------GAGAAGCGGCGT------GTGTCCATGTGT
Pogonomyrmex_barbatus|2673          ---------------------GAA------CTTGTCGGCAGA------AGTTCGCTCTGC
Daphnia_pulex|19417                 ---------------------------------------------------------TGC
Ixodes_scapularis|17836             ------------------------------CGCGGGAGCTCGCTGTCTCGGCGCGTCTGC
Pediculus_humanus|2973              ---------------------ATGTTGCAAAAAAAAAGGCGG------CTGAGTCTGTGT
Nasonia_vitripennis|9293            ---------------------TCT------CAGAAGAGCAGA------AGTTCGCTGTGC
Apis_mellifera|33486                ------------------------------TTACAAAGCACA------AGTTCGCATTGC
Linepithema_humile|6941             ---------------------AAAGAATGCAAAGAAAGCAGA------AGTTCGCTCTGT
Pogonomyrmex_barbatus|2677          ------------------------------GGATCACACAAG------------------
Culex_quinquefasciatus|15641        ---------------------TTGTCAAGAGAAAAGGAACGC------CTCTCTCTGTGC
Bombyx_mori|3274                    ------------------------------AAGCTCCGGCTC---------TCGTTGTGC
Drosophila_persimilis|16405         ---------------------GATGTGATAAAAAAACAACGT------TTATCGCATTGC
Drosophila_yakuba|7048              ---------------------GATGTGATAAAAAAACAACGA------CTATCTCACTGC
Drosophila_melanogaster|3349        ---------------------GATGTGATAAAAAAACAACGC------CTATCTCACTGC
Drosophila_simulans|4567            ---------------------GATGTGATAAAAAAACAACGC------CTATCTCACTGC
Drosophila_sechellia|11762          ---------------------GATGTGATAAAAAAACAACGC------CTATCTCACTGC
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         ---------GCCGGCTGTCGATTGGAAATATCAGATCGGTACTTCCTCAGGGTCAATCCC
Danio_rerio|3280                    ---------GTGGGTTGTGGGCTTGAGATCCTGGACCGCTTCATTTTGCGCGTTTCCCCT
Xenopus_tropicalis|17501            ---------GTTGGATGCGGGAATCAGATCCACGACCAATATATACTGAGGGTTTCCCCG
Branchiostoma_floridae|41009        ---------GTGGGATGCGGGTCGCACATCCACGACCAGTACATCCTACGGGTGGCGCCC
Tarsius_syrichta|14472              ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Erinaceus_europaeus|8777            ---------GTTGGTTGTGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCGCCG
Gorilla_gorilla|31558               ---------GTTGGTTGCGGCAATCAGATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Gallus_gallus|22550                 ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Fugu_rubripes|7786                  ---------GTCGGCTGTGGGAACCAGATCCACGACCAGTACATCCTTCGGGTCTCACCA
Rhesus_macaque|32038                ---------GTTGGTTGCGGCAATCAGATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Otolemur_garnettii|13561            ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTAAGGGTTTCTCCG
Felis_catus|42581                   ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Microcebus_murinus|2006             ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTAAGGGTTTCTCCG
Macropus_eugenii|9432               ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Tupaia_belangeri|2263               ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Canis_familiaris|21922              ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Monodelphis_domestica|13648         ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Gasterosteus_aculeatus|19757        ---------GTGGGCTGCGGGAACCAGATCCACGACCAGTACATCCTGCGGGTCTCCCCG
Callithrix_jacchus|44206            ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Ornithorhynchus_anatinus|25838      ---------GTTGGTTGCGGCAATCAGATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Danio_rerio|26298                   ---------GTCGGCTGTGGGAATCAAATCCATGACCAGTATATTCTGCGCGTGTCGCCG
Anolis_carolinensis|1277            ---------GTGGGCTGCGGGAACCAGATCCACGACCAGTATATCCTGCGGGTTTCCCCG
Sorex_araneus|14424                 ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCGCCG
Pteropus_vampyrus|9384              ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Taeniopygia_guttata|18817           ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Pongo_abelii|22055                  ---------GTTGGTTGCGGCAATCAGATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Ochotona_princeps|513               ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Dipodomys_ordii|15885               ---------GTTGGTTGCGGCAATCAGATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Procavia_capensis|12972             ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Equus_caballus|14099                ---------GTTGGTTGCGGCAATCAGATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Dasypus_novemcinctus|4895           ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTAAGGGTTTCTCCG
Bos_taurus|12652                    ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Sus_scrofa|7945                     ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Oryctolagus_cuniculus|2869          ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Choloepus_hoffmanni|12539           ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Cavia_porcellus|12331               ---------GTTGGTTGCGGCAATCAAATTCATGATCAGTATATTCTAAGGGTTTCTCCG
Echinops_telfairi|13551             ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTAAGGGTTTCTCCA
Loxodonta_africana|24792            ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Mus_musculus|11820                  ---------GTTGGTTGCGGCAATCAAATTCACGACCAGTATATTCTGAGGGTTTCTCCG
Pan_troglodytes|29600               ---------GTTGGTTGCGGCAATCAGATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Rattus_norvegicus|17976             ---------GTTGGTTGCGGTAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Spermophilus_tridecemlineatus|13317 ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Tursiops_truncatus|5249             ---------GTTGGTTGCGGCAATCAAATTCACGATCAGTATATTCTGAGGGTTTCTCCG
Ornithorhynchus_anatinus|28681      ---------GTAGGCTGTGGGAGTCAAATCCATGACCAGTATATCCTGAAGGTCTCCCCG
Macropus_eugenii|7357               ---------GTCGGCTGTGGGAGTCAGATCCATGACCAGTACATCCTCAAGGTCTCTCCG
Xenopus_tropicalis|705              ---------GTGGGCTGTGGGAGCCACATCCTCGATCAGTACATCCTGAGAGTGTCCCCA
Oryzias_latipes|15600               gccacagcagcagcagcggcggcggtTCTCCGTGACGCATcgatttttaacaaatatttt
Felis_catus|40996                   ---------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Callithrix_jacchus|46809            ---------GTGGGCTGCGGGAGTCAGATCCACGACCAGTTTATCCTGCGGGTGTCGCCC
Microcebus_murinus|9605             ---------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Danio_rerio|29046                   ---------GTTGGCTGCGGCAGTCAGATCCACGACCAGTACATCCTGCGCGTCTCCCCC
Oryzias_latipes|18527               ---------GTGGGCTGTGGAAGTCAAATACACGACCAGTACATCCTGAGAGTGTCCCCG
Gasterosteus_aculeatus|2399         ---------GTAGGATGTGGAAGTCAGATTCATGACCAGTACATACTGAGAGTCTCCCCC
Tetraodon_nigroviridis|13830        ---------GTAGGATGTGGAAGCCAGATCCATGACCAGTACATACTGAGAGTCTCCCCG
Fugu_rubripes|30053                 ---------GTAGGATGTGGAAGCCAGATCCATGACCAGTATATACTGAAAGTCTCTCCG
Tetraodon_nigroviridis|4572         ---------GTGGGCTGCGGAAGTCAGATACACGACCAGTACATCATGAGAGTATCCCCG
Fugu_rubripes|1098                  ---------GTGGGCTGCGGAAGTCAGATACACGACCAGTACATCATGAGAGTGTCCCCG
Gasterosteus_aculeatus|22884        ---------GTGGGCTGTGGAAGTCAGATACACGACCAGTACATCCTGAGAGTCTCCCCG
Danio_rerio|20797                   ---------GTCGGCTGTGGAAGTCAGATCCATGATCAGTACATACTGCGGGTGTCCCCG
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            ---------GTCGGCTGTGGGAGTCAGATCCACGACCAATACATCCTCAAGGTCTCTCCG
Echinops_telfairi|972               ---------GTGGGCTGCGGGAGTCAGATCCACGACCAGTTTATCCTGCGGGTGTCGCCC
Gorilla_gorilla|16948               ---------GTGGGCTGCGGGAGTCAGATCCACGACCAGTTTATCCTGCGGGTGTCGCCC
Cavia_porcellus|24856               ---------GTGGGCTGCGGGAGTCAAATCCACGACCAGTTCATCCTGCGCGTGTCGCCC
Pteropus_vampyrus|10382             ---------GTGGGCTGCGGGAGTCAGATCCACGACCAGTTCATCCTGCGGGTGTCCCCG
Tupaia_belangeri|12837              ---------GTGGGCTGCGGGAGTCAGATCCACGACCAGTTCATGCTGCGGGTGTCGCCC
Otolemur_garnettii|2070             ---------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|15487             ---------GTGGGCTGCGGGAGTCAGATCCACGACCAGTTTATCCTGCGGGTCTCGCCC
Mus_musculus|44064                  ---------GTGGGCTGCGGGAGTCAGATCCACGACCAGTTTATCCTTCGCGTGTCGCCC
Rattus_norvegicus|33962             ---------GTGGGCTGCGGGAGTCAGATCCACGACCAGTTTATCCTTCGGGTGTCGCCC
Procavia_capensis|16748             ---------GTGGGCTGCGGGAGTCAGATCCACGACCAGTTTATCCTGCGGGTGTCGCCC
Oryctolagus_cuniculus|21892         ---------GTGGGTTGCGGGAGTCAGATCCACGACCAGTTCATCCTGCGGGTGTCGCCC
Equus_caballus|1290                 ---------GTGGGCTGCGGGAGTCAGATCCACGACCAGTTTATCCTGCGAGTGTCGCCC
Homo_sapiens|29496                  ---------GTGGGCTGCGGGAGTCAGATCCACGACCAGTTTATCCTGCGGGTGTCGCCC
Pongo_abelii|9734                   ---------GTGGGCTGCGGGAGTCAGATCCACGACCAGTTTATCCTGCGGGTGTCGCCC
Pan_troglodytes|13247               ---------GTGGGCTGCGGGAGTCAGATCCACGACCAGTTTATCCTGCGGGTGTCGCCC
Rhesus_macaque|34621                ---------GTGGGCTGCGGGAGTCAGATCCACGACCAGTTTATCCTGCGGGTGTCGCCC
Bos_taurus|13136                    ---------GTGGGCTGCGGGAGTCAGATCCACGATCAGTTTATCCTGCGGGTGTCGCCA
Spermophilus_tridecemlineatus|5969  ---------GTGGGCTGCGGGAGTCAGATCCACGACCAGTTTATCCTTCGGGTGTCGCCC
Dasypus_novemcinctus|10026          ---------GTGGGCTGCGGGAGTCAGATCCACGACCAGTTTATCCTGCGGGTGTCGCCC
Choloepus_hoffmanni|1405            ------------------------------------------------------------
Tursiops_truncatus|10256            ------------------------------------------------------------
Nematostella_vectensis|12483        ---------GTCGGCTGTGGATCTCAAATTCACGATCAGTACATCTTGAGGGTCGCGCCA
Pogonomyrmex_barbatus|2673          ---------GTTGGCTGCGGTAGTCGAATTCACGATCAATGGATTTTGAGGGTAGCGCCT
Daphnia_pulex|19417                 ---------GTGGGCTGCGGGTCGCCAATCCAGGACCAGTACATCCTGCGGGTGGCGCCC
Ixodes_scapularis|17836             ---------GTGGGCTGCGGTGCCCCGATCCGGGACCAGTACATCCTCCGCGTGGCCCCG
Pediculus_humanus|2973              ---------GTTGGATGTGGGGCTCAAATTCACGATCAATACATATTAAGGGTGGCACCA
Nasonia_vitripennis|9293            ---------GTCGGTTGCGGCGGTCGTATCCACGACCAGTGGATCTTGAGGGTAGCCCCG
Apis_mellifera|33486                ---------GTAGGATGTGGTGGTCGAATTCATGATCAATGGATTTTGCGAGTTGCACCG
Linepithema_humile|6941             ---------GTTGGCTGCGGCAGTCGGATTCATGACCAGTGGATTTTAAGGGTAGCACCT
Pogonomyrmex_barbatus|2677          ---------GCGGGCGTCGGTGGC------------------------------------
Culex_quinquefasciatus|15641        ---------GTCGGCTGCGGCACCCAGATCCACGACCAATACATCCTGCGGGTAGCGCCG
Bombyx_mori|3274                    ---------GTCGGCTGCGGAGGTCAGATCCACGACCAGTACATCCTCCGGGTGGCCCCT
Drosophila_persimilis|16405         ---------GTTGGCTGTGGCGGCCAGATCCACGATCAGTATATATTGCGCGTGGCACCC
Drosophila_yakuba|7048              ---------GTCGGCTGTGGCGGCCAGATCCACGACCAGTACATCTTGCGAGTTGCCCCC
Drosophila_melanogaster|3349        ---------GTCGGATGTGGCGGCCAGATCCACGATCAGTACATCTTGCGCGTTGCCCCC
Drosophila_simulans|4567            ---------GTCGGCTGTGGCGGCCAGATCCACGACCAGTACATCTTGCGCGTTGCCCCC
Drosophila_sechellia|11762          ---------GTCGGCTGTGGCGGCCAGATCCACGACCAGTACATCTTGCGCGTTGCCCCC
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         AATCTGGAATTTCACGCTCAATGTCTAAAATGTGTCCAATGCTCTCGCCCACTCGACGAA
Danio_rerio|3280                    GATCTGGAGTGGCACGCGCGGTGTCTGAAGTGCGCGGAGTGCCATCAGTTTCTGGACGAG
Xenopus_tropicalis|17501            GACCTGGAGTGGCATGCAGCCTGCCTGAAGTGCGCAGAGTGTAGCCAGTACCTGGATGAG
Branchiostoma_floridae|41009        GACCTGGAGTGGCACGCCGCCTGCCTCAAGTGCTCCGACTGCAACCAATACCTAGACGAA
Tarsius_syrichta|14472              GATTTGGAATGGCATGCCGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAA
Erinaceus_europaeus|8777            GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCAGAGTGTAATCAGTATTTGGATGAG
Gorilla_gorilla|31558               GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Gallus_gallus|22550                 GATTTGGAATGGCATGCGGCGTGTTTGAAGTGTGCAGAGTGTAATCAGTATTTGGACGAG
Fugu_rubripes|7786                  GACCTGGAATGGCACGCCGCCTGTCTCAAATGTGCCGAGTGCAGTCAGTACCTGGACGAG
Rhesus_macaque|32038                GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Otolemur_garnettii|13561            GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGATGAG
Felis_catus|42581                   GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCAGAGTGTAATCAGTATTTGGACGAG
Microcebus_murinus|2006             GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGATGAG
Macropus_eugenii|9432               GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Tupaia_belangeri|2263               GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Canis_familiaris|21922              GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Monodelphis_domestica|13648         GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Gasterosteus_aculeatus|19757        GACCTGGAGTGGCACGCCGCCTGCCTCAAATGCGCCGAGTGCAGCCAGTACCTGGACGAG
Callithrix_jacchus|44206            GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Ornithorhynchus_anatinus|25838      GATTTGGAATGGCATGCGGCGTGTTTGAAATGTGCCGAGTGTAACCAGTATCTGGACGAG
Danio_rerio|26298                   GATCTGGAGTGGCACGCGGCGTGTTTGAAATGTGCAGAATGTAACCAGTATCTGGACGAG
Anolis_carolinensis|1277            GACCTGGAATGGCACGCGGCGTGCTTGAAGTGCGCGGAATGTAACCAGTATTTGGACGAG
Sorex_araneus|14424                 GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCAGAGTGTAATCAGTATTTGGACGAG
Pteropus_vampyrus|9384              GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Taeniopygia_guttata|18817           GATTTGGAATGGCATGCGGCGTGTTTGAAGTGTGCAGAGTGTAATCAGTATTTGGACGAG
Pongo_abelii|22055                  GATTTGGAATGGCATGCGGCATGTTTGAAATGTGGGGAGTGTAATCAGTATTTGGACGAG
Ochotona_princeps|513               GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCAGAGTGTAATCAGTATTTGGACGAG
Dipodomys_ordii|15885               GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Procavia_capensis|12972             GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Equus_caballus|14099                GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Dasypus_novemcinctus|4895           GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Bos_taurus|12652                    GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Sus_scrofa|7945                     GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Oryctolagus_cuniculus|2869          GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Choloepus_hoffmanni|12539           GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCAGAGTGTAATCAGTATTTGGACGAG
Cavia_porcellus|12331               GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Echinops_telfairi|13551             GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Loxodonta_africana|24792            GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Mus_musculus|11820                  GATTTGGAGTGGCATGCAGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAA
Pan_troglodytes|29600               GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Rattus_norvegicus|17976             GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAA
Spermophilus_tridecemlineatus|13317 GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCAGAGTGTAATCAGTATTTGGACGAG
Tursiops_truncatus|5249             GATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGAGTGTAATCAGTATTTGGACGAG
Ornithorhynchus_anatinus|28681      GACCTCGAGTGGCATGCAGCCTGCCTCAAATGCGCTGAATGCAGCCAGTACCTGGATGAG
Macropus_eugenii|7357               GACCTCGAGTGGCATGCAGCCTGCCTCAAGTGTGCTGAATGCAGCCAGTACTTGGACGAA
Xenopus_tropicalis|705              GACCTGGAGTGGCACGCAGCTTGCCTCAAGTGCGCCGAGTGCAGTCAGTACCTGGATGAA
Oryzias_latipes|15600               tccacGGCTTTTGGATCCGCTTTGATAACATTTAAGTTGTGCTTCGTCCAT---GCCGCC
Felis_catus|40996                   NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Callithrix_jacchus|46809            GACCTCGAGTGGCACGCCGCCTGCCTCAAGTGCGCCGAGTGCAGCCAGTACCTGGACGAG
Microcebus_murinus|9605             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Danio_rerio|29046                   GACCTGGAGTGGCACGCAGCCTGTTTAAAATGTGTGGAGTGCAACCAATACCTGGACGAG
Oryzias_latipes|18527               GACCTGGAGTGGCATGCGGCTTGTCTCAAGTGTGCAGAGTGCAACCAGTATCTGGATGAG
Gasterosteus_aculeatus|2399         GACCTGGAATGGCACGCAGCCTGCCTGAAGTGTGCAGAGTGCAGCCAGTACCTGGATGAG
Tetraodon_nigroviridis|13830        GACCTGGAGTGGCACGCAGCCTGCCTGAAGTGCGCGGAGTGCAGCCAGTACCTGGACGAG
Fugu_rubripes|30053                 GACCTGGAGTGGCACGCAGCCTGCCTGAAGTGCGCGGAGTGCAGCCAGTACCTGGACGAG
Tetraodon_nigroviridis|4572         GACCTGGAGTGGCATGCAGCCTGCCTCAAGTGTGCAGAGTGCAGCCAGTATCTGGACGAG
Fugu_rubripes|1098                  GACCTGGAGTGGCATGCAGCCTGCCTCAAGTGTGCAGAGTGCAGCCAGTATCTGGACGAG
Gasterosteus_aculeatus|22884        GACCTGGAATGGCACGCAGCCTGCCTCAAGTGTGCAGAGTGCAGCCAGTACCTGGACGAG
Danio_rerio|20797                   GACCTGGAGTGGCACGCAGCCTGTCTGAAGTGCGCAGAATGCAGTCAGTACCTGGATGAG
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            GACCTCGAGTGGCACGCAGCCTGCCTCAAGTGCGCCGAATGCAGCCAGTACTTGGACGAA
Echinops_telfairi|972               GACCTCGAGTGGCATGCCGCCTGCCTCAAGTGCGCCGAGTGCAGCCAGTACCTGGACGAG
Gorilla_gorilla|16948               GACCTCGAGTGGCACGCGGCCTGCCTCAAGTGTGCCGAGTGCAGCCAGTACCTGGACGAG
Cavia_porcellus|24856               GACCTCGAGTGGCACGCTGCCTGCCTCAAGTGTGCTGAGTGCAGCCAGTACCTGGACGAG
Pteropus_vampyrus|10382             GACCTCGAGTGGCACGCCGCCTGCCTCAAGTGTGCCGAGTGCAGCCAGTACCTGGATGAG
Tupaia_belangeri|12837              GACCTCGAAAGGCACGCCGCCTGCCTCAAGTGCGCCGAGTGCAGCCAGTACCTGGACGAG
Otolemur_garnettii|2070             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|15487             GACCTCGAGTGGCATGCAGCCTGCCTCAAGTGCGCCGAGTGCAGCCAGTACCTGGATGAG
Mus_musculus|44064                  GACCTCGAGTGGCACGCCGCCTGCCTCAAGTGCGCGGAGTGCAGCCAGTACCTGGACGAG
Rattus_norvegicus|33962             GACCTCGAGTGGCACGCCGCCTGCCTCAAGTGCGCTGAGTGCAGCCAGTATCTGGATGAG
Procavia_capensis|16748             GACCTCGAGTGGCACGCAGCCTGCCTCAAGTGCGCCGAGTGCAGCCAGTACCTGGACGAG
Oryctolagus_cuniculus|21892         GACCTGGAGTGGCACGCAGCCTGCCTCAAGTGCGCCGAGTGCAGCCAGTACCTGGATGAG
Equus_caballus|1290                 GACCTCGAGTGGCACGCCGCCTGCCTCAAGTGCGCCGAGTGCAGCCAGTACCTGGACGAG
Homo_sapiens|29496                  GACCTCGAGTGGCACGCGGCCTGCCTCAAGTGTGCCGAGTGCAGCCAGTACCTGGACGAG
Pongo_abelii|9734                   GACCTCGAGTGGCACGCGGCCTGCCTCAAGTGTGCCGAGTGCAGCCAGTACCTGGACGAG
Pan_troglodytes|13247               GACCTCGAGTGGCACGCGGCCTGCCTCAAGTGTGCCGAGTGCAGCCAGTACCTGGACGAG
Rhesus_macaque|34621                GACCTCGAGTGGCACGCCGCCTGCCTCAAGTGCGCCGAGTGCAGCCAGTACCTGGACGAG
Bos_taurus|13136                    GACCTCGAGTGGCACGCCGCCTGCCTCAAGTGCGCCGAGTGCAGCCAGTACCTGGACGAG
Spermophilus_tridecemlineatus|5969  GACCTCGAGTGGCATGCCGCCTGCCTCAAGTGCGCCGAGTGCAGCCAGTACCTAGATGAG
Dasypus_novemcinctus|10026          GACCTCGAGTGGCACGCCGCCTGCCTCAAGTGCGCCGAGTGCAGCCAGTACCTGGACGAG
Choloepus_hoffmanni|1405            ------------------------------------------------------------
Tursiops_truncatus|10256            ---------------------------AAGTGCGTCGATGTCATCCAGTACTCGAACGAG
Nematostella_vectensis|12483        GACCTTGAGTGGCATGCAAGTTGTCTAAAGTGTGCGGACTGTCATATGTATCTCGACGAG
Pogonomyrmex_barbatus|2673          AATCTGGAATGGCATGCGGCATGTTTAAAGTGTGCCGAGTGTCAACAGTTTCTGGACGAG
Daphnia_pulex|19417                 GACCTGGAGTGGCACGCCTCCTGCCTCAAGTGCGTCGAGTGCGGCATCTTCCTGGACGAG
Ixodes_scapularis|17836             GACCTGGAGTGGCACGCCGCCTGCCTCAAGTGCGCCGACTGCCAGCAGTTCCTCGACGAG
Pediculus_humanus|2973              GATCTCGAATGGCATGCGGCCTGTTTAAAATGTGCCGAATGCCATCAATTTCTTGACGAA
Nasonia_vitripennis|9293            GACCTCGAGTGGCACGCAGCCTGCCTAAAATGCGCCGCCTGTCAGCAGTTCCTCGACGAG
Apis_mellifera|33486                AATCTGGAATGGCACGCTGCTTGTTTGAAATGTGCAGAATGCCAGCAATTTTTGGATGAG
Linepithema_humile|6941             AATCTTGAATGGCATGCGGCATGTTTAAAGTGTGCCGAATGTCAACAGTTCTTGGACGAA
Pogonomyrmex_barbatus|2677          ------------------------------------------------------------
Culex_quinquefasciatus|15641        GACCTGGAGTGGCACGCGGCCTGCCTCAAGTGCCAGGAGTGCCACCAGTTCCTGGACGAG
Bombyx_mori|3274                    GACTTGGAGTGGCACGCGGCCTGCCTAAAGTGTCAGGAATGCCGGCAGTTCCTCGACGAA
Drosophila_persimilis|16405         GATCTGGAGTGGCATGCGGCGTGCTTGAAGTGCCAGGAATGCAGGCAGTTTCTGGACGAA
Drosophila_yakuba|7048              GATCTGGAGTGGCATGCGGCGTGTCTGAAGTGCCAGGAGTGCAGGCAGTTCCTGGACGAA
Drosophila_melanogaster|3349        GATCTGGAGTGGCATGCGGCGTGTCTGAAGTGCCAGGAGTGCAGGCAGTTCCTGGACGAA
Drosophila_simulans|4567            GATCTGGAGTGGCATGCGGCGTGTCTGAAGTGCCAGGAGTGCAGGCAGTTCCTGGACGAA
Drosophila_sechellia|11762          GATCTGGAGTGGCATGCGGCGTGTCTGAAGTGCCAGGAGTGCAGGCAGTTCCTGGACGAA
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         AACCAGACAGCATTC---------------GTGAAAAATGGACAAACGTAT---TGCCGG
Danio_rerio|3280                    TCCTGCACCTGCTTC---------------ATCAGAGACGGCAAAACCTTC---TGCAGA
Xenopus_tropicalis|17501            ACCTGCACTTGCTTT---------------GTCAGGGATGGCAAAACCTAC---TGTAAA
Branchiostoma_floridae|41009        ACCTGCACTTGCTTT---------------GTGAGGGAAGGGAAAACATAT---TGTAAA
Tarsius_syrichta|14472              AGCTGTACGTGCTTT---------------GTTAGGGATGGGAAAACCTAC---TGTAAA
Erinaceus_europaeus|8777            AGCTGTACGTGCTTT---------------GTTAGAGATGGGAAGACCTAC---TGTAAG
Gorilla_gorilla|31558               AGCTGTACATGCTTT---------------GTTAGGGATGGGAAAACCTAC---TGTAAA
Gallus_gallus|22550                 ACCTGTACGTGCTTT---------------GTTAGAGATGGCAAAACCTAC---TGTAAA
Fugu_rubripes|7786                  TCTTGCACATGCTTT---------------GTTCGGGATGGAAAGACTTAC---TGTAAA
Rhesus_macaque|32038                AGCTGTACATGCTTT---------------GTTAGGGATGGGAAAACCTAC---TGTAAA
Otolemur_garnettii|13561            AGCTGTACGTGCTTT---------------GTTAGGGATGGGAAAACCTAC---TGTAAA
Felis_catus|42581                   AGCTGTACCTGCTTT---------------GTTAGAGATGGGAAAACCTAC---TGTAAA
Microcebus_murinus|2006             AGCTGTACATGCTTT---------------GTTAGGGATGGGAAAACCTAC---TGTAAA
Macropus_eugenii|9432               ACCTGTACATGCTTT---------------GTTAGGGATGGTAAAACCTAC---TGTAAA
Tupaia_belangeri|2263               AGCTGTACGTGCTTT---------------GTTAGGGATGGGAAAACCTAC---TGTAAA
Canis_familiaris|21922              AGCTGTACGTGCTTT---------------GTTAGAGATGGGAAAACCTAC---TGTAAA
Monodelphis_domestica|13648         ACCTGTACATGCTTT---------------GTTAGGGATGGGAAAACCTAC---TGTAAA
Gasterosteus_aculeatus|19757        TCCTGCACGTGCTTC---------------GTCCGGGACGGGAAGACGTAC---TGTAAA
Callithrix_jacchus|44206            AGCTGTACATGCTTT---------------GTTAGGGATGGGAAAACCTAC---TGTAAA
Ornithorhynchus_anatinus|25838      ACCTGTACATGCTTT---------------GTTAGAGATGGTAAAACCTAC---TGTAAA
Danio_rerio|26298                   TCCTGTACATGTTTT---------------GTGCGAGACGGGAAAACTTAC---TGTAAA
Anolis_carolinensis|1277            ACCTGTACCTGCTTT---------------GTTAGGGACGGGAAGACCTAC---TGCAAG
Sorex_araneus|14424                 AGCTGTACGTGCTTT---------------GTTAGAGATGGGAAAACCTAC---TGTAAG
Pteropus_vampyrus|9384              AGCTGTACGTGCTTT---------------GTTAGAGATGGGAAAACCTAC---TGTAAA
Taeniopygia_guttata|18817           ACCTGTACGTGCTTT---------------GTTAGGGATGGCAAAACCTAC---TGTAAA
Pongo_abelii|22055                  AGCTGTACATGCTTT---------------GTTAGGGATGGGAAACCCTAC---TGTAAA
Ochotona_princeps|513               AGCTGTACGTGCTTT---------------GTGAGGGATGGGAAAACCTAC---TGTAAA
Dipodomys_ordii|15885               AGCTGTACGTGCTTT---------------GTTAGGGATGGGAAAACCTAC---TGTAAA
Procavia_capensis|12972             AGCTGTACGTGCTTT---------------GTTAGGGATGGGAAAACCTAC---TGTAAA
Equus_caballus|14099                AGCTGTACGTGCTTT---------------GTTAGAGATGGGAAAACCTAC---TGTAAA
Dasypus_novemcinctus|4895           AGCTGTACGTGCTTT---------------GTTAGGGATGGGAAAACCTAC---TGTAAA
Bos_taurus|12652                    AGCTGTACGTGCTTT---------------GTTAGAGATGGGAAAACCTAC---TGTAAA
Sus_scrofa|7945                     AGCTGTACGTGCTTT---------------GTTAGAGATGGGAAAACCTAC---TGTAAA
Oryctolagus_cuniculus|2869          AGCTGTACGTGCTTT---------------GTTAGGGATGGGAAAACCTAC---TGTAAA
Choloepus_hoffmanni|12539           AGCTGTACGTGCTTT---------------GTTAGGGATGGGAAAACCTAC---TGTAAA
Cavia_porcellus|12331               AGCTGTACGTGCTTT---------------GTTAGGGATGGGAAAACCTAC---TGTAAA
Echinops_telfairi|13551             AGCTGTACTTGCTTT---------------GTTAGGGATGGGAAAACCTAC---TGTAAA
Loxodonta_africana|24792            AGCTGTACGTGCTTT---------------GTTAGGGATGGGAAAACCTAC---TGTAAA
Mus_musculus|11820                  AGCTGTACGTGCTTT---------------GTTAGGGATGGGAAAACCTAC---TGTAAA
Pan_troglodytes|29600               AGCTGTACATGCTTT---------------GTTAGGGATGGGAAAACCTAC---TGTAAA
Rattus_norvegicus|17976             AGCTGTACCTGCTTT---------------GTTAGGGACGGGAAAACCTAC---TGTAAA
Spermophilus_tridecemlineatus|13317 AGCTGTACGTGCTTT---------------GTTAGGGATGGGAAAACCTAC---TGTAAA
Tursiops_truncatus|5249             AGCTGTACGTGCTTT---------------GTTAGAGATGGGAAAACCTAC---TGTAAA
Ornithorhynchus_anatinus|28681      ACCTGCACTTGTTTT---------------GTGAGAGATGGCAAGACATAC---TGTAAA
Macropus_eugenii|7357               ACCTGCACATGTTTT---------------GTGAGAAACGGCAAGACGTAC---TGTAAA
Xenopus_tropicalis|705              AATTGCACTTGTTTT---------------GTGCGGGACGGCAAGACTTAC---TGCAAG
Oryzias_latipes|15600               AACTGTTACGCATTTAGTTTACAGAGAgatctaaaaaaaggaaaaggaaaa---aatgaC
Felis_catus|40996                   NNNNNNNNNNNNNNN---------------NNNNNNNNNNNNNNNNNNNNN---NNNNNN
Callithrix_jacchus|46809            ACGTGCACGTGCTTC---------------GTGAGAGACGGGAAAACATAC---TGCAAG
Microcebus_murinus|9605             NNNNNNNNNNNNNNN---------------NNNNNNNNNNNNNNNNNNNNN---NNNNNN
Danio_rerio|29046                   ACATGCACTTGCTTC---------------GTACGGGACGGGAAAACGTAC---TGCAAG
Oryzias_latipes|18527               ACCTGCACTTGTTTT---------------GTCCGGGACGGAAAAACCTAC---TGTAAA
Gasterosteus_aculeatus|2399         ACCTGCACTTGTTTT---------------GTCCGGGACGGCAAAACTTAT---TGCAAA
Tetraodon_nigroviridis|13830        ACCTGCACATGTTTC---------------GTCCGAGACGGGAAAACCTAC---TGCAAA
Fugu_rubripes|30053                 ACCTGCACATGCTTC---------------GTCCGAGACGGAAAAACCTAC---TGCAAG
Tetraodon_nigroviridis|4572         ACCTGCACTTGCTTC---------------GTCCGAGACGGGAAGACTTAC---TGTAAA
Fugu_rubripes|1098                  ACCTGCACTTGCTTC---------------GTCCGAGACGGGAAAACCTAC---TGTAAA
Gasterosteus_aculeatus|22884        ACCTGCACTTGCTTC---------------GTCCGAGACGGAAAGACGTAT---TGTAAA
Danio_rerio|20797                   ACGTGCACTTGCTTC---------------GTCCGAGACGGCAAGACTTAT---TGCAAG
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            ACCTGCACGTGTTTT---------------GTGAGAAACGGCAAGACGTAC---TGTAAA
Echinops_telfairi|972               ACATGCACGTGCTTC---------------GTGAGAGACGGGAAGACCTAC---TGCAAG
Gorilla_gorilla|16948               ACGTGCACGTGCTTC---------------GTGAGAGACGGGAAGACCTAC---TGCAAG
Cavia_porcellus|24856               ACATGCACGTGCTTC---------------GTGCGAGACGGGAAGACCTAC---TGCAAG
Pteropus_vampyrus|10382             ACGTGCACGTGCTTC---------------GTGAGAGACGGGAAGACCTAC---TGCAAA
Tupaia_belangeri|12837              ACCTGCACGTGCTTC---------------GTGAGAGACGGGAAGACCTACTCAANNNNN
Otolemur_garnettii|2070             NNNNNNNNNNNNNNN---------------NNNNNNNNNNNNNNNNNNNNN---NNNNNN
Ochotona_princeps|15487             ACCTGCACGTGCTTC---------------GTGAGAGACGGGAAGACCTAC---TGCAAA
Mus_musculus|44064                  ACGTGCACGTGCTTC---------------GTGAGAGACGGGAAAACCTAC---TGCAAG
Rattus_norvegicus|33962             ACGTGCACGTGCTTC---------------GTGAGAGACGGGAAAACGTAC---TGCAAG
Procavia_capensis|16748             ACGTGCACGTGCTTC---------------GTGAGAGACGGGAAGACTTAC---TGCAAA
Oryctolagus_cuniculus|21892         ACCTGCACGTGCTTC---------------GTCAGAGACGGGAAGACCTAC---TGCAAG
Equus_caballus|1290                 ACGTGCACGTGCTTC---------------GTGAGAGACGGGAAGACCTAC---TGCAAG
Homo_sapiens|29496                  ACGTGCACGTGCTTC---------------GTGAGAGACGGGAAGACCTAC---TGCAAG
Pongo_abelii|9734                   ACGTGCACGTGCTTC---------------GTGAGAGACGGGAAGACCTAC---TGCAAG
Pan_troglodytes|13247               ACGTGCACGTGCTTC---------------GTGAGAGACGGGAAGACCTAC---TGCAAG
Rhesus_macaque|34621                ACGTGCACGTGCTTC---------------GTGAGAGACGGGAAGACCTAC---TGCAAG
Bos_taurus|13136                    ACGTGCACGTGCTTC---------------GTGAGAGACGGGAAGACCTAC---TGCAAG
Spermophilus_tridecemlineatus|5969  ACGTGCACGTGCTTC---------------GTGAGAGACGGGAAGACCTAC---TGCAAG
Dasypus_novemcinctus|10026          ACGTGCACGTGTTTC---------------GTGAGAGACGGGAAGACCTAC---TGCAAG
Choloepus_hoffmanni|1405            ------------------------------------------------------------
Tursiops_truncatus|10256            ATGCGCACG---TTC---------------GTGAGAGACGGGAAGACCTAC---TGCAAG
Nematostella_vectensis|12483        AAATGTACCTGCTTC---------------GTGCGTGAAGGGAAGACGTAC---TGCAAG
Pogonomyrmex_barbatus|2673          AAATGCACCTGTTTT---------------GTAAGGGATGGCAAAACTTAC---TGCAAG
Daphnia_pulex|19417                 AACTGCACCTGCTTC---------------GTCCGCGACGGCAAGACCTTC---TGCCGC
Ixodes_scapularis|17836             ACGTGCACCTGCTTT---------------GTGCGAGACGGCAAGACCTAC---TGCAAG
Pediculus_humanus|2973              AATTGTACGTGTTTT---------------GTTAGAGATGGTAAAACATAT---TGCAAA
Nasonia_vitripennis|9293            AGCTGCACATGCTTC---------------GTCCGCGACGGCAAGACCTAC---TGCAAG
Apis_mellifera|33486                CACTGCACCTGCTTC---------------GTGCGAGATGGAAAAACTTAT---TGCAAG
Linepithema_humile|6941             AAATGCACCTGTTTC---------------GTGCGAGACGGCAAAACCTAC---TGCAAG
Pogonomyrmex_barbatus|2677          ------------------------------------------------------------
Culex_quinquefasciatus|15641        AGCTGTACCTGCTTC---------------GTGAGGGACGGCAAAACGTAC---TGTAAG
Bombyx_mori|3274                    TCCTGCACGTGCTTC---------------GTTAGAGACGGAAAGACTTAT---TGCAAA
Drosophila_persimilis|16405         AGCTGTACGTGCTTT---------------GTGCGTGACGGCAAAACCTAT---TGCAAG
Drosophila_yakuba|7048              AGCTGTACGTGTTTT---------------GTGCGCGACGGCAAGACCTAC---TGCAAG
Drosophila_melanogaster|3349        AGCTGTACGTGTTTT---------------GTGCGCGATGGCAAGACCTAC---TGCAAG
Drosophila_simulans|4567            AGCTGTACGTGTTTT---------------GTGCGCGATGGCAAGACCTAC---TGCAAG
Drosophila_sechellia|11762          AGCTGTACGTGTTTT---------------GTGCGCGACGGCAAGACCTAC---TGCAAG
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         GATGATTACAGA---AGGTTATTTACAACACGTTGCTCTCGATGCCATGGAGATTTTGAC
Danio_rerio|3280                    GAACACTACAGC---AGATTATCCACCAGCAAGTGTGCAAAATGCGACAAAGCCTTCATA
Xenopus_tropicalis|17501            AGGGACTATATC---------------------------AGGTACAGCAATGGG------
Branchiostoma_floridae|41009        AGGTGCTACGTA---AGGTTATTCGGAACCAAGTGCGCCAAATGCAGCCTAGGTTTCACC
Tarsius_syrichta|14472              AGAGATTATATC---AGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Erinaceus_europaeus|8777            AGAGATTATATC---AGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Gorilla_gorilla|31558               AGAGATTATATC---AGGTTGTACGGGATCAAATGCGCCAAGTGCAGCATCGGCTTCAGC
Gallus_gallus|22550                 AGAGATTATATC---AGAAAAATAAATACACGTGCAAAAATGTATTCTACCGGGTTTGAA
Fugu_rubripes|7786                  CGGGACTACATC---AGGTTATACGGGATCAAATGTGCTAAATGCAACATCGGCTTCAGC
Rhesus_macaque|32038                AGAGATTATATC---AGATTATTTGGTGTGGCTTTGTCTTTTTGTGGTTTGCCTCTGTGG
Otolemur_garnettii|13561            AGAGATTATATC---AGGTTGTACGGGATCAAATGCGCCAAGTGCAGCATCGGCTTCAGC
Felis_catus|42581                   AGGGATTATATC---AGNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGCATCGGCTTCAGC
Microcebus_murinus|2006             AGAGATTATATC---AGGTTGTACGGGATCAAATGCGCCAAGTGCAGCATCGGCTTCAGC
Macropus_eugenii|9432               AGAGATTATATC---AGGTTATACGGGATAAAGTGCGCCAAGTGCAGCATCGGTTTCAGC
Tupaia_belangeri|2263               AGAGATTATATC---AGGTTGTATGGGATCAAATGCGCCAAGTGCAGCATCGGCTTCAGC
Canis_familiaris|21922              AGAGATTATATCAGCAGGTTGTACGGGATCAAATGCGCCAAGTGCAGCATCGGCTTCAGC
Monodelphis_domestica|13648         AGAGATTATATC---AGGTTATACGGGATAAAGTGCGCCAAGTGCAGCATCGGTTTCAGC
Gasterosteus_aculeatus|19757        CGGGACTACATCAGCAGGCTGTACGGCATCAAATGCGCAAAGTGCAACATCGGCTTCAGC
Callithrix_jacchus|44206            AGAGACTATATC---AGGTTGTATGGGATCAAATGCGCCAANNNCAGCATCGGCTTCAGC
Ornithorhynchus_anatinus|25838      AGAGATTATATC---AGGCTATACGGCATCAAGTGCGCCAAGTGCAGCATCGGGTTCAGC
Danio_rerio|26298                   CGGGACTACATC---AGGTTATACGGGATCAAATGTGCAAAATGCAACATCGGTTTCAGC
Anolis_carolinensis|1277            CGGGACTACATC---AGGCTCTACGGCATCAAGTGCGCCAAGTGCAACATCGGCTTCAGC
Sorex_araneus|14424                 AGAGATTATATC---AGGTTGTACGGGAACAAATGCGCCAAGTGCAGCATTGGCTTCATC
Pteropus_vampyrus|9384              AGAGATTATATC---AGGTTGTACGGGATCAAATGCGCCAAGTGCAGCATCGGCTTCAGC
Taeniopygia_guttata|18817           AGAGATTATATC---AGGTTATACGGCATCAAATGCGCCAAATGCAGCATCGGCTTCAGC
Pongo_abelii|22055                  AGAGATTATATC---AGGTTGTACGGGATCAAATGCGCCAAGTGCAGCATCGGCTTCAGC
Ochotona_princeps|513               AGAGATTATATC---AGGTTATACGGGATCAAATGCGCCAAGTGCAGCATTGGCTTCAGC
Dipodomys_ordii|15885               AGAGATTATATC---AGGTTATACGGGATCAAATGTGCAAAGTGCAGCATTGGCTTCAGC
Procavia_capensis|12972             AGAGATTATATC---AGGTTGTATGGGATCAAATGCGCCAAGTGCAGCATCGGCTTCAGC
Equus_caballus|14099                AGAGATTATATC---AGGTTGTACGGGATCAAATGCGCCAAGTGCAGCATCGGCTTCAGC
Dasypus_novemcinctus|4895           AGAGATTATATC---AGGTTGTACGGGATCAAATGCGCCAAATGCAGCATCGGCTTCAGC
Bos_taurus|12652                    AGAGATTATATC---AGGTTGTACGGGATCAAATGCGCCAAGTGCAGCATCGGCTTCAGC
Sus_scrofa|7945                     AGAGATTATATC---AGGTTGTACGGGATCAAATGCGCCAAGTGCAGCATCGGCTTCAGC
Oryctolagus_cuniculus|2869          AGAGATTATATC---AGGTTGTACGGGATCAAATGCGCCAAGTGCAGCATCGGCTTCAGC
Choloepus_hoffmanni|12539           AGAGATTATATC---AGGTTGTACGGGATCAAATGCGCCAAATGCAGCATCGGCTTCAGC
Cavia_porcellus|12331               AGAGACTATATC---AGGTTGTACGGTATCAAATGCGCTAAGTGCAGTATCGGCTTCAGC
Echinops_telfairi|13551             AGAGATTATATC---AGGTTGTACGGGATCAAATGCGCCAAGTGCAGCATCGGTTTCAGC
Loxodonta_africana|24792            AGAGATTATATC---AGGTTGTACGGGATCAAATGCGCTAAGTGCAGCATCGGCTTCAGC
Mus_musculus|11820                  AGAGATTATATC---AGGTTGTACGGGATCAAATGCGCCAAGTGCAGCATAGGCTTCAGC
Pan_troglodytes|29600               AGAGATTATATC---AGGTTGTACGGGATCAAATGCGCCAAGTGCAGCATCGGCTTCAGC
Rattus_norvegicus|17976             AGAGATTATATC---AGGTTGTACGGGATCAAATGCGCCAAGTGCAGCATAGGCTTCAGC
Spermophilus_tridecemlineatus|13317 AGAGATTATATC---AGGTTGTACGGAATCAAATGCGCCAAGTGCAGCATCGGCTTCAGT
Tursiops_truncatus|5249             AGAGATTATATC---AGGTTGTACGGGATCAAATGCGCCAAGTGCAGCATCGGCTTCAGC
Ornithorhynchus_anatinus|28681      AGGGATTATATC---AGA------------------------------------------
Macropus_eugenii|7357               AGGGACTATATC---AGGTTGTTCGGCATCAAGTGTGCCAAATGCAAGGTGGGTTTCAGC
Xenopus_tropicalis|705              AGGGACTATATC---AGGTTATTCAGTGCCAGGTGCCCCCGCTGCCAAGGGACTCTGCCC
Oryzias_latipes|15600               TGTTCTTGCTGC---AGGctttttggaataaaatgtgcaaaatgcaaCCTGGGCTTCAGC
Felis_catus|40996                   NNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Callithrix_jacchus|46809            CGGGACTATGTC---AGGCTGTTCGGCATCAAGTGCGCCAAGTGCCAGGTGGGCTTCAGC
Microcebus_murinus|9605             NNNNNNNNNNNN---NNGCTGTTCGGCATCAAGTGCGCCAAGTGCCAGGTGGGCTTCAGC
Danio_rerio|29046                   AGAGATTATGTA---AGATTGTTCGGTATAAAATGCGCAAAATGCACTTTGGGCTTCAGC
Oryzias_latipes|18527               AGAGATTATGCA---AGGTTGTTTGGTATCAAATGTGCAAAGTGTAACACGGGCTTCTGC
Gasterosteus_aculeatus|2399         AGAGATTATGTA---AGGCTGTTTGGAATAAAATGCGCAAAATGCAACCTGGGATTCAGC
Tetraodon_nigroviridis|13830        AGAGATTATGTA---AGACTCTTTGGAATAAAATGCGCCAAATGCAACCTGGGATTCAGC
Fugu_rubripes|30053                 AGAGATTATGTA---AGACTCTTTGGAATAAAATGCGCCAAATGCAACCTGGGATTCAGC
Tetraodon_nigroviridis|4572         AGAGATTACGCA---AGGATATTTGGCATCAAGTGTGCGAAATGCAACGTGGGCTTCTGC
Fugu_rubripes|1098                  AGAGATTATGCA---AGGTTATTTGGCATCAAATGTGCGAAGTGCAACATGGGCTTCTGC
Gasterosteus_aculeatus|22884        AGAGATTACGCA---AGGTTGTTTGGCATCAAATGTGCAAAGTGTAACATGGGCTTCTGC
Danio_rerio|20797                   AGAGATTACGTA---CGATTATTCGGGATCAAATGCGCCAAATGTAACATCGGTTTCTGC
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            AGGGACTATATC---AGGTTGTTCGGGATCAAGTGTGCCAAATGCAAGGTGGGTTTCAGC
Echinops_telfairi|972               CGCGACTACGTC---AGGCTGTTCGGCATCAAGTGCGCAAAGTGCCAGGTGGGCTTCAGC
Gorilla_gorilla|16948               CGGGACTATGTC---AGGCTGTTCGGCATCAAGTGCGCCAAGTGCCAGGTGGGCTTCAGC
Cavia_porcellus|24856               CGGGACTACGCG---CGGCTCTTCGGCATCAAGTGCGCCAAGTGCCAGGTGGGCTTCAGT
Pteropus_vampyrus|10382             CGGGACTACGTC---AGGCTGTTCGGCATCAAGTGCGCCAAGTGCCAGGTGGGCTTCAGC
Tupaia_belangeri|12837              NNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|2070             NNNNNNNNNNNN---NNGCTGTTCGGCATCAAATGTGCCAAGTGCCAGGTGGGCTTCAGC
Ochotona_princeps|15487             CGTGACTACGTC---AGGCTGTTCGGCATCAAGTGCGCCAAGTGCCAGGTGGGCTTCGGC
Mus_musculus|44064                  CGGGACTACGTC---AGGCTGTTCGGCATCAAGTGTGCCCAGTGCCAGGTGGGCTTCAGC
Rattus_norvegicus|33962             CGGGACTACGTC---AGGCTGTTCGGCATCAAGTGTGCCCAGTGTCAGGTGGGCTTCAGC
Procavia_capensis|16748             CGGGACTACGTC---AGGCTGTTCGGCATCAAGTGCGCTAAGTGCCAGGTGGGCTTCAGC
Oryctolagus_cuniculus|21892         CGGGACTACGTC---AGGCTTTTCGGCATCAAGTGCGCCAAGTGCCAGGTGGGCTTCGGC
Equus_caballus|1290                 CGGGACTACGTC---AGGCTGTTCGGCATCAAGTGCGCCAAGTGCCAGGTGGGCTTCAGC
Homo_sapiens|29496                  CGGGACTATGTC---AGGCTGTTCGGCATCAAGTGCGCCAAGTGCCAGGTGGGCTTCAGC
Pongo_abelii|9734                   CGGGACTATGTC---AGGCTGTTCGGCATCAAGTGCGCCAAGTGCCAGGTGGGCTTCAGC
Pan_troglodytes|13247               CGGGACTATGTC---AGGCTGTTCGGCATCAAGTGCGCCAAGTGCCAGGTGGGCTTCAGC
Rhesus_macaque|34621                CGGGACTATGTG---AGGCTGTTCGGCATCAAGTGCGCCAAGTGCCAGGTGGGCTTCAGC
Bos_taurus|13136                    CGGGACTACGTC---AGGCTCTTCGGCATCAAGTGCGCCAAGTGCCAGGTGGGCTTCAGC
Spermophilus_tridecemlineatus|5969  CGGGACTACGTA---AGGCTGTTCGGCATCAAGTGCGCCAAGTGCCAGGTGGGCTTCAGC
Dasypus_novemcinctus|10026          CGGGACTACGTC---AGGCTGTTCGGCATCAAGTGCGCCAAGTGTCAGGTGGGCTTTAGC
Choloepus_hoffmanni|1405            ------------------------------------------------------------
Tursiops_truncatus|10256            CGGGAGTACGTC---ATGCTCTTCGGCATCAAGTGCGCCAAGTGCCAGGTGGGCTTCAGC
Nematostella_vectensis|12483        CGAGACTACGTA---CGGTTATTCGGGACCAAGTGTGCGAAATGCTCGCTGAACTTCAGC
Pogonomyrmex_barbatus|2673          CGCGATTACGTT---AGT------------------------------------------
Daphnia_pulex|19417                 CGGGATTACGTC---AGGTTGTTTGGTGCCAAGTGCGACAAGTGCGGGCTGGGCTTCAGC
Ixodes_scapularis|17836             CGAGACTACGTC---AGGCTGTTCGGCGCCAAGTGCTCCAAGTGCCAGCAGGGCTTCAGC
Pediculus_humanus|2973              AGAGATTATGTG---AGATTATTCGGGACCAAGTGTGATAAATGCGGGCAAAGTTTTAGT
Nasonia_vitripennis|9293            GACGACTACGTT---AGGTTATTCGGCACCAAGTGCGACAAGTGCAGGCAGTCGTTCAAC
Apis_mellifera|33486                CGAGATTATGTC---AGACTGTTTGGGACAAAATGCGACAAGTGCAGTGAGTGCTTTAGC
Linepithema_humile|6941             CGCGATTACGTG---AGGTTGTTTGGCACGAAATGCGACAAGTGTAGCCAGTGCTTTAGC
Pogonomyrmex_barbatus|2677          ------------------------------------------------------------
Culex_quinquefasciatus|15641        CGAGATTATGTT---AGGTTATTTGGTACCAAATGTGATAAATGCGGCAACTCCTTTAGT
Bombyx_mori|3274                    AGAGATTATACT---AGATTATTCGGCACGAAATGCGACAAATGCGGCGCGTCCTTCAGT
Drosophila_persimilis|16405         CGTGATTATGTT---AGGTTATTTGGTACAAAATGTGATAAATGCGGTAACTCCTTCAGC
Drosophila_yakuba|7048              CGTGATTATGTT---AGGTTATTTGGTACAAAATGTGATAAATGCGGCAACTCCTTCAGC
Drosophila_melanogaster|3349        CGTGATTATGTT---AGGTTATTTGGTACAAAATGTGATAAATGCGGCAACTCCTTCAGC
Drosophila_simulans|4567            CGTGATTATGTT---AGGTTATTTGGTACAAAATGTGATAAATGCGGCAACTCCTTCAGC
Drosophila_sechellia|11762          CGTGATTATGTT---AGGTTATTTGGTACAAAATGTGATAAATGTGGCAACTCCTTCAGC
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         AAAACTGATCTCGTGATGAGGGCTGGACCCCAAAATGTGTTC---CATCTCAACTGCTTT
Danio_rerio|3280                    AGCAAAGAGTTTGTGATGCGTTCT---CAAGTGAATATTTAT---CACATCCAGTGTTTT
Xenopus_tropicalis|17501            ---------------------------------------------CACCTTCGC------
Branchiostoma_floridae|41009        AAGAACGACTTCGTTATGCGCGCG---AGGAACAAGATATAC---CACATAGACTGTTTT
Tarsius_syrichta|14472              NNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNN---NNNNNNNNNNNNNNN
Erinaceus_europaeus|8777            NNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNN---NNNNNNNNNNNNNNN
Gorilla_gorilla|31558               AAGAACGACTTCGTGATGCGTGCC---CGCTCCAAGGTGTAT---CACATCGAGTGTTTC
Gallus_gallus|22550                 AAACTAGAACTTCGAATGACACTG---AGG---------------TACGGACCGTGTTTT
Fugu_rubripes|7786                  AAAAACGACTTCGTGATGCGGGCC---CGCTCCAAAGTCTAC---CACATCGAGTGTTTC
Rhesus_macaque|32038                AGTCATTCCTTTTTAAAATTAGTA---ACTTACAAATTTTTTTGCAAAATATCACTTTTT
Otolemur_garnettii|13561            AAGAACGACTTCGTGATGCGCGCC---CGCTCCAAGGTGTAT---CACATCGAGTGCTTC
Felis_catus|42581                   AAGAACGACTTCGTGATGCGCGCC---CGCTCCAAGGTGTAC---CACATCGAGTGTTTC
Microcebus_murinus|2006             AAGAACGACTTCGTGATGCGTGCC---CGCTCCAAGGTGTAC---CACATCGAGTGTTTC
Macropus_eugenii|9432               AAGAACGATTTTGTGATGCGTGCC---CGCTCCAAGGTGTAC---CACATCGAATGTTTC
Tupaia_belangeri|2263               AAGAATGACTTTGTGATGCGCGCC---CGCTCCAAGGTGTAC---CACATTGAGTGTTTC
Canis_familiaris|21922              AAGAACGACTTCGTGATGCGCGCC---CGCTCCAAGGTGTAC---CACATCGAGTGTTTC
Monodelphis_domestica|13648         AAGAATGATTTTGTGATGCGGGCC---CGCTCCAAGGTGTAC---CACATCGAGTGTTTC
Gasterosteus_aculeatus|19757        AAGAACGACTTCGTGATGCGGGCG---CGCTCCAAGGTCTAC---CACATCGAGTGTTTC
Callithrix_jacchus|44206            AAGAACGACTTCGTGATGCGTGCC---CGCTCCAAGGTGTAT---CACATCGAGTGTTTC
Ornithorhynchus_anatinus|25838      AAGAACGACTTCGTGATGCGCGCC---CGCTCCAAGGTCTAT---CACATCGAGTGTTTC
Danio_rerio|26298                   AAGAATGACTTTGTGATGAGAGCA---CGTTCGAAGGTTTAT---CATATTGAGTGTTTT
Anolis_carolinensis|1277            AAGAACGACTTCGTGATGCGGGCC---CGCTCCAAGGTCTAC---CACATCGAGTGCTTC
Sorex_araneus|14424                 AAAAACCACTTCGTGATGCGCGCC---CGCTCCAAGGTGTAC---CACATCGAGTGTTTC
Pteropus_vampyrus|9384              AAGAACGACTTCGTGATGCGCGCC---CGTTCCAAGGTGTAC---CACATCGAGTGTTTC
Taeniopygia_guttata|18817           AAGAATGACTTCGTGATGCGCGCC---CGCGCCAAGGTGTAC---CACATCGAATGTTTT
Pongo_abelii|22055                  AAGAACGACTTCGTGATGCGTGCC---CGCTCCAAGGTGTAT---CACATCGAGTGTTTC
Ochotona_princeps|513               AAGAATGACTTCGTGATGCGCGCC---CGCTCCAAGGTGTAC---CACATCGAGTGTTTC
Dipodomys_ordii|15885               AAGAACGACTTCGTAATGCGCGCC---CGTTCCAAGGTGTAC---CACATCGAGTGTTTC
Procavia_capensis|12972             AAGAACGACTTCGTGATGCGCGCC---CGCTCCAAGGTGTAC---CACATCGAG---TTC
Equus_caballus|14099                AAGAACGACTTCGTGATGCGCGCC---CGCTCCAAGGTGTAC---CACATCGAGTGTTTC
Dasypus_novemcinctus|4895           AAGAACGACTTCGTGATGCGAGCC---CGTTCCAAGGTGTAC---CACATTGAGTGTTTC
Bos_taurus|12652                    AAAAACGATTTCGTGATGCGCGCG---CGCTCCAAGGTGTAC---CACATCGAGTGTTTC
Sus_scrofa|7945                     AAGAACGACTTCGTGATGCGTGCC---CGCTCCAAGGTGTAC---CACATCGAGTGTTTC
Oryctolagus_cuniculus|2869          AAGAACGACTTCGTGATGCGCGCC---CGCTCCAAGGTGTAC---CACATCGAGTGTTTC
Choloepus_hoffmanni|12539           AAGAACGACTTCGTGATGCGCGCC---CGCTCCAAGGTGTAC---CACATAGAGTGTTTC
Cavia_porcellus|12331               AAGAACGACTTCGTGATGCGTGCC---CGCTCCAAAGTGTAC---CACATCGAGTGTTTC
Echinops_telfairi|13551             AAGAACGACTTCGTGATGCGCGCC---CGCTCCAAGGTGTAT---CACATCGAGTGTTTC
Loxodonta_africana|24792            AAAAACGACTTCGTGATGCGCGCC---CGCTCCAAGGTGTAC---CACATCGAGTGTTTC
Mus_musculus|11820                  AAGAACGACTTCGTGATGCGTGCC---CGCTCTAAGGTGTAC---CACATCGAGTGTTTC
Pan_troglodytes|29600               AAGAATGACTTCGTGATGCGTGCC---CGCTCCAAGGTGTAT---CACATCGAGTGTTTC
Rattus_norvegicus|17976             AAGAACGACTTCGTGATGCGCGCC---CGCTCTAAGGTGTAC---CACATCGAATGTTTC
Spermophilus_tridecemlineatus|13317 AAGAACGACTTCGTGATGCGCGCC---CGCTCCAAGGTGTAC---CACATCGAGTGTTTC
Tursiops_truncatus|5249             AAGAACGACTTCGTGATGCGCGCC---CGCTCCAAGGTGTAC---CACATCGAGTGTTTC
Ornithorhynchus_anatinus|28681      ---------------------------AAACAGTCCGTCAGT---GTAATAAGGAAATAC
Macropus_eugenii|7357               AGCAGCGATCTGGTGATGAGAGCC---CGGGAGAATGTCTAT---CACATCGAGTGTTTC
Xenopus_tropicalis|705              CGCTCTGAGCTGGTGATGAGAGTG---GGGGAGAGGGTGTAT---CACACAGACTGCTTC
Oryzias_latipes|15600               AGCAGCGACTTGGTGATGCGGGCT---CGGGATAACGTGTAT---CACATCGAGTGCTTT
Felis_catus|40996                   NNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNN---NNNNNNNNNNNNNNN
Callithrix_jacchus|46809            AGCAGCGACCTGGTGATGCGGGCG---CGGGACAGCGTGTAC---CACATCGAGTGCTTC
Microcebus_murinus|9605             AGCAGCGACCTGGTGATGCGCGCG---CGGGACAGCGTGTAC---CACATCGAGTGCTTC
Danio_rerio|29046                   AGCAGTGATTTGGTCATGCGAGCT---CGGGACAGTGTGTAT---CACATCGAATGCTTC
Oryzias_latipes|18527               AGCAGTGACCTGGTGATGAGAGCT---CGGGAAAAAGTATAT---CACATGGAGTGCTTT
Gasterosteus_aculeatus|2399         AGCAGCGATTTGGTGATGAGAGCC---CGGGATAACGTGTAC---CACATCGAGTGTTTT
Tetraodon_nigroviridis|13830        AGCAGCGATTTGGTGATGAGAGCC---CGGGATCATGTCTAC---CACATCGAGTGTTTT
Fugu_rubripes|30053                 AGCAGCGATTTGGTGATGAGAGCC---CGGGATCACGTTTAC---CACATCGAGTGTTTT
Tetraodon_nigroviridis|4572         AGCAGCGACCTGGTGATGCGCGCT---CGGGACAACGTCTAT---CACATGGAGTGTTTT
Fugu_rubripes|1098                  AGCAGCGACTTGGTGATGCGCGCC---CGGGACAGTGTCTAT---CACATGGAGTGTTTT
Gasterosteus_aculeatus|22884        AGCAGCGACCTGGTGATGAGAGCT---CGGGACAATGTGTAT---CACGTGGAGTGTTTT
Danio_rerio|20797                   AGCAGTGACCTGGTCATGAGGGCC---CGGGATAACGTCTAC---CACATGGAGTGTTTT
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            AGCAGCGACCTGGTGATGAGAGCC---CGAGAGAACGTCTAC---CACATCGAGTGCTTC
Echinops_telfairi|972               AGCAGCGACCTGGTGATGCGGGCG---CGGGACAGCGTGTAC---CACATCGAGTGCTTC
Gorilla_gorilla|16948               AGCAGCGACCTGGTGATGAGGGCG---CGGGACAGCGTGTAC---CACATCGAGTGCTTC
Cavia_porcellus|24856               AGCAGCGACCTGGTGATGCGCGCA---CGCGACAGCGTGTTC---CACGTGGAATGCTTC
Pteropus_vampyrus|10382             AGCAGCGACCTGGTGATGCGGGCG---CGGGACAGCGTGTAC---CACATCGAGTGCTTC
Tupaia_belangeri|12837              NNNNNNNNNNNNNNNNTGCGGTCG---CCGCAGAACGTATAC---TGCGTCGAGTTGTTC
Otolemur_garnettii|2070             AGCAGCGACTTGGTGATGCGGGCA---CGGGACAGCGTGTAC---CACATCGAATGCTTT
Ochotona_princeps|15487             AGCAGCGACCTGGTAATGCGCGCA---CGGGACAGCGTGTAT---CACATCGAGTGCTTC
Mus_musculus|44064                  AGCAGTGACCTGGTGATGCGGGCG---CGGGACAGCGTGTAC---CACATCGAGTGCTTC
Rattus_norvegicus|33962             AGCAGTGACCTGGTGATGCGGGCG---CGGGACAGCGTGTAC---CACATCGAGTGCTTC
Procavia_capensis|16748             AGCAGTGACCTGGTGATGCGAGCG---CGGGACAGTGTGTAC---CACATCGAGTGCTTC
Oryctolagus_cuniculus|21892         AGCAGCGACCTGGTGATGCGCGCG---CGGGACAGCGTGTAC---CACATCGAGTGCTTC
Equus_caballus|1290                 AGCAGCGATCTGGTGATGAGGGCT---CGGGACAGCGTGTAC---CACATCGAGTGCTTC
Homo_sapiens|29496                  AGCAGCGACCTGGTGATGAGGGCG---CGGGACAGCGTGTAC---CACATCGAGTGCTTC
Pongo_abelii|9734                   AGCAGCGACCTGGTGATGAGGGCG---CGGGACAGCGTGTAC---CACATCGAGTGCTTC
Pan_troglodytes|13247               AGCAGCGACCTGGTGATGAGGGCG---CGGGACAGCGTGTAC---CACATCGAGTGCTTC
Rhesus_macaque|34621                AGCAGCGACCTGGTGATGAGGGCG---CGGGACAGCGTGTAT---CACATCGAGTGCTTC
Bos_taurus|13136                    AGCAGCGATCTGGTGATGCGGGCG---CGGGACAGCGTGTAC---CACATCGAGTGTTTC
Spermophilus_tridecemlineatus|5969  AGCAGCGACCTGGTGATGCGGGCG---CGGGACAGCGTGTAC---CACATAGAGTGCTTC
Dasypus_novemcinctus|10026          AGCAGCGACCTGGTGATGCGGGCA---CGGGACAGCGTGTAC---CACATCGAGTGCTTT
Choloepus_hoffmanni|1405            ------------------------------------------------------------
Tursiops_truncatus|10256            AGCAGCGATCTGGTGATGCGGGCG---CGGGACAGCGTGTAC---CACATCGAGTGTTTC
Nematostella_vectensis|12483        AAGAACGATTTCGTTATGCGAGCG---AGAAATAAAATCTAC---CACATCGATTGCTTT
Pogonomyrmex_barbatus|2673          ---------------------------------------------CACATCGATACTTTC
Daphnia_pulex|19417                 CGCTCCGACTTTGTGATGAGGGCC---AAGAGCAAGATCTAC---CACATCGAGTGCTTC
Ixodes_scapularis|17836             CGCACGGACTTCGTGATGCGGGCC---CGGCAGCACATCTAC---CACCTGGACTGCTTT
Pediculus_humanus|2973              AAAAATGATTTTGTTATGAGAGCA---AAAACAAAAATATAT---CACGTGGATTGTTTT
Nasonia_vitripennis|9293            AAGAACGACTTCGTCATGCGAGCC---AAGACCAAGATCTAC---CACCTGGAGTGTTTC
Apis_mellifera|33486                AAGGATGACTACGTAATGAGGGCA---AGGAGCAAGATTTAT---CACATAAAGTGCTTC
Linepithema_humile|6941             AAAAATGACTATGTGATGAGAGCG---AAAACTAAGATCTAT---CACGTGGAGTGCTTT
Pogonomyrmex_barbatus|2677          ------------------------------------------------------------
Culex_quinquefasciatus|15641        AAAAACGACTTTGTGATGAGGGCG---AAATCGAAAATCTAC---CACATAGAGTGCTTT
Bombyx_mori|3274                    AAAAACGACTTCGTGATGCGTGCC---AAGACGAAGATATAC---CACATAGATTGTTTT
Drosophila_persimilis|16405         AAAAATGATTTTGTGATGCGGGCC---AAAACGAAAATCTTT---CACATTGAGTGTTTT
Drosophila_yakuba|7048              AAAAATGATTTTGTGATGCGGGCC---AAAACGAAAATCTTT---CACATCGAGTGCTTT
Drosophila_melanogaster|3349        AAAAATGATTTTGTGATGCGGGCC---AAAACGAAAATCTTT---CACATCGAGTGCTTT
Drosophila_simulans|4567            AAAAATGATTTTGTGATGCGGGCC---AAAACGAAAATCTTT---CACATCGAGTGCTTT
Drosophila_sechellia|11762          AAAAATGATTTTGTGATGCGGGCC---AAAACGAAAATCTTT---CACATCGAGTGCTTT
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         GCGTGTGTTGCCTGTGAAAAACGATTACAAACTGGAGAAGAGTTTCAG------------
Danio_rerio|3280                    CGATGCGAGGGATGCAATCGTCCATTACTTCCTGGAGATGAGTATGTT------------
Xenopus_tropicalis|17501            ------------------AGATCCTTGTGCCACGGTTCGGCCGCTGCA------------
Branchiostoma_floridae|41009        CGTTGCGTGGCGTGCAGCCGGCAGCTTATTCCCGGGGACGAATTCGCG------------
Tarsius_syrichta|14472              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------
Erinaceus_europaeus|8777            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------
Gorilla_gorilla|31558               CGCTGTGTGGCCTGCAGCCGCCAGCTCATCCCTGGGGACGAATTTGCG------------
Gallus_gallus|22550                 CTTATGGCGAGGTCAGGTCCCCGCGCCGTGCCGGGGGGAGAGGGTAGG------------
Fugu_rubripes|7786                  CGCTGCGTGGCCTGCAGCCGCCAGCTCATTCCCGGGGACGAGTTTGCG------------
Rhesus_macaque|32038                AAATGTCTGGTGGCTGTTAACAATTTACTAGATTGGAGTATCTTTACT------------
Otolemur_garnettii|13561            CGATGTGTGGCCTGCAGCCGCCAGCTCATCCCTGGGGACGAGTTTGCG------------
Felis_catus|42581                   CGCTGCGTGGCTTGCAGCCGTCAGCTCATCCCTGGGGATGAGTTCGCG------------
Microcebus_murinus|2006             CGATGTGTGGCCTGCAGCCGCCAGCTCATCCCTGGGGACGAGTTCGCG------------
Macropus_eugenii|9432               CGCTGCGTGGCCTGCAGCCGTCAGCTCATCCCCGGGGACGAGTTTGCG------------
Tupaia_belangeri|2263               CGCTGTGTGGCATGCAGCCGCCAACTCATCCCTGGGGACGAATTTGCA------------
Canis_familiaris|21922              CGCTGCGTGGCCTGCAGCCGTCAGCTCATCCCCGGGGACGAGTTCGCG------------
Monodelphis_domestica|13648         CGCTGCGTGGCCTGCAGTCGTCAGCTCATCCCCGGGGACGAGTTCGCG------------
Gasterosteus_aculeatus|19757        CGCTGCGTGGCCTGCAGCCGCCAGCTCATCCCGGGGGACGAGTTCGCG------------
Callithrix_jacchus|44206            CGCTGTGTGGCTGCAGCGCCAGCT---CATCCTGGGGACGAATTTGCG------------
Ornithorhynchus_anatinus|25838      CGCTGCGTGGCCTGCAGCCGCCAGCTCATCCCCGGGGACGAGTTCGCG------------
Danio_rerio|26298                   AGATGTGTGGCGTGTAGTCGGCAGCTCATCCCAGGAGATGAGTTCGCT------------
Anolis_carolinensis|1277            CGCTGCGTGGCCTGCAGCCGGCAGCTCATCCCCGGGGACGAGTTCGCG------------
Sorex_araneus|14424                 CGTTGCGTGGCCTGCAGCCGCCAGCTCATCCCGGGGGACGAGTTCGCG------------
Pteropus_vampyrus|9384              CGCTGCGTGGCCTGCAGCCGCCAGCTCATCCCCGGGGACGAGTTCGCG------------
Taeniopygia_guttata|18817           CGCTGCGTGGCCTGCAGCCGCCAGCTCATCCCCGGCGATGAATTCGCA------------
Pongo_abelii|22055                  CGCTGTGTGGCCTGCAGCCGCCAGCTCATCCCTGGGGACGAATTTGCG------------
Ochotona_princeps|513               CGCTGCGTGGCCTGCAGCCGCCAGCTCATCCCCGGAGACGAGTTTGCG------------
Dipodomys_ordii|15885               CGCTGCGTGGCCTGCAGCCGCCAGCTCATCCCCGGCGACGAGTTCGCG------------
Procavia_capensis|12972             CGCTGCGTGGCCTGTAGTCGCCAGCTCATTCCTGGGGACGAATTCGCG------------
Equus_caballus|14099                CGCTGCGTGGCCTGCAGTCGCCAGCTCATCCCAGGGGACGAGTTCGCA------------
Dasypus_novemcinctus|4895           CGCTGCGTGGCCTGCAGCCGCCAGCTCATCCCCGGGGACGAGTTCGCG------------
Bos_taurus|12652                    CGCTGCGTGGCCTGCAGCCGCCAGCTTATCCCCGGGGATGAGTTCGCG------------
Sus_scrofa|7945                     CGCTGCGTGGCCTGCAGCCGCCAGCTCATCCCTGGGGACGAGTTCGCG------------
Oryctolagus_cuniculus|2869          CGCTGCGTGGCCTGCAGCCGCCAGCTCATCCCCGGGGACGAGTTCGCG------------
Choloepus_hoffmanni|12539           CGCTGCGTGGCCTGCAGCCGTCAGCTTATCCCCGGGGACGAGTTCGCG------------
Cavia_porcellus|12331               CGCTGCGTGGCCTGCAGCCGCCAGCTCATCCCCGGGGACGAGTTCGCG------------
Echinops_telfairi|13551             CGCTGCGTGGCCTGCAGCCGCCAGCTCATTCCCGGGGACGAGTTCGCG------------
Loxodonta_africana|24792            CGATGCGTGGCCTGCAGCCGCCAGCTCATTCCTGGGGACGAGTTCGCG------------
Mus_musculus|11820                  CGCTGTGTAGCCTGCAGCCGACAGCTCATCCCGGGAGACGAATTCGCC------------
Pan_troglodytes|29600               CGCTGTGTGGCCTGCAGCCGCCAGCTCATCCCTGGGGACGAATTTGCG------------
Rattus_norvegicus|17976             CGCTGTGTAGCATGCAGCCGACAGCTCATCCCGGGAGACGAATTCGCG------------
Spermophilus_tridecemlineatus|13317 CGCTGCGTGGCCTGCAGCCGCCAGCTCATTCCCGGGGACGAGTTTGCG------------
Tursiops_truncatus|5249             CGCTGCGTGGCCTGCAGCCGCCAGCTCATCCCCGGGGACGAGTTCGCG------------
Ornithorhynchus_anatinus|28681      CAAGATGATGATGATGATTTACAAATGTTAGAAGGAAAAACCAATTCCTCGGCCCCGCCG
Macropus_eugenii|7357               CGCTGTTCGGTCTGCAGCCGCCAGCTGCTGCCGGGGGATGAGTTCTCC------------
Xenopus_tropicalis|705              CGATGTTCTGTCTGCAGCCGCCGACTCCTTCCAGGGGAAGAGATCAGC------------
Oryzias_latipes|15600               CGGTGCTCGATGTGCAGCAGGCAGCTGCTGCCGGGAGACGAGTTCTCC------------
Felis_catus|40996                   NNNNNNNNNNTGTGCAGCCGCCAGCTGCTGCCCGGCGACGAGTTCTCG------------
Callithrix_jacchus|46809            CGCTGCTCCGTGTGCAGCCGCCAGCTGCTGCCTGGGGACGAATTCTCG------------
Microcebus_murinus|9605             CGGTGCTCCGTGTGCAGCCGCCAGCTGCTGCCTGGGGACGAGTTCTCG------------
Danio_rerio|29046                   CGCTGTTCGGTGTGTAGCCGGCAGCTTTTGCCCGGGGATGAGTTCTCT------------
Oryzias_latipes|18527               CGGTGCTCGGTGTGCAGCCGGCACCTCCTGCCTGGAGACGAATTCTCC------------
Gasterosteus_aculeatus|2399         CGGTGCTCGGTGTGCAGCAGGCAGCTGCTGCCGGGGGACGAGTTCTCC------------
Tetraodon_nigroviridis|13830        AGGTGCTCGGTGTGCAGCCGACAGCTGCTGCCGGGGGACGAGTTCTCC------------
Fugu_rubripes|30053                 AGGTGCTCGGTGTGCAGCCGACAATTGCTGCCGGGGGACGAGTTCTCC------------
Tetraodon_nigroviridis|4572         CGGTGCTCGGTGTGCTGCCGGCACCTCCTGCCGGGGGACGAGTTCTCC------------
Fugu_rubripes|1098                  CGTTGCTCGGTGTGCTGCCGACACCTCCTGCCGGGGGACGAGTTCTCT------------
Gasterosteus_aculeatus|22884        CGGTGCTCGGTGTGCAGTCGCCACCTCCTACCGGGGGACGAGTTCTCT------------
Danio_rerio|20797                   AGGTGCTCGGTGTGCAGCAGACATTTGCTCCCGGGAGATGAGTTCTCA------------
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            CGCTGCTCCGTCTGCAGCCGCCAGCTGCTGCCCGGGGACGAGTTCTCC------------
Echinops_telfairi|972               CGCTGCTCTGTGTGCAGTCGCCAGCTGTTGCCCGGCGACGAGTTCTCG------------
Gorilla_gorilla|16948               CGCTGCTCCGTGTGCAGCCGCCAGCTGCTGCCTGGGGACGAGTTCTCG------------
Cavia_porcellus|24856               CGCTGCGCAGTGTGCAGCCGCCAGCTGCTGCCGGGGGACGAGTTCTCA------------
Pteropus_vampyrus|10382             CGCTGCTCCGTGTGCAGCCGCCAGCTGCTGCCCGGCGACGAGTTCTCC------------
Tupaia_belangeri|12837              TGCTGCTCCGTGTGCAGCGGCCAG---CACTCGTGGGCCGAGTTCTCG------------
Otolemur_garnettii|2070             CGCTGCTCGGTGTGCAGCCGCCAGCTGCTGCCTGGGGACGAGTTCTCG------------
Ochotona_princeps|15487             CGCTGCTCAGTGTGCAGCCGCCAGCTGCTGCCCGGAGACGAGTTCTCG------------
Mus_musculus|44064                  CGCTGCTCCGTGTGCAGCCGCCAGCTGCTCCCTGGAGACGAGTTCTCG------------
Rattus_norvegicus|33962             CGCTGCTCCGTGTGCAGCCGCCAGCTGCTCCCTGGAGACGAGTTCTCG------------
Procavia_capensis|16748             CGCTGCTCCGTGTGCAGCCGCCAGCTGCTCCCGGGCGACGAGTTCTCG------------
Oryctolagus_cuniculus|21892         CGCTGCTCCGTATGCAGCCGCCAGCTGCTGCCGGGAGACGAGTTCTCG------------
Equus_caballus|1290                 CGCTGCTCTGTGTGCAGCCGCCAGCTGCTGCCGGGCGACGAGTTCTCG------------
Homo_sapiens|29496                  CGCTGCTCCGTGTGCAGCCGCCAGCTGCTGCCTGGGGACGAGTTCTCG------------
Pongo_abelii|9734                   CGCTGCTCCGTGTGCAGCCGCCAGCTACTGCCTGGGGACGAATTCTCG------------
Pan_troglodytes|13247               CGCTGCTCCGTGTGCAGCCGCCAGCTGCTGCCTGGGGACGAGTTCTCG------------
Rhesus_macaque|34621                CGCTGCTCCGTGTGCAGCCGTCAGCTGCTGCCTGGGGACGAGTTCTCG------------
Bos_taurus|13136                    CGCTGCTCAGTGTGCAGCCGCCAGCTGCTGCCGGGAGACGAATTCTCG------------
Spermophilus_tridecemlineatus|5969  CGCTGCTCCGTGTGCAGCCGCCAGCTGCTGCCTGGAGATGAGTTCTCG------------
Dasypus_novemcinctus|10026          CGCTGCTCCGTGTGCAGCCGCCAGCTACTGCCCGGCGACGAGTTCTCG------------
Choloepus_hoffmanni|1405            ------------------------------------------------------------
Tursiops_truncatus|10256            CGCTGTTCCGTGTGCAGCCGCCAGCTGCTGCCCGGCGACGAGTTCTCG------------
Nematostella_vectensis|12483        CGTTGCGTTGCGTGCAGCAGACAGCTTGTGCCGGGGGACGAGTTCGCT------------
Pogonomyrmex_barbatus|2673          ------------TTCGCGAAAGAACTTTGCGTGGGA------------------------
Daphnia_pulex|19417                 CGGTGCGCCCTGTGCCAGCGCCAGTTGGTGCCGGGCGACGAGTTTGCC------------
Ixodes_scapularis|17836             CGGTGCCAGGCCTGCGCCCGGCAGCTCATCCCGGGCGACGAGTTCGCG------------
Pediculus_humanus|2973              CGGTGTACGGCTTGCGAAAGACAATTGGTTCCCGGTGATGAATTTGCA------------
Nasonia_vitripennis|9293            CGCTGCTCGGCCTGCATGAGGCAGCTCGTCCCGGGCGACGAGTTCGCT------------
Apis_mellifera|33486                CGATGTTCAGCCTGCATGAGACAGTTAGTGCCTGGCGATGAATTTGCC------------
Linepithema_humile|6941             CGGTGCAGTGCTTGCTTGAGGCGGCTGGAGACCGGCGATGAATTCGCT------------
Pogonomyrmex_barbatus|2677          ------------------------------------------------------------
Culex_quinquefasciatus|15641        CGATGCTCGCTCTGTATGAAACACCTGCAACCTGGAGACGAATTCGCG------------
Bombyx_mori|3274                    AGATGCTGCGCTTGTGCCCGACAACTTATACCTGGTGACGAATTCGCG------------
Drosophila_persimilis|16405         CGCTGTTCGGCGTGTGCGCGACAATTACTGCCAGGCGATGAATTTGCG------------
Drosophila_yakuba|7048              CGATGCTCCGCGTGTGCGCGACAATTGCTGCCAGGCGATGAATTCGCG------------
Drosophila_melanogaster|3349        CGATGCTCCGCGTGTGCGCGACAATTGCTGCCAGGCGATGAATTCGCG------------
Drosophila_simulans|4567            CGATGCTCCGCGTGTGCGCGACAATTGCTGCCAGGCGATGAATTCGCG------------
Drosophila_sechellia|11762          CGATGCTCCGCGTGTGCGCGACAATTGCTGCCAGGCGATGAATTCGCG------------
                                                                                                

Ixodes_scapularis|17839             ------atgGACGGT---------------------------------------------
Caenorhabditis_elegans|1417         ATCAAAAATAACAGC---TTATACTGTCGATCAGACTGCCGGGGACTT------------
Danio_rerio|3280                    CTGCAGGACGGTCAA---CTGCTTTGCACCGATCATCATAACAAACTAATGAGTGCTTTT
Xenopus_tropicalis|17501            TGGAGATCTTTATCCACCATTCTGTGC---------------------------------
Branchiostoma_floridae|41009        CTCAGGGAGGACGGT---CTGTTCTGTAAGGCCGACCACGAGGTCTTG------------
Tarsius_syrichta|14472              NNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------
Erinaceus_europaeus|8777            NNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------
Gorilla_gorilla|31558               CTTCGGGAGGACGGT---CTCTTCTGCCGAGCAGACCACGATGTGGTG------------
Gallus_gallus|22550                 ---------GACGGC------------CCCTCGCCGCATGCAGCCCGAGCA---------
Fugu_rubripes|7786                  CTGCGAGACGACGGA---CTTTTCTGCCGGGCCGACCATGACGTTGTG------------
Rhesus_macaque|32038                CCTGTGGAAATA------GTATTTTGCTCAATTGCACACAGAGTCGTG------------
Otolemur_garnettii|13561            CTGCGAGAGGACGGG---CTTTTCTGCCGAGCAGACCACGACGTGNNN------------
Felis_catus|42581                   CTTCGGGAGGACGGG---CTCTTCTGCCGTGCAGACCACGACGTGGTG------------
Microcebus_murinus|2006             CTGCGGGAGGACGGG---CTTTTCTGCCGAGCAGACCACGACGTGGTG------------
Macropus_eugenii|9432               CTGCGAGAGGACGGC---CTCTTCTGCCGAGCGGACCACGATGTGGTG------------
Tupaia_belangeri|2263               CTGCGGGAGGATGGA---CTCTTCTGCCGCGCAGATCATGATGTGGTG------------
Canis_familiaris|21922              CTTCGGGAGGACGGG---CTCTTCTGCCGCGCGGACCACGACGTGGTG------------
Monodelphis_domestica|13648         CTGCGGGAGGATGGC---CTCTTCTGCCGGGCCGACCACGATGTAGTG------------
Gasterosteus_aculeatus|19757        CTGCGGGAGGACGGG---CTCTTCTGCCGGGCCGATCACGACGTGGTG------------
Callithrix_jacchus|44206            CTTCGGGAGGATGGT---CTCTTCTGCCGAGCCGACCACGATGTGGTG------------
Ornithorhynchus_anatinus|25838      CTGCGGGAGGACGGG---CTCTTCTGCCGGGCTGATCACGATGTGGTG------------
Danio_rerio|26298                   CTGCGGGAAGACGGG---CTCTTCTGCAGGGCCGACCATGACGTGGTG------------
Anolis_carolinensis|1277            CTGCGGGAGGACGGG---CTCTTCTGCCGCGCGGATCACGACGTGGTG------------
Sorex_araneus|14424                 CTGCGGGAGGACGGG---CTCTTCTGCCGCGCAGACCACGACGTGGTG------------
Pteropus_vampyrus|9384              CTGCGGGAGGACGGG---CTCTTCTGCCGCGCAGACCATGACGTGGTG------------
Taeniopygia_guttata|18817           CTGCGGGAGGACGGC---CTCTTCTGCCGGGCGGACCACGACGTGGTG------------
Pongo_abelii|22055                  CTTCGGGAGGACGGT---CTCTTCTGCCGAGCAGACCACGATGTGGTG------------
Ochotona_princeps|513               CTGCGGGAGGACGGC---CTCTTCTGTCGCGCGGACCACGACGTAGTG------------
Dipodomys_ordii|15885               CTCAGGGAGGATGGA---CTCTTCTGCCGCGCCGATCACGACGTGGTG------------
Procavia_capensis|12972             CTTCGGGAAGATGGG---CTTTTTTGCCGCGCAGACCACGACGTGGTG------------
Equus_caballus|14099                CTGCGGGAGGACGGG---CTCTTCTGCCGCGCCGAACACGACGTGGTG------------
Dasypus_novemcinctus|4895           CTGCGGGAAGACGGG---CTTTTCTGCCGCGCGGACCACGATGTTGTG------------
Bos_taurus|12652                    CTGCGGGAGGACGGG---CTCTTCTGCCGCGCCGACCACGACGTGGTG------------
Sus_scrofa|7945                     CTGCGGGAGGACGGG---CTCTTCTGCCGCGCAGACCACGACGTGGTG------------
Oryctolagus_cuniculus|2869          CTGCGGGAGGATGGC---CTTTTCTGTCGCGCGGACCACGACGTCGTG------------
Choloepus_hoffmanni|12539           TTGCGGGAGGACGGG---CTCTTCTGCCGCGCGGACCACGACGTGGTG------------
Cavia_porcellus|12331               CTGCGGGAGGACGGG---CTTTTCTGCCGCGCGGACCATGACGTGGTG------------
Echinops_telfairi|13551             CTGCGGGAGGACGGG---CTCTTCTGCCGCGCCGACCACGACGTGGTG------------
Loxodonta_africana|24792            CTGCGGGAGGACGGG---CTCTTCTGCCGTGCGGACCACGACGTGGTA------------
Mus_musculus|11820                  CTGCGGGAGGATGGG---CTTTTCTGCCGTGCAGACCACGATGTGGTG------------
Pan_troglodytes|29600               CTTCGGGAGGACGGT---CTCTTCTGCCGAGCAGACCACGATGTGGTG------------
Rattus_norvegicus|17976             CTGCGGGAGGATGGG---CTTTTCTGCCGCGCGGACCACGATGTAGTG------------
Spermophilus_tridecemlineatus|13317 CTGCGGGAAGATGGG---CTCTTCTGCCGCGCGGACCACGATGTGGTG------------
Tursiops_truncatus|5249             CTGCGGGAGGACGGG---CTCTTCTGCCGCGCGGATCACGACGTGGTG------------
Ornithorhynchus_anatinus|28681      GCAAGGAGCCGGGGT---TTGGGGCCGAGGGTCGGGCAGAGGGTTGAC------------
Macropus_eugenii|7357               CTAAGGGATCACGAG---CTTCTATGCCGAGCAGATCACAGCCTTTTGCTG---------
Xenopus_tropicalis|705              CTGAGGGACCAAGAT---CTGTTGTGTGGGGCAGAGCACAACCTGTCA------------
Oryzias_latipes|15600               CTGCAGGAAGGAGAT---CTGCTGTGCCGGGCGGACCACAGCATGCTGCTG---------
Felis_catus|40996                   CTGCGGGAGCACGAG---CTGCTCTGCCGCGCCGACCACGGCCTCCTGCTG---------
Callithrix_jacchus|46809            CTAAGGGAGCACGAG---CTGCTCTGCCGCGCCGACCGAATAAGTGTTATT---------
Microcebus_murinus|9605             CTGCGGGAGCACGAG---CTGCTCTGCCGCGCCGACCACGGCCTCCTGCTC---------
Danio_rerio|29046                   GTCCGGGACGAGGAA---CTGTTATGTCGGGCAGATCATGGTCTGGCTCTA---------
Oryzias_latipes|18527               CTGCGAGAGGACGAG---CTGCTGTGCCGCGCAAACCACGACCTGCTG------------
Gasterosteus_aculeatus|2399         CTGCGGGAAGACGAG---CTGCTGTGCCGGGCGGACCACAGCCTGCTGCTG---------
Tetraodon_nigroviridis|13830        CTGCGGGAAGAAGAG---CTGCTCTGCCGGGCAGACCACAGCCTGCTGCTG---------
Fugu_rubripes|30053                 CTGCGGGAAGAAGAG---CTGCTCTGCCGGGCCGACCACAGCATTCTACTG---------
Tetraodon_nigroviridis|4572         CTGCGGGAAGATGAG---CTCCTGTGTCGGGCGGACCACTGCCTGCTGATG---------
Fugu_rubripes|1098                  CTGCGGGAAGATGAG---CTCCTGTGTCGGGCGGATCACTGCCTGCTGATG---------
Gasterosteus_aculeatus|22884        CTGCGGGACGACGAG---CTGCTGTGTCGGGCCGATCACGGCTCGCTGGCG---------
Danio_rerio|20797                   TTGCGGGACGAGGAG---CTGCTCTGCCGGGCGGACCACGGACTGCTAATG---------
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            CTGAGGGATCACGAG---CTTCTGTGCCGGGCTGATCACAGCCTCCTGCTG---------
Echinops_telfairi|972               CTGCGGGAGCATGAG---CTGCTTTGCCGAGCGGACCACGGCCTCTTGCTG---------
Gorilla_gorilla|16948               CTGCGGGAGCACGAG---CTGCTCTGCCGCGCCGACCACGGCCTCCTACTCCTGCCCGGT
Cavia_porcellus|24856               CTGCGGGAGCACGAG---CTGCTGTGCCGAGCCGACCACGGGCTCCTGCTC---------
Pteropus_vampyrus|10382             CTGCGGGAGCACGAG---CTGCTGTGCCGCGCGGACCACGGCCTTCTGCTG---------
Tupaia_belangeri|12837              CGAGGAGAGCACGAG---CTTTTCATCCGCGCCGTGCACGACCTCCTGCTC---------
Otolemur_garnettii|2070             CTGCGGGAACACGAG---CTGCTCTGCCGCGCGGACCACGGCCTCCTGCTG---------
Ochotona_princeps|15487             CTGCGGGAACACGAG---CTGCTCTGTCGTGCAGACCACGGCCTCCTGCTG---------
Mus_musculus|44064                  CTGCGGGAGCATGAG---CTGCTCTGCCGAGCTGACCACGGCCTCCTGCTG---------
Rattus_norvegicus|33962             CTGAGGGAGCACGAG---CTGCTCTGCCGAGCCGACCACGGCCTCCTGCTG---------
Procavia_capensis|16748             CTGCGGGAGCACGAG---CTGCTCTGCCGCGCGGACCACGGCCTCCTGCTG---------
Oryctolagus_cuniculus|21892         CTGCGGGAACACGAG---CTGCTCTGCCGCGCCGACCACGGCCTCCTGCTC---------
Equus_caballus|1290                 CTCCGGGAGCACGAG---CTGCTCTGCCGCGCCGACCACGGCCTCCTGCTC---------
Homo_sapiens|29496                  CTGCGGGAGCACGAG---CTGCTCTGCCGCGCCGACCACGGCCTCCTGCTC---------
Pongo_abelii|9734                   CTGCGGGAGCATGAG---CTGCTCTGCCGTGCCGACCACGGCCTCCTGCTC---------
Pan_troglodytes|13247               CTGCGGGAGCACGAG---CTGCTCTGCCGCGCCGACCACGGCCTCCTGCTC---------
Rhesus_macaque|34621                CTGCGGGAGCACGAG---CTGCTCTGCCGCGCAGACCACGGCCTCCTGCTC---------
Bos_taurus|13136                    TTGCGGGAGCACGAG---CTGCTCTGCCGCGCCGACCACGGCCTCCTGCTC---------
Spermophilus_tridecemlineatus|5969  CTGAGGGAGCACGAA---CTGCTCTGCCGCGCAGATCACGGCCTCCTGCTT---------
Dasypus_novemcinctus|10026          CTGCGGGAGCACGAG---CTGCTCTGCCGCGCGGACCACGGCCTCCTGCTC---------
Choloepus_hoffmanni|1405            ------------------------TGTCGCGCGGATCACGGCCTCCTGCTC---------
Tursiops_truncatus|10256            CTGCGGGAGCACGAG---CTGCTCTGCCGCGCCGACCACGGCCTCCTGCTC---------
Nematostella_vectensis|12483        CTTCGCGAAGATGGA---CTATTCTGTAAGGCCGATCACGAAATTGTA------------
Pogonomyrmex_barbatus|2673          ---AAGTCAGACGGG---------------------------------------------
Daphnia_pulex|19417                 CTGCGTGACGACGGCAACCTCTTCTGCAAGGACGACCACGACCAGACC------------
Ixodes_scapularis|17836             CTGCGAGACGACGGC---CTCTTCTGCAGGGCGGACCACGACGTGCTC------------
Pediculus_humanus|2973              TTAAGAGAAGATGGA---CTTTTTTGCAAAGAAGACCACGAAGTACTC------------
Nasonia_vitripennis|9293            CTGAGGTCCGACGGC---CTCTTCTGCCGGCACGACCACGACGCGCTC------------
Apis_mellifera|33486                TTGAGACAGGATGGC---CTGTTCTGCAGACATGATCACGACGTTCTC------------
Linepithema_humile|6941             CTAAGGCAAGACGGT---CTCTTTTGTCGACACGATCACGACGTTCTC------------
Pogonomyrmex_barbatus|2677          GTTCGCGGTTCTGGC---------------------------------------------
Culex_quinquefasciatus|15641        TTACGGGACGGTGGCGCGCTGTACTGCAAGGAGGACCACGACCACCTG------------
Bombyx_mori|3274                    TTGCGAGAAGGCGGAGCGCTCTATTGTAGAGAAGATCACGATGTTTTA------------
Drosophila_persimilis|16405         TTACGTGATGCTGGGGCCCTGTATTGCAAGGAGGATCACGACGTGCTG------------
Drosophila_yakuba|7048              TTACGCGATGCCGGGGCTTTGTACTGCAAGGAGGATCACGATGTGCTG------------
Drosophila_melanogaster|3349        TTACGCGATGCCGGGGCTTTGTACTGCAAGGAGGATCACGATGTGCTG------------
Drosophila_simulans|4567            TTACGCGATGCCGGGGCTTTGTACTGCAAGGAGGATCACGATGTGCTG------------
Drosophila_sechellia|11762          TTACGCGATGCCGGGGCTTTGTACTGCAAGGAGGATCACGATGTGCTG------------
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         GACAATCCAGATACATCAGCT---TCAGTTCCAGATTATTCAAAATTGAATAACAATAAC
Danio_rerio|3280                    ATAAACCAACAGAAGGAGGCT---GGC---------------------------------
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        GAGAGGGCGTCAAACAATGTG---GAT---------------------------------
Tarsius_syrichta|14472              NNNNNNNNNNNNNNNNNNNNN---NNN---------------------------------
Erinaceus_europaeus|8777            NNNNNNNNNNNNNNNNNNNNN---NNN---------------------------------
Gorilla_gorilla|31558               GAGAGGGCCAGTCTAGGCGCT---GGC---------------------------------
Gallus_gallus|22550                 GCGGGACAGGAGGAGGGGGCG---GCA---------------------------------
Fugu_rubripes|7786                  GAACGGGCCAGTCTGGCCTCT---GGA---------------------------------
Rhesus_macaque|32038                GAGCCCAGCGCTCATGGCGCT---TCT---------------------------------
Otolemur_garnettii|13561            NNNNNNNNNNNNNNNNNNNNN---NNN---------------------------------
Felis_catus|42581                   GAGAGGGCCAGCCTGGGCGCC---GGT---------------------------------
Microcebus_murinus|2006             GAGAGGGCCAGCCTCGGCGCC---GGC---------------------------------
Macropus_eugenii|9432               GAGAGAGCCAGTCTGGGAGCC---GGC---------------------------------
Tupaia_belangeri|2263               GAGAGAGCCAGCCTGGGTGCT---GGT---------------------------------
Canis_familiaris|21922              GAGAGGGCCAGCCTGGGCGCC---GGC---------------------------------
Monodelphis_domestica|13648         GAGAGGGCCAGTCTAGGAGCC---GGC---------------------------------
Gasterosteus_aculeatus|19757        GAGCGCGCCAGCCTGGGCAGCGGCGGC---------------------------------
Callithrix_jacchus|44206            GAGAGGGCCAGTCTGGGGGCT---GGC---------------------------------
Ornithorhynchus_anatinus|25838      GAAAGGGCCAGTCTGGGCGCG---GGA---------------------------------
Danio_rerio|26298                   GAGCGGGCAACAATGGGTGCT---GGT---------------------------------
Anolis_carolinensis|1277            GAGCGCGCCAGCCTGGGCCCC---GGG---------------------------------
Sorex_araneus|14424                 GAGAGAGCCAGCCTGGGCGCC---GGC---------------------------------
Pteropus_vampyrus|9384              GAGAGAGCCAGCCTGGGCGCC---GGC---------------------------------
Taeniopygia_guttata|18817           GAGAGGGCCAGCCTGGGCGGC---GGG---------------------------------
Pongo_abelii|22055                  GAGAGGGCCAGTCTGGGCGCT---GGC---------------------------------
Ochotona_princeps|513               GAAAGGGCTAGTCTGGGCGCC---GGT---------------------------------
Dipodomys_ordii|15885               GAGAGGGCTAGCTTGGGCGCC---GGC---------------------------------
Procavia_capensis|12972             GAGAGGGCCAGCCTGGGCGCT---GGT---------------------------------
Equus_caballus|14099                GAGAGGGCCAGCCTGGGGGCC---GGC---------------------------------
Dasypus_novemcinctus|4895           GAAAGGGCCAGCCTGGGCGCC---AGC---------------------------------
Bos_taurus|12652                    GAGAGGGCCAGCCTGGGCGCC---GGC---------------------------------
Sus_scrofa|7945                     GAGAGGGCCAGCCTGGGCGCC---GGC---------------------------------
Oryctolagus_cuniculus|2869          GAAAGGGCTAGCCTGGGCGCC---GGC---------------------------------
Choloepus_hoffmanni|12539           GAGAGGGCCAGCTTGGGCGCC---GGC---------------------------------
Cavia_porcellus|12331               GAGAGAGCCAGTCTGGGTGCT---GGC---------------------------------
Echinops_telfairi|13551             GAGAGGGCCAGCCTGGGCGCC---GGT---------------------------------
Loxodonta_africana|24792            GAGAGGGCCAGCCTGGGCGCC---GGT---------------------------------
Mus_musculus|11820                  GAGAGAGCCAGCCTGGGAGCT---GGA---------------------------------
Pan_troglodytes|29600               GAGAGGGCCAGTCTAGGCGCT---GGC---------------------------------
Rattus_norvegicus|17976             GAGAGGGCCAGCCTAGGAGCT---GGA---------------------------------
Spermophilus_tridecemlineatus|13317 GAGAGAGCCAGCTTGGGTGCC---GGC---------------------------------
Tursiops_truncatus|5249             GAGAGGGCCAGCCTGGGCGCC---GGC---------------------------------
Ornithorhynchus_anatinus|28681      CCCCCTCCGGGGTGGGGGGCT---------------------------------------
Macropus_eugenii|7357               GACAGGGCCTCGGCGGAGAGT---CCT---------------------------------
Xenopus_tropicalis|705              GGTAGAGTTACTGTAGCAAAC---------------------------------------
Oryzias_latipes|15600               GAGAGGACCTCCGCGGGGAGC---CCC---------------------------------
Felis_catus|40996                   GAGCGCGCCGCGGCCGGCAGC---CCG---------------------------------
Callithrix_jacchus|46809            GTCAGAAGGGAAGGAGGTTTG---CCT---------------------------------
Microcebus_murinus|9605             GAGCGCGCCGCGGCCGGCAGC---CCG---------------------------------
Danio_rerio|29046                   GAGCGCGGACCAGGCGGCAGT---CCA---------------------------------
Oryzias_latipes|18527               GAGCGGGCCTCTGCAGGAAGC---CCG---------------------------------
Gasterosteus_aculeatus|2399         GACCGGAGCGCCGCAGGAAGC---------------------------------------
Tetraodon_nigroviridis|13830        GAGAGGAGCTCCGCAGGAAGC---CCC---------------------------------
Fugu_rubripes|30053                 GAGAAGAGCTCCGCAGGAAGT---CCC---------------------------------
Tetraodon_nigroviridis|4572         GAGCGGGCCTCCGCAGGGAGC---CCC---------------------------------
Fugu_rubripes|1098                  GAGCGGGCCTCCGCAGGGAGC---CCC---------------------------------
Gasterosteus_aculeatus|22884        GAGCGGGCCTCTGCAGGGAGC---CCG---------------------------------
Danio_rerio|20797                   GAACGCGCTTCCGCTGGGAGC---CCC---------------------------------
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            GACAGGGCCTCGGGGGAGAGT---CCT---------------------------------
Echinops_telfairi|972               GAGCGCGCAGCGGCCGGCAGC---CCG---------------------------------
Gorilla_gorilla|16948               AAGCGCGCCGGGGCCTGTGCC---GGG---------------------------------
Cavia_porcellus|24856               GAGCGCGCGGCAGCCGGCAGC---CCG---------------------------------
Pteropus_vampyrus|10382             GAGCGTGTCGCGGCCACCAGC---CCG---------------------------------
Tupaia_belangeri|12837              GAGCGA---GCCGCGGGCAGC---CCG---------------------------------
Otolemur_garnettii|2070             GAGCGCGCTGCAGCCGGCAGC---CCG---------------------------------
Ochotona_princeps|15487             GAGCGCGCGGCCGCCGGCAGC---CCG---------------------------------
Mus_musculus|44064                  GAGCGCGCTGCGGCTGGCAgc---ccg---------------------------------
Rattus_norvegicus|33962             GAGCGCGCTgcggccggcagc---ccg---------------------------------
Procavia_capensis|16748             GAGCGCGCGGCGGCCGGCAGC---CCA---------------------------------
Oryctolagus_cuniculus|21892         GAgcgcgcggcggccggcagc---ccg---------------------------------
Equus_caballus|1290                 GAgcgcgccgcggccggcagc---ccg---------------------------------
Homo_sapiens|29496                  GAgcgcgccgcggccggcagc---ccg---------------------------------
Pongo_abelii|9734                   GAgcgcgccgcggccggcagc---ccg---------------------------------
Pan_troglodytes|13247               GAgcgcgccgcggccggcagc---ccg---------------------------------
Rhesus_macaque|34621                GAGCGCGCCGCTGCAGGCAGC---CCG---------------------------------
Bos_taurus|13136                    GAgcgcgcggcggccggcagc---ccg---------------------------------
Spermophilus_tridecemlineatus|5969  GAGCGCGCTGCGGCCGGCAGC---CCG---------------------------------
Dasypus_novemcinctus|10026          GAGCGCGCGGCGGCGGGCAGC---CCG---------------------------------
Choloepus_hoffmanni|1405            GAGCGCGCCGCGGCCGGCAGC---CCG---------------------------------
Tursiops_truncatus|10256            GAGCGCGCTGCGGCCGGCAGC---CCG---------------------------------
Nematostella_vectensis|12483        GAGAAAGCGACGGCGACGGCT---CAG---------------------------------
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 AACAACAACAACAACAACAGC---AGC---------------------------------
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              GATAAATCATGTACGGGAGAACATAAT---------------------------------
Nasonia_vitripennis|9293            GAGGGTGAGAAGATCTGCGGTGGCGGT---------------------------------
Apis_mellifera|33486                GAAGGCGGAAAGCTCTGCTCTGGACCT---------------------------------
Linepithema_humile|6941             GAAGGCGGAAAGCATTGTACC---GGT---------------------------------
Pogonomyrmex_barbatus|2677          ------------------------GGT---------------------------------
Culex_quinquefasciatus|15641        GAAAAGACGAGCCAAAGTTTGGGGCCG------------------------GGCGTCGAG
Bombyx_mori|3274                    GAAAAGAGCGCGAACACGAGCGGCGGG---------------------------------
Drosophila_persimilis|16405         GAGAAATCATCGCAGAGCAGTCTCACC---------------------------------
Drosophila_yakuba|7048              GAGAAATCGTCGCAGAGCAGCCTCACT---------------------------------
Drosophila_melanogaster|3349        GAGAAATCGTCGCAGAGCAGCCTCACT---------------------------------
Drosophila_simulans|4567            GAGAAATCGTCGCAGAGCAGCCTCACT---------------------------------
Drosophila_sechellia|11762          GAGAAATCGTCGCAGAGCAGCCTCACT---------------------------------
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         AACAATGATAACAACAATTCAAGTTCAAATTTTGATGAGGATGAATGGGATGAGGAGAGA
Danio_rerio|3280                    ------------------------------------------------------------
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        ------------------------------------------------------------
Tarsius_syrichta|14472              ------------------------------------------------------------
Erinaceus_europaeus|8777            ------------------------------------------------------------
Gorilla_gorilla|31558               ------------------------------------------------------------
Gallus_gallus|22550                 ------------------------------------------------------------
Fugu_rubripes|7786                  ------------------------------------------------------------
Rhesus_macaque|32038                ------------------------------------------------------------
Otolemur_garnettii|13561            ------------------------------------------------------------
Felis_catus|42581                   ------------------------------------------------------------
Microcebus_murinus|2006             ------------------------------------------------------------
Macropus_eugenii|9432               ------------------------------------------------------------
Tupaia_belangeri|2263               ------------------------------------------------------------
Canis_familiaris|21922              ------------------------------------------------------------
Monodelphis_domestica|13648         ------------------------------------------------------------
Gasterosteus_aculeatus|19757        ------------------------------------------------------------
Callithrix_jacchus|44206            ------------------------------------------------------------
Ornithorhynchus_anatinus|25838      ------------------------------------------------------------
Danio_rerio|26298                   ------------------------------------------------------------
Anolis_carolinensis|1277            ------------------------------------------------------------
Sorex_araneus|14424                 ------------------------------------------------------------
Pteropus_vampyrus|9384              ------------------------------------------------------------
Taeniopygia_guttata|18817           ------------------------------------------------------------
Pongo_abelii|22055                  ------------------------------------------------------------
Ochotona_princeps|513               ------------------------------------------------------------
Dipodomys_ordii|15885               ------------------------------------------------------------
Procavia_capensis|12972             ------------------------------------------------------------
Equus_caballus|14099                ------------------------------------------------------------
Dasypus_novemcinctus|4895           ------------------------------------------------------------
Bos_taurus|12652                    ------------------------------------------------------------
Sus_scrofa|7945                     ------------------------------------------------------------
Oryctolagus_cuniculus|2869          ------------------------------------------------------------
Choloepus_hoffmanni|12539           ------------------------------------------------------------
Cavia_porcellus|12331               ------------------------------------------------------------
Echinops_telfairi|13551             ------------------------------------------------------------
Loxodonta_africana|24792            ------------------------------------------------------------
Mus_musculus|11820                  ------------------------------------------------------------
Pan_troglodytes|29600               ------------------------------------------------------------
Rattus_norvegicus|17976             ------------------------------------------------------------
Spermophilus_tridecemlineatus|13317 ------------------------------------------------------------
Tursiops_truncatus|5249             ------------------------------------------------------------
Ornithorhynchus_anatinus|28681      ------------------------------------------------------------
Macropus_eugenii|7357               ------------------------------------------------------------
Xenopus_tropicalis|705              ------------------------------------------------------------
Oryzias_latipes|15600               ------------------------------------------------------------
Felis_catus|40996                   ------------------------------------------------------------
Callithrix_jacchus|46809            ------------------------------------------------------------
Microcebus_murinus|9605             ------------------------------------------------------------
Danio_rerio|29046                   ------------------------------------------------------------
Oryzias_latipes|18527               ------------------------------------------------------------
Gasterosteus_aculeatus|2399         ------------------------------------------------------------
Tetraodon_nigroviridis|13830        ------------------------------------------------------------
Fugu_rubripes|30053                 ------------------------------------------------------------
Tetraodon_nigroviridis|4572         ------------------------------------------------------------
Fugu_rubripes|1098                  ------------------------------------------------------------
Gasterosteus_aculeatus|22884        ------------------------------------------------------------
Danio_rerio|20797                   ------------------------------------------------------------
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            ------------------------------------------------------------
Echinops_telfairi|972               ------------------------------------------------------------
Gorilla_gorilla|16948               ------------------------------------------------------------
Cavia_porcellus|24856               ------------------------------------------------------------
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------------------------------------
Otolemur_garnettii|2070             ------------------------------------------------------------
Ochotona_princeps|15487             ------------------------------------------------------------
Mus_musculus|44064                  ------------------------------------------------------------
Rattus_norvegicus|33962             ------------------------------------------------------------
Procavia_capensis|16748             ------------------------------------------------------------
Oryctolagus_cuniculus|21892         ------------------------------------------------------------
Equus_caballus|1290                 ------------------------------------------------------------
Homo_sapiens|29496                  ------------------------------------------------------------
Pongo_abelii|9734                   ------------------------------------------------------------
Pan_troglodytes|13247               ------------------------------------------------------------
Rhesus_macaque|34621                ------------------------------------------------------------
Bos_taurus|13136                    ------------------------------------------------------------
Spermophilus_tridecemlineatus|5969  ------------------------------------------------------------
Dasypus_novemcinctus|10026          ------------------------------------------------------------
Choloepus_hoffmanni|1405            ------------------------------------------------------------
Tursiops_truncatus|10256            ------------------------------------------------------------
Nematostella_vectensis|12483        ------------------------------------------------------------
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 ------------------------------------------------------------
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              ------------------------------------------------------------
Nasonia_vitripennis|9293            ------------------------------GTACCCGCCGGAATACCCGGCAACGAGAAC
Apis_mellifera|33486                ------------------------------------GGTGGTGTTCCTGGAAGTGAAAAC
Linepithema_humile|6941             ---------------------------------ACTGTCGGTATGCCCGGAAGCGAAAAC
Pogonomyrmex_barbatus|2677          ------------------------------------------------------------
Culex_quinquefasciatus|15641        CCGAAcaacaacgtcagcaatgccaacgcgaaccaaaacagcagtagcaacaacaacaat
Bombyx_mori|3274                    ---------------------------------------AGTAGTAATAATGCCGAGAGC
Drosophila_persimilis|16405         ------------------------------------------TCCTCCTCGGTGGAGAGC
Drosophila_yakuba|7048              ------------------------------------------TCTTCGTCGGTGGAGAGC
Drosophila_melanogaster|3349        ------------------------------------------TCTTCGTCGGTGGAGAGC
Drosophila_simulans|4567            ------------------------------------------TCTTCGTCGGTGGAGAGC
Drosophila_sechellia|11762          ------------------------------------------TCTTCGTCGGTGGAGAGC
                                                                                                

Ixodes_scapularis|17839             ---------------------------------------------CGTCCGCTG------
Caenorhabditis_elegans|1417         TCCACATTGACTTCACTTGACAATAAC------------ACATCAAGTCCTTTAGGATCT
Danio_rerio|3280                    GATCCATTCGAGGAGATCAAATCCACA---------------------------------
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        TCTAACGGCAGAGCCAGCCTGGGAAGT------------------ACCGACCTCGAAATG
Tarsius_syrichta|14472              NNNNNNNNNNNNNNNNNNNNNNNNNNN------------------NNNNNNNNNNNNNNN
Erinaceus_europaeus|8777            NNNNNNNNNNNNNNNNNNNNNNNNNNN------------------NNNNNNNNNNNNNNN
Gorilla_gorilla|31558               GACCCGCTCAGTCCCCTGCATCCAGCG------------------CGGCCACTGCAAATG
Gallus_gallus|22550                 CCTCCTTCGAGCCCCTTGCACCCGGCC------------------CGACCGCTGCAG---
Fugu_rubripes|7786                  GATCCGCTCAGCCCGCTGCATCCAGCC------------------AGACCGCTGCAGATG
Rhesus_macaque|32038                TGCCCC------------------------------------------------------
Otolemur_garnettii|13561            NNNNNNNNNNNNNNNNNNNNNNNNNNN------------------NNNNNNNNNNNNNNN
Felis_catus|42581                   GATCCGCTCAGCCCTCTGCACCCGGCG------------------CGGCCGCTGCAAATG
Microcebus_murinus|2006             GACCCGCTTAGTCCGCTGCATCCGGCG------------------CGGCCCCTGCAAATG
Macropus_eugenii|9432               GACCCTCTGAGCCCCCTTCATCCTGCG------------------CGGCCGCTGCAAATG
Tupaia_belangeri|2263               GACCCGCTCAGTCCCCTGCACCCAGCA------------------CGGCCGCTGCAAATG
Canis_familiaris|21922              GACCCGCTCAGCCCTCTGCACCCAGCG------------------CGGCCGCTGCAAATG
Monodelphis_domestica|13648         GACCCTCTGAGTCCCCTTCATCCTGCG------------------CGGCCGCTGCAAATG
Gasterosteus_aculeatus|19757        GACCCGCTCAGCCCGCTGCACCCGTCC------------------CGCCCGCTGCAGATG
Callithrix_jacchus|44206            GACCCGCTCAGTCCCCTGCACCCGGCG------------------CGGCCTCTGCAAATG
Ornithorhynchus_anatinus|25838      GATCCGCTCAGCCCCCTGCATCCCGCC------------------CGCCCGCTCCAGATG
Danio_rerio|26298                   GACCCATTAAGCCCATTACATCCGGCG------------------AGACCTTTACAAATG
Anolis_carolinensis|1277            GACCCCCTCAGCCCCCTACACCCGGCC------------------AGGCCCCTCCAGATG
Sorex_araneus|14424                 GACCCGCTCAGCCCCCTGCACCCAGCG------------------CGGCCGCTGCAAATG
Pteropus_vampyrus|9384              GACCCACTCAGCCCTCTGCATCCGGCG------------------CGGCCGCTGCAAATG
Taeniopygia_guttata|18817           GACCCTCTCAGCCCCCTACATCCCGCT------------------CGGCCGCTGCAGATG
Pongo_abelii|22055                  GATCCGCTCAGTCCCCTGCATCCAGCG------------------CGGCCACTGCAAATG
Ochotona_princeps|513               GACCCTCTCAGTCCTCTGCACCCGGCA------------------CGGCCGCTGCAAATG
Dipodomys_ordii|15885               GACCCGCTCAGTCCCCTGCATCCAGCA------------------AGGCCGCTGCAAATG
Procavia_capensis|12972             GACCCCCTCAGCCCCTTGCATCCGGCT------------------CGGCCGCTGCAAATG
Equus_caballus|14099                GACCCGCTCAGCCCCCTGCACCCGGCG------------------CGGCCGCTGCAAATG
Dasypus_novemcinctus|4895           GACCCCCTCAGCCCCCTGCACCCGGCG------------------CGGCCGCTGCAAATG
Bos_taurus|12652                    GATCCGCTCAGCCCCTTGCACCCGGCG------------------CGGCCGCTGCAAATG
Sus_scrofa|7945                     GACCCGCTCAGCCCCCTGCACCCGGCG------------------CGGCCTCTGCAAATG
Oryctolagus_cuniculus|2869          GACCCTCTCAGCCCTCTGCACCCGGCG------------------CGGCCGCTGCAAATG
Choloepus_hoffmanni|12539           GACCCGCTCAGCCCCCTGCACCCGGCG------------------CGGCCGCTTCAAATG
Cavia_porcellus|12331               GACCCGCTCAGTCCCCTGCATCCCGCT------------------CGGCCGCTGCAAATG
Echinops_telfairi|13551             GACCCTCTCAGCCCCCTGCACCCGGCT------------------CGGCCCCTGCAAATG
Loxodonta_africana|24792            GACCCGCTCAGTCCCCTGCACCCCGCT------------------CGGCCGCTGCAAATG
Mus_musculus|11820                  GACCCTCTCAGTCCCTTGCATCCAGCG------------------CGGCCTCTGCAAATG
Pan_troglodytes|29600               GACCCGCTCAGTCCTCTGCATCCAGCG------------------CGGCCACTGCAAATG
Rattus_norvegicus|17976             GACCCTCTCAGTCCCTTGCATCCAGCG------------------CGGCCTCTGCAAATG
Spermophilus_tridecemlineatus|13317 GACCCTCTCAGTCCCTTGCATCCAGCA------------------CGGCCGCTGCAAATG
Tursiops_truncatus|5249             GACCCGCTCAGCCCCCTGCACCCGGCG------------------CGGCCGCTGCAAATG
Ornithorhynchus_anatinus|28681      ------AACAGGCCTGGGCCCCCCGCA---------------------------------
Macropus_eugenii|7357               CGGAGCCCAGGACACTTACCAAGCAGC------------------AGGGGCCTACATCTG
Xenopus_tropicalis|705              ACACAACTCTTACCAGTGCAGGGCAAC------------ACTGACACTAGCCTTATTGTT
Oryzias_latipes|15600               ATCAGTCCCGGACACATCCACTCCAAC------------------AGACCGCTGCACATG
Felis_catus|40996                   CGCAGCCCCGGCCCGCTCCCCGGCGCC------------------CGCGGCCTGCATCTG
Callithrix_jacchus|46809            AGGAGTATGTGTGTAATTAACACAGCTCCCAACTGGGAGCTGAGTAAGGGCTTGGTCAGC
Microcebus_murinus|9605             CGCAGCCCCGGCCCGCTCCCCGGCGCC------------------CGAGGCCTGCATCTG
Danio_rerio|29046                   CTTAGTCCAGGAAACATCCACACT---------------------AGAGGACTACACATG
Oryzias_latipes|18527               CTGAGTCCGGACAACCTTCAC---AAA------------------AGAACACTGCACATA
Gasterosteus_aculeatus|2399         ---CCGATCAGCCCCGGACACCCCCCG------------------------TTTCTGACG
Tetraodon_nigroviridis|13830        ATCAGCCCCGGACACATCCACTCCAAC------------------AGACCCCTGCACCTG
Fugu_rubripes|30053                 ATCAGCCCCGGACACTTGCACTCCAAC------------------AGAGCCCTGCACCTG
Tetraodon_nigroviridis|4572         CTCAGCCCGGGGCCCATTCAC---AGC------------------CGACCGCTCCACATC
Fugu_rubripes|1098                  CTCAGCCCGGGAACCATCCAC---AGC------------------AGACCACTACACATC
Gasterosteus_aculeatus|22884        CTCAGCCCGGGGAACATCCAC---AGC------------------AGACAGCTGCACATC
Danio_rerio|20797                   ATCAGCCCGGGGAACATTCACTCTAGC------------------AGGCCCTTACACATC
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            AGGAGCCCAGGACACCTACCAAGCAGC------------------AGGGGCCTCCATCTC
Echinops_telfairi|972               CGCAGCCCTGGCCCGCTCCCGGGCGCC------------------CGCGGCCTGCATCTG
Gorilla_gorilla|16948               GTAGTCATAGGCCTGCAGCACAGATCC------------------GCAGACCAGGCTGGG
Cavia_porcellus|24856               CGCAGCCCCGGCCCTATCCCTGGAGCG------------------CGCGCCTTGCACCTG
Pteropus_vampyrus|10382             AGCAGCCCTGGCTCGCTCCCC---GCG------------------CGCGGCCTGCATCTG
Tupaia_belangeri|12837              CGCAGCCCCGGCCCGCTCCCCGGCGCC------------------CGCGGCCTGCATCTA
Otolemur_garnettii|2070             CGCAGCCCCGGCCAGCTCCCCGGCGCC------------------CGCGGCCTGCATCTG
Ochotona_princeps|15487             CGCAGCCCCGGTCCGCTCCCGGGCGCC------------------CGCAGCCTGCATCTG
Mus_musculus|44064                  cgcagccccggcccgctccccggcgcc------------------cgcggccTGCATCTG
Rattus_norvegicus|33962             cgcagccctggcccgctccccggcgcc------------------cgcggccTGCATCTG
Procavia_capensis|16748             CGCAGCCCCAGCTCGCTGCCCGGCACC------------------CGCGGCCTGCATCTG
Oryctolagus_cuniculus|21892         cgcagccccggcccgctccccggcgcc------------------cgcggccTGCATCTG
Equus_caballus|1290                 cgcagccccggcccgcttcccggcgcc------------------cgcggccTGCATCTC
Homo_sapiens|29496                  cgcagccccggcccgcttcccggcgcc------------------cgcggccTGCATCTG
Pongo_abelii|9734                   cgcagccccggcccgcttcccggcgcc------------------cgcggccTGCATCTG
Pan_troglodytes|13247               cgcagccccggcccgcttcccggcgcc------------------cgcggccTGCATCTG
Rhesus_macaque|34621                CGCAGCCCCGGCCCGCTCCCCGGCTCC------------------CGCGGCCTGCATCTG
Bos_taurus|13136                    cgcagccccggcccgcttcccggcgcc------------------cgcggccTGCATCTG
Spermophilus_tridecemlineatus|5969  CGCAGCCCCGGTCCTCTCCCCGGAGCC------------------CGCGGCCTGCATCTG
Dasypus_novemcinctus|10026          CGCAGCCCGGGCCCGCTCCCCGGTGCC------------------CGCGGCCTGCATCTG
Choloepus_hoffmanni|1405            CGCAGCCCCGGCCCGCTGCCCGGCGCC------------------CGCGGCCTGCATCTG
Tursiops_truncatus|10256            CGCAGCCCCGGCCCGCTCCCCGGCGCC------------------CGCGGCCTGCATCTA
Nematostella_vectensis|12483        GCAACTCACGTACGGAACAACGGCCAG------------------CGTTCTTCTCAGTCA
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 AATCAGAATAATAACAACAACAACAAC------------------AACGGCGGCGGAATG
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              AATAATAATACAAATGTAAATAATAAC------------------AACAGTAATAGTGTA
Nasonia_vitripennis|9293            AACAACAACGCCAATCTCACCAACAAC------------------AATCACCACCTGCAT
Apis_mellifera|33486                AACAACAATGCATCCCTTATGAATAAT------------------AATCATCATCTGCAT
Linepithema_humile|6941             AACAATAATGCCTCTCTGACAAACAAC------------------AATCATCATTTGCAC
Pogonomyrmex_barbatus|2677          ------------------------------------------------------------
Culex_quinquefasciatus|15641        aacaacaacagcagtagcaacaacaacaacaacattagcctaagcaataacaaccacTCG
Bombyx_mori|3274                    AACAATAATACGACGCTAAGTAACAAT------------------AACTCGCATCATCCC
Drosophila_persimilis|16405         AACAACAATATTAGCAGTAGTAACAATAACAACACCAACCTTAGCAATAACAACCATTCC
Drosophila_yakuba|7048              AACAACAATATTAGCAGTAGTAACAACAACAACACCAACCTTAGCAATAACAACCATTCC
Drosophila_melanogaster|3349        AACAACAATATTAGCAGTAGTAACAACAACAACACCAACCTTAGCAATAACAACCATTCC
Drosophila_simulans|4567            AACAACAATATTAGCAGTAGTAACAACAACAACACCAACCTTAGCAATAACAACCATTCC
Drosophila_sechellia|11762          AACAACAATATTAGCAGTAGTAACAACAACAACACCAACCTTAGCAATAACAACCATTCC
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         CCCAAATCCGATGGAGTCCGAACCCCACTT------TTCGGTCATCATAACAGTGGTTCT
Danio_rerio|3280                    ------------------------------------------------------------
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        GCAACT---------------CGCCCAGAGTCG---CACGGTCGCTCGGATCAA------
Tarsius_syrichta|14472              NNNNGT---------------GAGCCCATC------TCCGCCCGGCAGCCGGCC------
Erinaceus_europaeus|8777            NNNNCC---------------GAGCCCATA------TCCGCCCGACAACCGGCC------
Gorilla_gorilla|31558               GCAGGT---------------ACTCCTCTGCCCGGCTCGGGTAGGCAGGCG---------
Gallus_gallus|22550                 ---------------------AGGGCAGGTAccgcccgcgcacggcgccccgcg------
Fugu_rubripes|7786                  GCAGCA---------------GAACCGGTT------TCCGCTCGGACCCCTGCA------
Rhesus_macaque|32038                GCAGCG---------------GAGCCCATC------TCCGCCAGGCAGCCGGCC------
Otolemur_garnettii|13561            NNNNCC---------------GAGCCCATC------TCCGCCCGGCAGCCGGCC------
Felis_catus|42581                   GCAGCC---------------GAGCCCATC------TCTGCCCGGCAGCCGGCC------
Microcebus_murinus|2006             GCAGCG---------------GAGCCCATC------TCCGCCCGGCAGCCGGCC------
Macropus_eugenii|9432               GCAGCA---------------GAACCCATC------TCTGCTAGGCAGCCAGCT------
Tupaia_belangeri|2263               GCAGCC---------------GAACCCATC------TCTGCCCGGCAGCCAGCC------
Canis_familiaris|21922              GCAGCC---------------GAGCCCATC------TCTGCCAGGCAGCCAGCC------
Monodelphis_domestica|13648         GCAGCA---------------GAACCCATC------TCTGCCAGGCAGCCAGCT------
Gasterosteus_aculeatus|19757        GCAGCA---------------GAACCCATC------TCGGCCCGGCAGCCCGCG------
Callithrix_jacchus|44206            GCAGCG---------------GAGCCCATC------TCCGCCAGGCAGCCGGCC------
Ornithorhynchus_anatinus|25838      GCAGCA---------------GAACCTATC------TCCGCCAGGCAGCCCGCC------
Danio_rerio|26298                   GCAGCA---------------GAGCCCATT------TCGGCACGTCAGCCTGCG------
Anolis_carolinensis|1277            GCAGCA---------------GAGCCTATC------TCGGCCCGGCAACCGGCT------
Sorex_araneus|14424                 GCAGCC---------------GAGCCCATC------TCCGCCCGGCAGCCCGCC------
Pteropus_vampyrus|9384              GCAGCC---------------GAGCCCATC------TCTGCCCGGCAGCCGGCC------
Taeniopygia_guttata|18817           GCAGCA---------------GAACCTATC------TCTGCCAGACAGCCAGCT------
Pongo_abelii|22055                  GCAGCG---------------GAGCCCATC------TCCGCCAGGCAGCCGGCC------
Ochotona_princeps|513               GCAGCG---------------GAGCCCATC---------GCCCGACAGCCAGCC------
Dipodomys_ordii|15885               GCAGCC---------------GAACCCATC------TCTGCCCGGCAGCCAGCC------
Procavia_capensis|12972             GCAGCC---------------GAGCCCATC------TCTGCGAGGCAGCCAGCC------
Equus_caballus|14099                GCAGCC---------------GAGCCCATC------TCCGCCCGGCAGCCGGCC------
Dasypus_novemcinctus|4895           GCAGCG---------------GAGCCCATC------TCTGCCCGGCAGCCGGCC------
Bos_taurus|12652                    GCAGCC---------------GAGCCCATC------TCCGCCCGGCAGCCAGCC------
Sus_scrofa|7945                     GCAGCC---------------GAGCCCATC------TCCGCCAGGCAGCCGGCC------
Oryctolagus_cuniculus|2869          GCAGCC---------------GAGCCCATC------TCCGCGCGACAGCCAGCC------
Choloepus_hoffmanni|12539           GCAGCC---------------GAGCCCATC------TCTGCCCGGCAACCGGCC------
Cavia_porcellus|12331               GCAGCT---------------GAGCCTATC------TCCGCCCGGCAGCCGGCC------
Echinops_telfairi|13551             GCAGCC---------------GAGCCCATC------TCTGCGAGGCAGCCAGCC------
Loxodonta_africana|24792            GCAGCC---------------GAGCCCATC------TCCGCGAGGCAGCCGGCC------
Mus_musculus|11820                  GCAGCC---------------GAACCCATC------TCGGCTAGGCAGCCAGCT------
Pan_troglodytes|29600               GCAGCG---------------GAGCCCATC------TCCGCCAGGCAGCCGGCC------
Rattus_norvegicus|17976             GCAGCC---------------GAGCCCATC------TCCGCTAGGCAGCCAGCT------
Spermophilus_tridecemlineatus|13317 GCAGCG---------------GAGCCTATC------TCTGCCCGGCAGCCAGCC------
Tursiops_truncatus|5249             GCAGCC---------------GAGCCCATC------TCCGCCCGGCAGCCGGCC------
Ornithorhynchus_anatinus|28681      ---------------------GACCCCGGG------TCCGGCCGGCAGCCGTCG------
Macropus_eugenii|7357               TCAGNN------------------------------NNNNNNNNNNNNNNNNNN------
Xenopus_tropicalis|705              TCAGAC------------------------------TCTGGCAGGCCCTCATCC------
Oryzias_latipes|15600               GCAGCA---------------GACCCAGTG------ACGGTGCGGCAGGCCCCG------
Felis_catus|40996                   CCA------------------GNNNNNNNN------NNNNNNNNNNNNNNNNNN------
Callithrix_jacchus|46809            CGGGAGCCAAGAACCCAACAAAACCCTGGG------TCGGGCCGGCAGCCCACG------
Microcebus_murinus|9605             CCA------------------GAGCCCGGG------GCGGCGCGGCAGCCCTCG------
Danio_rerio|29046                   GCAGCT---------------GATCCGGTG------TCGGTCCGACAAACCCCT------
Oryzias_latipes|18527               TCGGGTacccaccaa------aACCCAATT------TCGGTCCGGCATCCCTCCCAC---
Gasterosteus_aculeatus|2399         TCTTCCCCTCCGGGCTCAGCAGATCCGGTC------TCGGTGCGGCAGGCCCCG------
Tetraodon_nigroviridis|13830        ACAGGTCCGCCTCTA------CTTCCATTC------TCACTGCAGGCAGGTCCG------
Fugu_rubripes|30053                 ACAGCGTTTGCA---------GACCCGGTT------TCGATGCGGCAGGCCACG------
Tetraodon_nigroviridis|4572         TCA------------------GATGCAGTG------TCGGTCAGGCATCCTCCTCAT---
Fugu_rubripes|1098                  TCA------------------GATGCGGTT------ACTGTTCGACATCCTCCTCAT---
Gasterosteus_aculeatus|22884        TCA------------------GAACCAGTT------TCTGTCCGACATCCTCCTCAT---
Danio_rerio|20797                   CCA------------------GAACCTGTG------CCAGTTCGACAGCCACCT------
Otolemur_garnettii|1567             ---------------------GAGCCCATC------TCCGCCCGGCAGCCGGCC------
Monodelphis_domestica|57            TCA------------------GAGCCGGGC------TCGGGCCGGCAGCCGTCG------
Echinops_telfairi|972               CCA------------------GACCCCGGG------GCGGGCCGGCAGCCCTCG------
Gorilla_gorilla|16948               CCTCTG---------------GACGCTGGG------TCGGGCCGGCAGCCCGCG------
Cavia_porcellus|24856               CCA------------------GAGCCGGTG------CCTGGCCAGCAGCCCGCG------
Pteropus_vampyrus|10382             CCA------------------GACCCCGGG------GCTGGCCGGCAGCCCGCG------
Tupaia_belangeri|12837              TCA------------------GACCCCGGG------TCGGGCCGGCAGCCCTCG------
Otolemur_garnettii|2070             CCA------------------GACCCGGGG------TCGGCCCGGCAGCCCTCA------
Ochotona_princeps|15487             CCA------------------GACCCCGGG------CCCGGCCGGCAGCCCACC------
Mus_musculus|44064                  CCA------------------GACGCTGGG------TCCGGACGACAGCCCTCA------
Rattus_norvegicus|33962             CCA------------------GACGCCGGG------TCCGGACGACAGTCCTCA------
Procavia_capensis|16748             CCA------------------GACCCCGGC------GCGGGCCGGCAGCCCTCG------
Oryctolagus_cuniculus|21892         CCA------------------GACCCCGGG------CCCGGCCGGCAGCCCACG------
Equus_caballus|1290                 CCA------------------GATCCCGGG------GCGGGCCGGCAGGCTTCG------
Homo_sapiens|29496                  CCC------------------GACGCTGGG------TCGGGCCGGCAGCCCGCG------
Pongo_abelii|9734                   CCA------------------GACGCTGGG------TCGGGCCGGCAGCCCGCG------
Pan_troglodytes|13247               CCC------------------GACGCTGGG------TCGGGCCGGCAGCCCGCG------
Rhesus_macaque|34621                CCA------------------GATGCTGGG------TCGGGCCGGCAGCCCGCG------
Bos_taurus|13136                    CCA------------------GACCCGGGA------TCCGGCCGGCAGCCTTCG------
Spermophilus_tridecemlineatus|5969  CCA------------------GACCCTGGG------TCGGGCCGACAGCCCTCG------
Dasypus_novemcinctus|10026          CCA------------------GACCCCGGG------TCGGGCCGGCAGCCCCCG------
Choloepus_hoffmanni|1405            CCA---------------------------------------CGGCAGCCCCCG------
Tursiops_truncatus|10256            CCA------------------GACCCGGGA------TCGGGCCGGCAGCCCTCG------
Nematostella_vectensis|12483        GGGGGG---------------CAAACTAAT------GGGCAGACGACGCCGGAT------
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 GGCGGC------------------------------GTCGGAGGGTCGGGCGGC------
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              CATAACGAAGGATCCAATTCTGGTTATGAATGGTTAACTTCACGGTTTGATGCGTTTAAT
Nasonia_vitripennis|9293            CCGAACGACGGATCGCTGTCGGATTCCGGCTCGGAGAGCGGCTCGCACAAGACGGTGGGC
Apis_mellifera|33486                CCCAACGACGGCTCAATATCAGACTCCGGATCTGAGAGTGGATCTCATAAAGCTGGTATG
Linepithema_humile|6941             CCGAACGACGGTTCAATGTCAGATTCCGGATCCGAGAGCGGGTCGCATAAAGCGGGTGTT
Pogonomyrmex_barbatus|2677          ------------------------------------------------------------
Culex_quinquefasciatus|15641        AGCGAGCTGGGGTCGATGTCGGATTCCGGCAGCGAGTCGGGTTCGCACAAGAGC------
Bombyx_mori|3274                    CATGAGCTGGGGTCTATGTCAGATTCTGGGAGCGAATCCGGCTCTCACAAGAGT------
Drosophila_persimilis|16405         AGCGAATTGGGTTCAATGTCAGATTCTGGCAGCGAATCGGGCTCACATAAAAGT------
Drosophila_yakuba|7048              AGCGAATTGGGTTCAATGTCAGATTCCGGCAGCGAATCGGGCTCACACAAAAGT------
Drosophila_melanogaster|3349        AGCGAATTGGGTTCAATGTCAGATTCTGGCAGCGAATCGGGCTCACACAAAAGT------
Drosophila_simulans|4567            AGCGAATTGGGTTCAATGTCAGATTCTGGCAGCGAATCGGGCTCACACAAAAGT------
Drosophila_sechellia|11762          AGCGAATTGGGTTCAATGTCAGATTCTGGCAGCGAATCGGGCTCACACAAAAGT------
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         GGTGGCTCA---------ACGAGTAGT---TGTGGAAAAAAG------------------
Danio_rerio|3280                    ------------------CTGTCCTGG---TCCTCAATGCAG------------------
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        ------------------CGAAGACCA---CAGGTTCACAAA------------------
Tarsius_syrichta|14472              ------------------CTGCGGCCC---CACGTCCATAAC------------------
Erinaceus_europaeus|8777            ------------------CTGAGACCC---CACGTCCACAAG------------------
Gorilla_gorilla|31558               ------------------------CCA---GGTGTATACACA------------------
Gallus_gallus|22550                 ------------------gACAGACCC---CATCTCCTCATG------------------
Fugu_rubripes|7786                  ------------------CTGCGGCCT---CACGTACACAAA------------------
Rhesus_macaque|32038                ------------------CTGCGGCCC---CATGTCCACAAG------------------
Otolemur_garnettii|13561            ------------------TTGCGGCCC---CACGTCCACAAG------------------
Felis_catus|42581                   ------------------CTGCGGCCC---CATGTGCACAAG------------------
Microcebus_murinus|2006             ------------------CTGCGGCCC---CACGTCCACAAG------------------
Macropus_eugenii|9432               ------------------TTGCGGCCT---CATGTCCACAAG------------------
Tupaia_belangeri|2263               ------------------CTGCGGCCC---CATGTCCACAAG------------------
Canis_familiaris|21922              ------------------CTGCGGCCC---CACGTCCACAAG------------------
Monodelphis_domestica|13648         ------------------TTGCGGCCT---CATGTCCACAAG------------------
Gasterosteus_aculeatus|19757        ------------------CTCCGGCCC---CACGTCCACAAG------------------
Callithrix_jacchus|44206            ------------------CTGCGACCC---CATGTCCATAAG------------------
Ornithorhynchus_anatinus|25838      ------------------CTGCGACCC---CACGTCCACAAG------------------
Danio_rerio|26298                   ------------------CTTCGACCT---CATGTGCACAAG------------------
Anolis_carolinensis|1277            ------------------CTCCGGCCG---CACGTCCACAAG------------------
Sorex_araneus|14424                 ------------------CTGCGACCC---CACGTGCACAAG------------------
Pteropus_vampyrus|9384              ------------------CTGCGGCCC---CACGTCCATAAG------------------
Taeniopygia_guttata|18817           ------------------CTGCGGCCC---CACGTCCACAAG------------------
Pongo_abelii|22055                  ------------------CTGCGGCCC---CACGTCCACAAG------------------
Ochotona_princeps|513               ------------------CTG---CCC---CAC---CACAAG------------------
Dipodomys_ordii|15885               ------------------CTGAGGCCC---CACGTCCACAAG------------------
Procavia_capensis|12972             ------------------CTGCGGCCC---CACGTCCACAAG------------------
Equus_caballus|14099                ------------------CTACGGCCC---CACGTCCACAAG------------------
Dasypus_novemcinctus|4895           ------------------CTGCGACCC---CACGTCCACAAG------------------
Bos_taurus|12652                    ------------------CTGCGGCCC---CATGTCCACAAG------------------
Sus_scrofa|7945                     ------------------CTGAGGCCC---CACGTCCACAAG------------------
Oryctolagus_cuniculus|2869          ------------------CTGAGGCCC---CACGTCCACAAG------------------
Choloepus_hoffmanni|12539           ------------------CTGCGGCCC---CACGTCCACAAG------------------
Cavia_porcellus|12331               ------------------CTGCGGCCC---CACGTCCACAAA------------------
Echinops_telfairi|13551             ------------------CTGCGGCCC---CACGTCCACAAG------------------
Loxodonta_africana|24792            ------------------CTGCGGCCC---CATGTCCACAAG------------------
Mus_musculus|11820                  ------------------CTGCGGCCG---CACGTCCACAAG------------------
Pan_troglodytes|29600               ------------------CTGCGGCCC---CACGTCCACAAG------------------
Rattus_norvegicus|17976             ------------------CTGCGGCCG---CACGTCCACAAA------------------
Spermophilus_tridecemlineatus|13317 ------------------CTGCGGCCC---CATGTCCACAAG------------------
Tursiops_truncatus|5249             ------------------CTGCGGCCC---CACGTCCACAAG------------------
Ornithorhynchus_anatinus|28681      ------------------TTGCGGCCT---CACGTGCACAAG------------------
Macropus_eugenii|7357               ------------------NNNNNNNNNNNNNNNNNNNNNNNN------------------
Xenopus_tropicalis|705              ------------------CTCAGGTCT---CACATCCACAAA------------------
Oryzias_latipes|15600               ------------------CATCGGAAC---CACGTTCACAAG------------------
Felis_catus|40996                   ------------------NNNNNNNNN---NNNNNNNNNNNN------------------
Callithrix_jacchus|46809            ------------------TTGCGCCCG---CACGTGCACAAG------------------
Microcebus_murinus|9605             ------------------CTGCGGCAG---CACGCGCACAAG------------------
Danio_rerio|29046                   ------------------CATCGGAAC---CACGTGCACAAG------------------
Oryzias_latipes|18527               ------------------CACCGAAAC---CACGTGCACAAG------------------
Gasterosteus_aculeatus|2399         ------------------CATCGGAAC---CACGTCCACAAG------------------
Tetraodon_nigroviridis|13830        ------------------CATCGAAAC---CACGTCCACAAG------------------
Fugu_rubripes|30053                 ------------------CACCGGAAC---CACGTCCACAAG------------------
Tetraodon_nigroviridis|4572         ------------------CACCGAAAC---CACGTCCACAAA------------------
Fugu_rubripes|1098                  ------------------CATCGAAAC---CACGGCCACAAA------------------
Gasterosteus_aculeatus|22884        ------------------CACCGCAGC---CACGTCCACAAG------------------
Danio_rerio|20797                   ------------------CATCGGAAT---CACGTTCACAAG------------------
Otolemur_garnettii|1567             ------------------TTGCGGCCC---CACGTCCACAAG------------------
Monodelphis_domestica|57            ------------------CTGCGCGCC---CACGTGCACAAG------------------
Echinops_telfairi|972               ------------------CTGCGCCCG---CACGTGCACAAG------------------
Gorilla_gorilla|16948               ------------------TTGCGCCCG---CACGTGCACAAG------------------
Cavia_porcellus|24856               ------------------CTGCGCCCG---CACGTGCACAAG------------------
Pteropus_vampyrus|10382             ------------------CCGCGCCCG---CACGCGCACAAG------------------
Tupaia_belangeri|12837              ------------------CTGCGCCCG---CACGTGCACAAG------------------
Otolemur_garnettii|2070             ------------------CTGCGCCCG---CACGTGCACAAG------------------
Ochotona_princeps|15487             ------------------CTGCGGCCG---CACGTGCACAAG------------------
Mus_musculus|44064                  ------------------CTGCGCACG---CACGTGCACAAG------------------
Rattus_norvegicus|33962             ------------------CTGCGCACG---CACGTGCACAAG------------------
Procavia_capensis|16748             ------------------CTGCGCCCG---CATGTGCACAAG------------------
Oryctolagus_cuniculus|21892         ------------------CTGCGCCCA---CACGTGCACAAG------------------
Equus_caballus|1290                 ------------------CTGCGCCCG---CACGTGCACAAG------------------
Homo_sapiens|29496                  ------------------TTGCGCCCG---CACGTGCACAAG------------------
Pongo_abelii|9734                   ------------------TTGCGCCCG---CACGTGCACAAG------------------
Pan_troglodytes|13247               ------------------TTGCGCCCG---CACGTGCACAAG------------------
Rhesus_macaque|34621                ------------------TTGCGCCCG---CACGTGCACAAG------------------
Bos_taurus|13136                    ------------------CTGCGCCCG---CACGTGCACAAA------------------
Spermophilus_tridecemlineatus|5969  ------------------CTGCGTCCA---CACGTGCACAAG------------------
Dasypus_novemcinctus|10026          ------------------CTGCGTCCG---CATGTGCACAAG------------------
Choloepus_hoffmanni|1405            ------------------CTGCGTCCG---CATGTGCACAAG------------------
Tursiops_truncatus|10256            ------------------CTGCGTCCG---CACGTGCACAAA------------------
Nematostella_vectensis|12483        ------------------TCGACTCCA---------AGTAAA------------------
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 ------------------GTCTCTGGC---GGCGGCGGCGGC------------------
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              TCAATGTGTGCAGATGATGTCCGATTG---TGTGTGTCCCATTTTTTTGCCTACTATTCG
Nasonia_vitripennis|9293            GGC---------------GCGCGGGGCGCAGCGGGCCACAAG------------------
Apis_mellifera|33486                GGTGGT------------ACTCGAGGTTCGGGCAGCCATAAA------------------
Linepithema_humile|6941             GGTGGT------------GTTCGCGGTTCAGGTGGTCACAAA------------------
Pogonomyrmex_barbatus|2677          ------------------CACAAAAGC---------GGCGGT------------------
Culex_quinquefasciatus|15641        ------------------ATGCGCGGCAAGGGACCCACCGGA------------------
Bombyx_mori|3274                    ------------------GGTCGGGCG---CGGACCACAGCG------------------
Drosophila_persimilis|16405         ------------------ATTAGGGAAAAACGACCCTCGGGT------------------
Drosophila_yakuba|7048              ------------------ATTAGGGAGAAGCGACCCTCGGGG------------------
Drosophila_melanogaster|3349        ------------------ATTAGGGACAAGCGACCCTCGGGG------------------
Drosophila_simulans|4567            ------------------ATTAGGGACAAGCGACCCTCGGGG------------------
Drosophila_sechellia|11762          ------------------ATTAGGGACAAGCGACCCTCGGGG------------------
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         ------------------------------------------------------------
Danio_rerio|3280                    ------------------------------------------------------------
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        ------------------------------------------------------------
Tarsius_syrichta|14472              ------------------------------------------------------------
Erinaceus_europaeus|8777            ------------------------------------------------------------
Gorilla_gorilla|31558               ------------------------------------------------------------
Gallus_gallus|22550                 ------------------------------------------------------------
Fugu_rubripes|7786                  ------------------------------------------------------------
Rhesus_macaque|32038                ------------------------------------------------------------
Otolemur_garnettii|13561            ------------------------------------------------------------
Felis_catus|42581                   ------------------------------------------------------------
Microcebus_murinus|2006             ------------------------------------------------------------
Macropus_eugenii|9432               ------------------------------------------------------------
Tupaia_belangeri|2263               ------------------------------------------------------------
Canis_familiaris|21922              ------------------------------------------------------------
Monodelphis_domestica|13648         ------------------------------------------------------------
Gasterosteus_aculeatus|19757        ------------------------------------------------------------
Callithrix_jacchus|44206            ------------------------------------------------------------
Ornithorhynchus_anatinus|25838      ------------------------------------------------------------
Danio_rerio|26298                   ------------------------------------------------------------
Anolis_carolinensis|1277            ------------------------------------------------------------
Sorex_araneus|14424                 ------------------------------------------------------------
Pteropus_vampyrus|9384              ------------------------------------------------------------
Taeniopygia_guttata|18817           ------------------------------------------------------------
Pongo_abelii|22055                  ------------------------------------------------------------
Ochotona_princeps|513               ------------------------------------------------------------
Dipodomys_ordii|15885               ------------------------------------------------------------
Procavia_capensis|12972             ------------------------------------------------------------
Equus_caballus|14099                ------------------------------------------------------------
Dasypus_novemcinctus|4895           ------------------------------------------------------------
Bos_taurus|12652                    ------------------------------------------------------------
Sus_scrofa|7945                     ------------------------------------------------------------
Oryctolagus_cuniculus|2869          ------------------------------------------------------------
Choloepus_hoffmanni|12539           ------------------------------------------------------------
Cavia_porcellus|12331               ------------------------------------------------------------
Echinops_telfairi|13551             ------------------------------------------------------------
Loxodonta_africana|24792            ------------------------------------------------------------
Mus_musculus|11820                  ------------------------------------------------------------
Pan_troglodytes|29600               ------------------------------------------------------------
Rattus_norvegicus|17976             ------------------------------------------------------------
Spermophilus_tridecemlineatus|13317 ------------------------------------------------------------
Tursiops_truncatus|5249             ------------------------------------------------------------
Ornithorhynchus_anatinus|28681      ------------------------------------------------------------
Macropus_eugenii|7357               ------------------------------------------------------------
Xenopus_tropicalis|705              ------------------------------------------------------------
Oryzias_latipes|15600               ------------------------------------------------------------
Felis_catus|40996                   ------------------------------------------------------------
Callithrix_jacchus|46809            ------------------------------------------------------------
Microcebus_murinus|9605             ------------------------------------------------------------
Danio_rerio|29046                   ------------------------------------------------------------
Oryzias_latipes|18527               ------------------------------------------------------------
Gasterosteus_aculeatus|2399         ------------------------------------------------------------
Tetraodon_nigroviridis|13830        ------------------------------------------------------------
Fugu_rubripes|30053                 ------------------------------------------------------------
Tetraodon_nigroviridis|4572         ------------------------------------------------------------
Fugu_rubripes|1098                  ------------------------------------------------------------
Gasterosteus_aculeatus|22884        ------------------------------------------------------------
Danio_rerio|20797                   ------------------------------------------------------------
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            ------------------------------------------------------------
Echinops_telfairi|972               ------------------------------------------------------------
Gorilla_gorilla|16948               ------------------------------------------------------------
Cavia_porcellus|24856               ------------------------------------------------------------
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------------------------------------
Otolemur_garnettii|2070             ------------------------------------------------------------
Ochotona_princeps|15487             ------------------------------------------------------------
Mus_musculus|44064                  ------------------------------------------------------------
Rattus_norvegicus|33962             ------------------------------------------------------------
Procavia_capensis|16748             ------------------------------------------------------------
Oryctolagus_cuniculus|21892         ------------------------------------------------------------
Equus_caballus|1290                 ------------------------------------------------------------
Homo_sapiens|29496                  ------------------------------------------------------------
Pongo_abelii|9734                   ------------------------------------------------------------
Pan_troglodytes|13247               ------------------------------------------------------------
Rhesus_macaque|34621                ------------------------------------------------------------
Bos_taurus|13136                    ------------------------------------------------------------
Spermophilus_tridecemlineatus|5969  ------------------------------------------------------------
Dasypus_novemcinctus|10026          ------------------------------------------------------------
Choloepus_hoffmanni|1405            ------------------------------------------------------------
Tursiops_truncatus|10256            ------------------------------------------------------------
Nematostella_vectensis|12483        ------------------------------------------------------------
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 ------------------------------------------------------------
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              TCGGAATCGGGTTCGAATAAAGGTAGAGATAGCGGAAGCTGTAGATCGAGCGGAGGAACA
Nasonia_vitripennis|9293            ------------------------------------------------------------
Apis_mellifera|33486                ------------------------------------------------------------
Linepithema_humile|6941             ------------------------------------------------------------
Pogonomyrmex_barbatus|2677          ------------------------------------------------------------
Culex_quinquefasciatus|15641        ------------------------------------------------------------
Bombyx_mori|3274                    ------------------------------------------------------------
Drosophila_persimilis|16405         ------------------------------------------------------------
Drosophila_yakuba|7048              ------------------------------------------------------------
Drosophila_melanogaster|3349        ------------------------------------------------------------
Drosophila_simulans|4567            ------------------------------------------------------------
Drosophila_sechellia|11762          ------------------------------------------------------------
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         ---------AAAAAGGATAAGCAAGCGACACGTGTCAGGACTGTGCTCAACGAAAATCAG
Danio_rerio|3280                    ---------AGGTGTTCAGAGAGGGCGACCCGCGTCAGGACGGTTCTCAGTGAGACTCAG
Xenopus_tropicalis|17501            ------------------TTTTATTTTAGTTTTTTTTCATTTATTTTATCCTCTTTCATT
Branchiostoma_floridae|41009        ---------CAAGACGGACACAAACCGACCCGAGTCAGAACAGTTTTGAACGAAAAGCAG
Tarsius_syrichta|14472              ---------CAGCCC---GAGAAGACCACCCGCGTGCGGACTGTGCTGAAC---AAACAG
Erinaceus_europaeus|8777            ---------CAGCCC---GAGAAGACCACCCGCGTGCGGACTGTGCTGAACGAGAAGCAG
Gorilla_gorilla|31558               ---------CGCCCA---AACATTACTTCC---------AGTTCGCTCTGGCCTCCAAAC
Gallus_gallus|22550                 ---------CAGCCT---GAGAAGACCACCCGAGTCCGAACTGTCCTTAATGAAAAGCAG
Fugu_rubripes|7786                  ---------CAGCCG---GAAAAGACCACTCGTGTTCGGACAGTCTTGAACGAGAAGCAG
Rhesus_macaque|32038                ---------CAGCCG---GAGAAGACCACCCGCGTGCGGACTGTGCTGAATGAGAAGCAG
Otolemur_garnettii|13561            ---------CAGCCG---GAGAAGACCACCCGAGTGCGGACTGTGCTGAACGAGAAGCAG
Felis_catus|42581                   ---------CAGCCC---GAGAAGACCACCCGCGTTCGGACTGTGCNNNNNNNNNNNNNN
Microcebus_murinus|2006             ---------CAGCCC---GAGAAGACTACGCGCGTGCGAACTGTGCTGAACGAGAAGCAG
Macropus_eugenii|9432               ---------CAACCG---GAGAAGACCACCCGAGTCCGGACTGTCCTTAATGAAAAACAG
Tupaia_belangeri|2263               ---------CAGCCG---GAGAAGACCACCCGCGTGCGGACTGTGCTGAACGAGAAGCAG
Canis_familiaris|21922              ---------CAGCCA---GAGAAGACCACCCGTGTTCGGACTGTGCTGAACGAGAAGCAG
Monodelphis_domestica|13648         ---------CAACCA---GAGAAGACCACCCGAGTCCGGACTGTCCTTAATGAAAAACAG
Gasterosteus_aculeatus|19757        ---------CAGCCG---GAGAAGACCACGCGCGTGCGCACGGTGCTCAACGAGAAGCAG
Callithrix_jacchus|44206            ---------CAGCCG---GAGAAGACCACCCGCGTGCGGACTGTGCTGAACGAGAAGCAG
Ornithorhynchus_anatinus|25838      ---------CAGCCG---GAGAAGACCACCCGGGTGCGGACCGTCCTGAACGAGAAGCAG
Danio_rerio|26298                   ---------CAACCT---GAGAAAACAACCCGCGTCCGGACAGTCCTCAACGAAAAACAG
Anolis_carolinensis|1277            ---------CAGCCG---GAGAAGACCACCCGGGTCCGGACCGTCCTCAACGAGAAGCAG
Sorex_araneus|14424                 ---------CAGCCG---GAGAAGACCACCCGCGTGCGGACTGTGCTCAACGAGAAGCAG
Pteropus_vampyrus|9384              ---------CAGCCA---GAGAAGACCACCCGCGTGCGGACTGTGCTGAACGAGAAGCAG
Taeniopygia_guttata|18817           ---------CAGCCC---GAGAAGACAACCCGAGTCCGGACTGTTCTTAATGAGAAACAG
Pongo_abelii|22055                  ---------CAGCCG---GAGAAGACCACCCGCGTGCGGACTGTGCTGAACGAGAAGCAG
Ochotona_princeps|513               ---------CAGCCG---GAGAAGACCACCCGGGTGCGGACTGTGCTCAATGAGAAGCAG
Dipodomys_ordii|15885               ---------CAGCCC---GAGAAGACCACCCGCGTGCGGACTGTGCTGAATGAGAAGCAG
Procavia_capensis|12972             ---------CAACCG---GAGAAGACCACCCGCGTGCGGACTGTGCTGAATGAGAAGCAG
Equus_caballus|14099                ---------CAGCCC---GAGAAGACCACCCGCGTGCGGACTGTGCTGAACGAGAAGCAG
Dasypus_novemcinctus|4895           ---------CAGCCG---GAGAAGACCACCCGCGTGCGGACTGTGCTGAACGAGAAGCAG
Bos_taurus|12652                    ---------CAGCCC---GAGAAGACCACCCGCGTGCGGACTGTGCTGAACGAGAAGCAG
Sus_scrofa|7945                     ---------CAGCCT---GAGAAGACCACCCGCGTTCGGACTGTGCTGAACGAAAAGCAG
Oryctolagus_cuniculus|2869          ---------CAGCCG---GAGAAGACCACCCGTGTGCGGACTGTGCTCAACGAGAAGCAG
Choloepus_hoffmanni|12539           ---------CAGCCC---GAGAAGACCACACGTGTGCGGACAGTGCTGAACGAGAAGCAG
Cavia_porcellus|12331               ---------CAGCCA---GAGAAGACCACCCGCGTTCGGACTGTGCTGAATGAGAAGCAG
Echinops_telfairi|13551             ---------CAACCG---GAGAAGACCACCCGCGTGCGGACTGTGCTGAATGAGAAGCAG
Loxodonta_africana|24792            ---------CAGCCG---GAGAAGACCACCCGCGTGCGGACTGTGCTGAACGAGAAGCAG
Mus_musculus|11820                  ---------CAGCCG---GAGAAGACCACCCGAGTGCGGACTGTGCTCAACGAGAAGCAG
Pan_troglodytes|29600               ---------CAGCCG---GAGAAGACCACCCGCGTGCGGACTGTGCTGAACGAGAAGCAG
Rattus_norvegicus|17976             ---------CAGCCC---GAGAAGACCACCCGAGTGCGGACTGTGCTCAACGAAAAGCAG
Spermophilus_tridecemlineatus|13317 ---------CAGCCA---GAGAAGACCACCCGTGTGCGGACTGTGCTGAATGAGAAGCAG
Tursiops_truncatus|5249             ---------CAGCCA---GAGAAGACCACCCGCGTGCGGACTGTGTTGAACGAGAAGCAG
Ornithorhynchus_anatinus|28681      ---------CAGGCG---GAGAAGACCACCCGCGTCCGGACGGTGCTCAACGAGAAGCAG
Macropus_eugenii|7357               ---------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|705              ---------CAAACA---GAAAAGACTACCAGGGTTCGGACGGTACTAAATGAAAAGCAA
Oryzias_latipes|15600               ---------CAGTCA---GAGAAGACGACTCGCGTAAGGACGGTGCTGAACGAGAAGCAG
Felis_catus|40996                   ---------NNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACGAGAAGCAG
Callithrix_jacchus|46809            ---------CAGACG---GAGAAGACGACCCGCGTTCGGACTGTGCTCAACGAGAAGCAG
Microcebus_murinus|9605             ---------CAGGCG---GAGAAGACGACCCGGGTGCGCACCGTGCTGAACGAGAAGCAG
Danio_rerio|29046                   ---------CAATCG---GAGAAGACCACTCGGGTGAGGACGGTTCTGAACGAAAAACAG
Oryzias_latipes|18527               ---------CAGTCT---GAGAAGACGACCCGTGTCCGGACTGTGCTCAACGAGAAGCAG
Gasterosteus_aculeatus|2399         ---------CAGTCG---GAGAAGACGACTCGGGTCCGGACGGTGCTGAACGAGAAGCAG
Tetraodon_nigroviridis|13830        ---------CAGTCG---GAGAAGACGACGCGGGTCAGGACGGTGCTGAACGAGAAGCAG
Fugu_rubripes|30053                 ---------CAGTCG---GAGAAGACGACGCGTGTCAGGACCGTGCTGAACGAGAAGCAG
Tetraodon_nigroviridis|4572         ---------CAGTCG---GAGAAGACCACCCGGATCCGCACGGTGCTGACCGAGAAGCAG
Fugu_rubripes|1098                  ---------CAGTCG---GAAAAGACCACCCGGATCCGGACGGTGCTGACCGAGAAGCAG
Gasterosteus_aculeatus|22884        ---------CAGTCC---GAGAAGACCACTCGGATCCGGACGGTGCTGAACGAGAAGCAG
Danio_rerio|20797                   ---------CAGTCG---GAGAAAACCACGCGTGTTCGGACAGTATTAAACGAAAAGCAG
Otolemur_garnettii|1567             ---------CAGCCG---GAGAAGACCACCCGAGTGCGGACTGTGCTGAACGAGAAGCAG
Monodelphis_domestica|57            ---------CAGGCG---GAGAAGACGACCCGGGTGCGGACGGTCCTGAACGAGAAGCAG
Echinops_telfairi|972               ---------CAGACG---GAGAAGACGACCCGCGTCCGCACGGTGCTCAACGAGAAGCAG
Gorilla_gorilla|16948               ---------CAGACG---GAGAAGACGACCCGCGTGCGGACTGTGCTGAACGAGAAGCAG
Cavia_porcellus|24856               ---------CAGGCG---GAGAAGACGACGCGGGTGCGGACGGTGCTGAACGAGAAGCAG
Pteropus_vampyrus|10382             ---------CAGGCG---GAGAAGACGACCCGCGTGCGCACGGTGCTCAACGAGAAGCAG
Tupaia_belangeri|12837              ---------CAGACG---GAGAAGACGACCCGCGTGCGGACCGTGCTCAACGAGAAGCAG
Otolemur_garnettii|2070             ---------CAGACG---GAGAAGACGACCCGCGTGCGGACTGTGCTGAACGAGAAGCAG
Ochotona_princeps|15487             ---------CCGGCG---GAGAAGACGACCCGCGTGCGCACGGTGCTCAACGAGAAGCAG
Mus_musculus|44064                  ---------CAGGCG---GAGAAGACAACCCGGGTACGGACTGTGCTCAACGAGAAGCAA
Rattus_norvegicus|33962             ---------CAGGCG---GAGAAGACAACCCGGGTGCGGACTGTGCTCAACGAGAAGCAA
Procavia_capensis|16748             ---------CAGACG---GAGAAGACAACCCGCGTGCGCACCGTGCTCAACGAGAAGCAG
Oryctolagus_cuniculus|21892         ---------CAGGCG---GAGAAGACGACCCGCGTGCGCACCGTGCTCAACGAGAAGCAA
Equus_caballus|1290                 ---------CAGACG---GAGAAGACGACCCGCGTGCGGACCGTGCTCAACGAGAAGCAG
Homo_sapiens|29496                  ---------CAGACG---GAGAAGACGACCCGCGTGCGGACTGTGCTGAACGAGAAGCAG
Pongo_abelii|9734                   ---------CAGACG---GAAAAGACGACCCGCGTGCGGACTGTGCTGAACGAGAAGCAG
Pan_troglodytes|13247               ---------CAGACG---GAGAAGACGACCCGCGTGCGGACTGTGCTGAACGAGAAGCAG
Rhesus_macaque|34621                ---------CAGACG---GAGAAGACGACCCGCGTGCGGACTGTGCTGAACGAGAAGCAG
Bos_taurus|13136                    ---------CAGACC---GAGAAGACAACCCGCGTGCGAACCGTGCTGAACGAGAAGCAG
Spermophilus_tridecemlineatus|5969  ---------CAGACG---GAGAAGACGACCCGAGTGCGGACTGTGCTCAACGAGAAGCAG
Dasypus_novemcinctus|10026          ---------CAGACG---GAGAAGACGACCCGCGTGCGGACCGTGCTCAACGAGAAGCAG
Choloepus_hoffmanni|1405            ---------CAGACC---GAGAAGACGACCCGCGTGCGGACCGTACTCAACGAGAAGCAG
Tursiops_truncatus|10256            ---------CAGACC---GAGAAGACAACCCGCGTGCGGACCGTGCTCAACGAGAAGCAG
Nematostella_vectensis|12483        ---------AGGAAAACTGATCGGCCGACAAGGGTTCGAACTGTGCTAAATGAAAAGCAG
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 ---------GGGTCGGACGGCAAGCCGACGCGAGTCCGCACGGTCTTGAACGAGAAGCAG
Ixodes_scapularis|17836             ------------------------------------------------GACAAGACGCGG
Pediculus_humanus|2973              AATAAAGTTTCATCCGACGGAAAACCGACGAGAGTGAGGACCGTCCTTAATGAAAAACAA
Nasonia_vitripennis|9293            ---GGCGGCGGCTCCGACGGCAAGCCGACGCGCGTGCGCACCGTGCTGAACGAGAAGCAG
Apis_mellifera|33486                AGCGGCGGCGGTTCAGACGGGAAACCAACCAGAGTTCGCACCGTTCTAAATGAGAAACAA
Linepithema_humile|6941             AGCGGCGGCGGATCCGACGGAAAACCGACGAGGGTGCGCACAGTTCTCAATGAGAAGCAG
Pogonomyrmex_barbatus|2677          ---------GGTTCCGACGGAAAACCGACGAGGGTGCGCACGGTTCTCAACGAGAAACAG
Culex_quinquefasciatus|15641        ---------CCGTCGGACGGCAAGCCGACCCGGGTGCGGACGGTGCTCAACGAGAAGCAG
Bombyx_mori|3274                    ---------GCGGCCGACGGTAAGCCGACCCGAGTCCGGACCGTGCTGAATGAAAAGCAA
Drosophila_persimilis|16405         ---------CCATCGGATGGCAAGCCAACGCGAGTTCGGACCGTGCTCAATGAAAAACAA
Drosophila_yakuba|7048              ---------CCCTCGGATGGCAAGCCAACGCGGGTTCGGACCGTGCTCAATGAGAAACAG
Drosophila_melanogaster|3349        ---------CCATCGGATGGCAAGCCCACGCGGGTTCGGACCGTGCTCAATGAGAAACAG
Drosophila_simulans|4567            ---------CCATCGGATGGCAAGCCCACGCGGGTTCGAACCGTGCTCAATGAGAAACAG
Drosophila_sechellia|11762          ---------CCATCGGATGGCAAGCCCACGCGGGTTCGGACCGTGCTCAATGAGAAACAG
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         CTC---AAAATTCTTCGAGACTGCTATTCGATTAATTCTCGACCTGATGCAACTCTGAAA
Danio_rerio|3280                    CTC---TGCATGCTTCAGACCTGTTACACTGCAAATCCCAGACCTGATGCTCTCATGAAA
Xenopus_tropicalis|17501            TTA---------------------------------------------------------
Branchiostoma_floridae|41009        CTT---CACACGTTACGGACTTGCTACGCGGCCAATCCGCGGCCTGACGCGTTGATGAAG
Tarsius_syrichta|14472              CTG---CACACCTTGCAGACCTGCTACGACGTCTATCCTCGGCCCGATGCGCTCATGAAC
Erinaceus_europaeus|8777            CTG---CACACCTTGCGGACCTGCTACGCCGCCAACCCCCGACCCGACGCGCTCATGAAG
Gorilla_gorilla|31558               CTT---GGCTTGCTGAAAACGGGCTTCAGCTCCCAGCCAGTCTCCCAAATCCTTTTTCCT
Gallus_gallus|22550                 CTT---CACACCTTGAGGACCTGCTACGCTGCCAACCCCAGACCCGACGCCCTCATGAAA
Fugu_rubripes|7786                  CTG---CACACGCTGCGCACCTGCTACAACGCCAACCCAAGGCCTGATGCCCtgatgaag
Rhesus_macaque|32038                CTG---CACACCTTGCGGACCTGCTATGCCGCAAACCCGCGGCCCGATGCGCTCATGAAG
Otolemur_garnettii|13561            CTG---CACACCTTGCGGACCTGCTACGCTGCAAACCCCCGG---GACGCGCTCATGAAG
Felis_catus|42581                   NNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|2006             CTN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Macropus_eugenii|9432               CTC---CACACATTGAGGACCTGCTATGCTGCTAACCCCAGACCTGACGCTCTCATGAAG
Tupaia_belangeri|2263               CTG---CACACCTTGCGGACCTGCTACGCCGCAAACCCCCGGCCTGATGCGCTCATGAAG
Canis_familiaris|21922              CTG---CACACCTTGCGGACCTGCTATGCCGCCAACCCCAGGCCAGACGCACTCATGAAG
Monodelphis_domestica|13648         CTT---CACACCTTGAGGACCTGCTATGCTGCCAACCCCAGACCTGATGCTCTCATGAAG
Gasterosteus_aculeatus|19757        CTG---CACACGCTGCGGACCTGCTACAACGCCAACCCGCGGCCCGACGCGCTCATGAAG
Callithrix_jacchus|44206            CTG---CACACCTTGCGGACCTGCTACGCAGCCAACCCGCGGCCTGATGCGCTCATGAAG
Ornithorhynchus_anatinus|25838      CTG---CATACCTTGAGGACCTGCTACGCGGCCAACCCGCGGCCGGACGCCCTCATGAAA
Danio_rerio|26298                   CTC---CATACCTTGAGGACTTGTTACAATGCCAACCCTCGACCCGACGCCCTCATGAAA
Anolis_carolinensis|1277            CTC---CACACTTTGCGGACCTGCTACGCCGCCAACCCGAGGCCCGACGCCCTCATGAAG
Sorex_araneus|14424                 CTG---CACACCTTGCGGACCTGCTACGCCGCCAACCCCCGGCCCGACGCGCTCATGAAG
Pteropus_vampyrus|9384              CTG---CACACCTTGCGGACCTGCTACGCCGCCAACCCGAGGCCTGACGCGCTCNNNNNN
Taeniopygia_guttata|18817           CTT---CACACCTTGAGGACCTGCTACGCTGCCAATCCCAGACCTGACGCCCTCATGAAA
Pongo_abelii|22055                  CTG---CACACCTTGCGGACCTGCTACGCCGCAAACCCGCGGCCAGATGCGCTCATGAAG
Ochotona_princeps|513               CTG---CACACCTTGCGGACCTGCTACGCTGCCAACCCTCGGCCCGACGCACTCATGAAG
Dipodomys_ordii|15885               CTG---CACACCTTGCGGACCTGCTATGCCGCCAATCCCCGGCCGGATGCTCTCATGAAG
Procavia_capensis|12972             TTG---CACACCTTGCGGACCTGCTACGCCGCCAATCCCCGGCCCGACGCGCTCATGAAG
Equus_caballus|14099                CTG---CACACCTTGCGGACCTGCTACGCCGCAAACCCCCGGCCCGACGCACTCATGAAG
Dasypus_novemcinctus|4895           CTG---CACACCTTGCGGACCTGCTACGCAGCCAACCCCCGGCCCGACGCGCTCATGAAG
Bos_taurus|12652                    CTG---CACACCTTGCGGACCTGCTATGCCGCTAACCCCCGGCCCGATGCGCTCATGAAG
Sus_scrofa|7945                     CTG---CACACCTTGAGGACCTGCTACGCCGCCAATCCCCGACCCGATGCACTCATGAAG
Oryctolagus_cuniculus|2869          CTG---CACACCTTGCGAACCTGCTACGCTGCCAACCCTCGGCCCGACGCGCTCATGAAG
Choloepus_hoffmanni|12539           CTG---CACACCTTGCGGACCTGCTATGCAGCCAACCCCCGGCCCGACGCGCTCATGAAG
Cavia_porcellus|12331               CTG---CACACCTTGCGGACCTGCTATGCTGCCAACCCTCGGCCGGATGCCCTCATGAAG
Echinops_telfairi|13551             TTG---CACACCTTGCGGACCTGCTACGCCGCCAACCCCCGGCCCGACGCGCTCATGAAG
Loxodonta_africana|24792            TTG---CACACCTTGCGGACCTGCTACGCAGCCAATCCCCGGCCCGACGCGCTCATGAAG
Mus_musculus|11820                  CTG---CACACCTTGCGGACCTGCTATGCCGCCAACCCTCGGCCAGATGCGCTCATGAAG
Pan_troglodytes|29600               CTG---CACACCTTGCGGACCTGCTACGCCGCAAACCCGCGGCCAGATGCGCTCATGAAG
Rattus_norvegicus|17976             CTG---CACACCTTGCGGACCTGCTACGCAGCCAACCCTCGGCCAGATGCGCTCATGAAG
Spermophilus_tridecemlineatus|13317 CTG---CACACCTTGCGGACCTGCTATGCTGCCAACCCCCGGCCTGATGCACTCATGAAG
Tursiops_truncatus|5249             CTG---CACACCTTGCGGACCTGCTACGCCGCCAACCCCCGGCCCGACGCGCTCATGAAG
Ornithorhynchus_anatinus|28681      CTC---CACACGCTGCGGACCTGCTACGCCGCCAACCCCAGGCCCGACGCCCTCATGAAG
Macropus_eugenii|7357               NNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|705              CTA---CATACATTACGTACATGCTATGCAGCCAATCCCCGTCCAGATGCCCTGATGAAG
Oryzias_latipes|15600               CTT---CACACGTTGCGAACCTGCTACAACGCGAACCCGCGGCCGGACGCGCTGATGAAG
Felis_catus|40996                   CTG---CAAACTCTGCGGACGTGCTATGCCGCCCATCCTCGGCCCGACGCGCTCATGAAG
Callithrix_jacchus|46809            CTG---CACACACTGCGGACCTGCTACGCCGCCAACCCGCGGCCCGATGCTCTCATGAAG
Microcebus_murinus|9605             CTG---CACACGCTGCGGACCTGCTACGCCGCCAACCCGCGGCCGGACGCGCTCATGAAG
Danio_rerio|29046                   CTC---CACACTTTACGGACGTGCTACAACGCAAACCCGCGACCAGATGCGCTCATGAAG
Oryzias_latipes|18527               CTT---CACACCCTGCGCACCTGCTACAACGCCAACCCCAGACCGGACGCCCTGATGAAG
Gasterosteus_aculeatus|2399         CTG---CACACGTTGCGGACCTGCTACAACGCGAACCCGAGGCCGGACGCGCTGATGAAG
Tetraodon_nigroviridis|13830        CTC---CACACGCTGCGGACGTGCTACAACGCCAACCCGAGGCCGGACGCGCTGATGAAG
Fugu_rubripes|30053                 CTC---CACACGCTGCGGACTTGCTACAACGCCAACCCGAGGCCGGACGCGCTGATGAAG
Tetraodon_nigroviridis|4572         CTC---CACACCCTGCGGACGTGCTACAACGCCAACCCGCGGCCGGACGCCCTGATGAAG
Fugu_rubripes|1098                  CTC---CACACCCTGCGGACCTGTTACAACGCCAACCCGCGGCCGGACGCCCTGATGAAG
Gasterosteus_aculeatus|22884        CTC---CACACCCTGCGGACCTGCTACAACGCCAACCCGCGACCGGACGCCCTGATGAAG
Danio_rerio|20797                   CTT---CACACCCTCCGGACGTGTTATAATGCAAACCCTCGACCGGACGCGCTAATGAAA
Otolemur_garnettii|1567             CTG---CACACCTTGCGGACCTGCTACGCTGCCAACCCCCGGCCCGACGCGCTCATGAAG
Monodelphis_domestica|57            CTG---CACACGCTGCGGACCTGCTACGCCGCCAACCCGAGGCCCGACGCGCTCATGAAG
Echinops_telfairi|972               CTG---CACACCCTGCGAACGTGCTACGCGGCCAACCCGCGGCCCGACGCGCTCATGAAG
Gorilla_gorilla|16948               CTG---CACACTCTGCGGACCTGCTACGCCGCCAACCCGCGGCCCGACGCTCTCATGAAG
Cavia_porcellus|24856               CTG---CACACGCTGAGGACCTGCTACGCCGCCAACCCGCGGCCCGACGCGCTCATGAAG
Pteropus_vampyrus|10382             CTG---CACACGCTGCGGACCTGCTACGCCGCCAACCCGCGGCCCGACGCGCTCATGAAG
Tupaia_belangeri|12837              CTG---CACACCCTGCGGACGTGCTACGCCGCCAACCCGCGACCGGACGCGCTCATGAAG
Otolemur_garnettii|2070             CTG---CACACTCTCCGTACCTGCTATGCCGCCAATCCGCGGCCAGACGCGCTCATGAAG
Ochotona_princeps|15487             CTG---CACACCCTGCGGACGTGCTACGCCGCGAACCCGAGGCCCGACGCGCTCATGAAG
Mus_musculus|44064                  CTG---CATACCCTGCGGACGTGCTACGCCGCCAATCCGCGGCCAGACGCGCTCATGAAA
Rattus_norvegicus|33962             CTG---CACACCCTGCGGACATGCTACGCCGCCAACCCGCGGCCCGACGCGCTCATGAAG
Procavia_capensis|16748             CTG---CACACGCTGCGGACGTGCTACGCGGCCAACCCGCGGCCCGACGCGCTGATGAAG
Oryctolagus_cuniculus|21892         CTG---CACACTCTGCGGACCTGCTACGCCGCCAACCCGCGGCCCGACGCGCTCATGAAG
Equus_caballus|1290                 CTG---CACACTCTGCGGACGTGCTATGCTGCCAACCCGCGGCCGGACGCACTCATGAAG
Homo_sapiens|29496                  CTG---CACACTCTGCGGACCTGCTACGCCGCCAACCCGCGGCCCGACGCTCTCATGAAG
Pongo_abelii|9734                   CTG---CACACTCTGCGGACCTGCTACGCCGCCAACCCGCGGCCCGACGCTCTCATGAAG
Pan_troglodytes|13247               CTG---CACACTCTGCGGACCTGCTACGCCGCCAACCCGCGACCCGACGCTCTCATGAAG
Rhesus_macaque|34621                CTG---CACACTCTGCGGACCTGCTACGCCGCCAACCCGCGGCCCGACGCTCTCATGAAG
Bos_taurus|13136                    CTGCACCACACTCTGCGGACGTGCTACGCCGCCAACCCGCGGCCCGACGCGCTCATGAAG
Spermophilus_tridecemlineatus|5969  CTG---CACACTCTGAGGACGTGCTACGCCGCCAACCCGCGGCCAGATGCGCTCATGAAG
Dasypus_novemcinctus|10026          CTG---CACACCCTGCGGACGTGCTACGCGGCCAACCCGCGGCCCGACGCGCTCATGAAG
Choloepus_hoffmanni|1405            CTG---CACACTCTGCGGACGTGTTACGCGGCCAACCCGCGGCCCGACGCACTCATGAAG
Tursiops_truncatus|10256            CTG---CACACTCTGCGGACGTGCTACGCCGCTAACCCGCGGCCCGACGCGCTCATGAAG
Nematostella_vectensis|12483        CTT---CATACGCTAAGGACTTGTTACAATGCGAACCCCCGGCCGGACGCCATGATGAAA
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 CTG---CACACGCTGCGCACCTGCTACGCGGCCAATCCCCGTCCCGACGCCCTGATGAAG
Ixodes_scapularis|17836             ATG---------------------------------------------------------
Pediculus_humanus|2973              TTA---CACACGCTTCGTACCTGTTACGCGGCAAATCCTCGACCTGATGCTCTTATGAAA
Nasonia_vitripennis|9293            CTG---CACACGCTGCGCACTTGCTACGCGGCCAACCCGAGACCCGACGCTCTCATGAAG
Apis_mellifera|33486                CTT---CATACTTTGAGGACTTGCTATGCCGCGAATCCACGACCGGATGCGTTGATGAAA
Linepithema_humile|6941             TTA---CACACTCTCAGAACTTGCTACGCTGCGAACCCGCGCCCGGATGCACTTATGAAG
Pogonomyrmex_barbatus|2677          TTG---CACACCCTGAGAACCTGCTACGCTGCGAATCCTCGCCCGGATGCTCTCATGAAG
Culex_quinquefasciatus|15641        CTA---CAGACCCTAAGAACCTGCTACAACGCCAACCCCCGGCCGGACGCGCTCATGAAG
Bombyx_mori|3274                    CTG---CACACGTTACGGACTTGCTACGCCGCCAACCCACGTCCGGACGCACTGATGAAG
Drosophila_persimilis|16405         CTG---CATACACTGAGAACCTGCTACAATGCTAATCCGCGACCTGATGCGCTCATGAAG
Drosophila_yakuba|7048              CTG---CATACGCTCAGAACCTGCTACAACGCTAATCCGCGACCTGATGCGCTCATGAAG
Drosophila_melanogaster|3349        CTG---CATACGCTCAGAACCTGCTACAATGCTAATCCGCGACCTGATGCGCTCATGAAG
Drosophila_simulans|4567            CTG---CATACGCTCAGAACCTGCTACAATGCTAATCCGCGACCTGATGCGCTCATGAAG
Drosophila_sechellia|11762          CTG---CATACGCTCAGAACCTGCTACAATGCTAATCCGCGACCTGATGCGCTCATGAAG
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         GAACGACTTGTTGAGATGACTGGACTCAGTGCACGAGTGATACGAGTATGGTTCCAGAAT
Danio_rerio|3280                    GAGCAGCTGGTTGAAATGACTGGTCTCAGTCCTCGGGTCATTCGTGTCTGGTTCCAGAAC
Xenopus_tropicalis|17501            ------------------------------------------------TTCCTGTTGGGA
Branchiostoma_floridae|41009        GAACAGTTAGTGGAGATGACAGGCCTCTCACCCCGTGTCATCAGGGTGTGGTTCCAGAAC
Tarsius_syrichta|14472              GAACAACTGGTGGAGATGACGGGCCTC---CCCCGCGTGATCCGGGTCTGGTTTCAAAAC
Erinaceus_europaeus|8777            GAGCAACTGGTGGAGATGACGGGCCTCAGCCCCCGTGTGATCCGGGTCTGGTTTCAAAAC
Gorilla_gorilla|31558               TGTGAGTTGCTTCACAGTAAGGGGGAAGAAGAAAATCAAAGTAGAATTTGGTTTAATAAG
Gallus_gallus|22550                 GAGCAACTGGTAGAAATGACTGGCCTCAGTCCGAGGGTCATCAGGGTTTGGTTTCAAAAC
Fugu_rubripes|7786                  gagcagctggtggagatgaCCGGCCTGAGCCCGCGAGTGATCCGAGTCTGGTTCCAGAAT
Rhesus_macaque|32038                GAGCAACTGGTAGAGATGACGGGCCTCAGTCCCCGTGTGATCCGGGTCTGGTTTCAAAAC
Otolemur_garnettii|13561            GAGCCACTGGGGGAGATGACGGGCCTCAGCCCTCGTATCGGAGCC------TTTCAAAAT
Felis_catus|42581                   NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|2006             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Macropus_eugenii|9432               GAGCAACTAGTGGAAATGACTGGCCTCAGCCCCCGGGTGATCAGGGTCTGGTTTCAGAAC
Tupaia_belangeri|2263               GAGCAACTGATGAAGATGACGGGCCTCAGCCCGCGCGTGATCCGGGTCTGGTTTCAAAAC
Canis_familiaris|21922              GAGCAACTGGTGGAGATGACGGGCCTTAGCCCTCGTGTGATCCGGGTCTGGTTTCAAAAC
Monodelphis_domestica|13648         GAGCAACTAGTGGAAATGACTGGCCTCAGCCCTAGAGTGATCAGGGTCTGGTTTCAAAAC
Gasterosteus_aculeatus|19757        GAGCAGCTGGTGGAGATGACGGGCCTCAGCCCGCGCGTCATACGCGTGTGGTTCCAGAAC
Callithrix_jacchus|44206            GAGCAACTAGTAGAGATGACAGGCCTCAGTCCCCGAGTGATCCGGGTCTGGTTTCAAAAC
Ornithorhynchus_anatinus|25838      GAGCAGCTGGTGGAGATGACCGGGCTGAGCCCCCGGGTCATCCGCGTCTGGTTCCAGAAC
Danio_rerio|26298                   GAGCAGCTCGTTGAGATGACGGGTCTTAGTCCGAGAGTCATCAGGGTTTGGTTTCAAAAC
Anolis_carolinensis|1277            GAGCAACTGGTGGAAATGACTGGCCTCAGTCCCAGGGTCATCCGGGTCTGGTTTCAAAAC
Sorex_araneus|14424                 GAGCAACTGGTGGAGATGACTGGTCTTAGCCCGCGGGTGATCCGGGTCTGGTTTCAAAAC
Pteropus_vampyrus|9384              NAGCAACTAGTGGAGATGACTGGCCTCAGCCCGCGCGTGATCCGGGTCTGGTTTCAGAAC
Taeniopygia_guttata|18817           GAGCAACTGGTAGAAATGACTGGCCTCAGCCCGAGGGTCATCAGGGTTTGGTTTCAAAAC
Pongo_abelii|22055                  GAGCAACTGGTAGAGATGACGGGCCTCAGTCCCCGTGTGATCCGGGTCTGGTTTCAAAAC
Ochotona_princeps|513               GAGCAACTGGTGGAGATGACGGGCCTCAGTCCCCGCGTGATCCGGGTCTGGTTTCAAAAC
Dipodomys_ordii|15885               GAGCAACTGGTGGAGATGACAGGCCTCAGCCCCCGCGTGATCCGAGTGTGGTTTCAGAAC
Procavia_capensis|12972             GAGCAGCTGGTGGAGATGACGGGCCTCAGCCCCCGTGTGATCCGGGTCTGGTTTCAGAAC
Equus_caballus|14099                GAGCAACTGGTGGAGATGACGGGCCTCAGCCCGCGCGTGATCCGGGTCTGGTTTCAGAAC
Dasypus_novemcinctus|4895           GAGCAACTCGTGGAGATGACGGGCCTCAGCCCCCGCGTAATCCGGGTCTGGTTTCAAAAC
Bos_taurus|12652                    GAGCAACTGGTGGAGATGACCGGCCTCAGTCCCCGTGTGATCCGGGTCTGGTTTCAGAAC
Sus_scrofa|7945                     GAGCAACTGGTGGAGATGACCGGCCTCAGTCCCCGCGTGATCCGGGTCTGGTTTCAGAAC
Oryctolagus_cuniculus|2869          GAGCAACTGGTGGAGATGACTGGCCTCAGCCCCCGCGTGATCCGGGTCTGGTTTCAAAAC
Choloepus_hoffmanni|12539           GAGCAACTAGTGGAGATGACTGGCCTCAGCCCCCGCGTGATCCGGGTCTGGTTTCAGAAC
Cavia_porcellus|12331               GAGCAACTGGTGGAGATGACGGGTCTCAGCCCACGCGTGATTCGAGTCTGGTTTCAAAAC
Echinops_telfairi|13551             GAGCAACTAGTAGAGATGACTGGCCTCAGCCCCCGCGTGATCCGGGTCTGGTTTCAAAAC
Loxodonta_africana|24792            GAGCAACTGGTGGAGATGACGGGCCTCAGCCCCCGCGTGATCCGGGTCTGGTTTCAAAAC
Mus_musculus|11820                  GAGCAACTAGTGGAGATGACGGGCCTCAGTCCCAGAGTCATCCGAGTGTGGTTTCAAAAC
Pan_troglodytes|29600               GAGCAACTGGTAGAGATGACGGGCCTCAGTCCCCGTGTGATCCGGGTCTGGTTTCAAAAC
Rattus_norvegicus|17976             GAGCAACTAGTGGAGATGACCGGCCTCAGTCCCCGAGTCATCCGGGTCTGGTTTCAAAAC
Spermophilus_tridecemlineatus|13317 GAGCAACTAGTGGAGATGACAGGCCTCAGCCCCCGCGTGATCCGAGTCTGGTTTCAAAAC
Tursiops_truncatus|5249             GAGCAACTGGTGGAGATGACCGGCCTCAGTCCCCGCGTGATCCGGGTCTGGTTTCAGAAC
Ornithorhynchus_anatinus|28681      GAGCAGCTGGTGGAGATGACCGGCCTCAGCCCCAGGGTCATCCGCGTCTGGTTCCAGAAC
Macropus_eugenii|7357               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|705              GAACAGCTGGTTGAAATGACTGGACTCAGTCCGCGGGTTATCCGAGTATGGTTTCAGAAC
Oryzias_latipes|15600               GAGCAGCTGGTGGAAATGACCGGCCTCAGTCCCAGAGTCATCCGGGTGTGGTTCCAGAAC
Felis_catus|40996                   GAGCAGCTGGTGGAGATGACGGGCCTGAGCCCACGGGTCATCCGCGTCTGGTTCCAGAAC
Callithrix_jacchus|46809            GAGCAGCTGGTGGAGATGACCGGCCTGAGCCCGCGGGTCATCCGCGTCTGGTTCCAGAAT
Microcebus_murinus|9605             GAGCAGCTGGTGGAGATGACCGGCCTGAGCCCGCGGGTCATCCGCGTCTGGTTCCAGAAC
Danio_rerio|29046                   GAGCAGCTGGTGGAGATGACAGGCCTGAGCCCGCGGGTCATTCGAGTCTGGTTCCAAAAC
Oryzias_latipes|18527               GAGCAGCTGGTGGAGATGACCGGCCTCAGCCCCCGGGTGATCCGCGTCTGGTTTCAGAAC
Gasterosteus_aculeatus|2399         GAGCAGCTGGTGGAGATGACCGGCCTCAGCCCGCGGGTGATCCGGGTGTGGTTCCAGAAC
Tetraodon_nigroviridis|13830        GAGCAGCTGGTGGAGATGACCGGCCTGAGCCCCAGGGTGATCCGGGTCTGGTTCCAGAAC
Fugu_rubripes|30053                 GAGCAGCTGGTGGAGATGACCGGCCTGAGCCCCAGAGTGATTCGGGTTTGGTTCCAGAAC
Tetraodon_nigroviridis|4572         GAGCAGCTGGTGGAGATGACCGGCCTGAGCCCCAGGGTGGTCCGGGTCTGGTTCCAGAAC
Fugu_rubripes|1098                  GAGCAGCTGGTGGAGATGACCGGCCTGAGCCCCCGGGTGGTCCGGGTCTGGTTCCAGAAC
Gasterosteus_aculeatus|22884        GAGCAGCTGGTGGAGATGACCGGCCTGAGCCCGAGGGTGATCCGCGTCTGGTTCCAGAAC
Danio_rerio|20797                   GAGCAGCTCGTGGAAATGACCGGCCTGAGCCCACGGGTCATACGAGTGTGGTTCCAAAAC
Otolemur_garnettii|1567             GAGCAACTGGTGGAGATGACGGGCCTCAGCCCTCGTGTGATCCGAGTCTGGTTTCAAAAC
Monodelphis_domestica|57            GAGCAGCTGGTGGAGATGACGGGCCTGAGCCCGCGAGTCATCCGCGTCTGGTTCCAGAAC
Echinops_telfairi|972               GAGCAGCTGGTGGAGATGACCGGCCTGAGCTCGAGGGTCATCCGCGTCTGGTTCCGAAAT
Gorilla_gorilla|16948               GAGCAGCTGGTGGAGATGACCGGCCTGAGTCCGCGGGTCATCCGCGTCTGGTTCCAGAAC
Cavia_porcellus|24856               GAGCAGCTGGTGGAGATGACCGGGCTGAGCCCGCGCGTCATCCGCGTCTGGTTCCAGAAC
Pteropus_vampyrus|10382             GAGCAGCTGGTGGAGATGACCGGCCTGAGCCCGCGGGTCATCCGCGTCTGGTTCCAGAAC
Tupaia_belangeri|12837              GAGCAGCTGGTGGAGATGACCGGCCTGAGCCCGCGGGTCATCCGCGTCTGGTTCCAGAAC
Otolemur_garnettii|2070             GAACAGCTGGTGGAGATGACCGGCCTGAGCCCGCGTGTCATCCGCGTCTGGTTCCAGAAC
Ochotona_princeps|15487             GAGCAGCTGGTGGAGATGACCGGCCTGAGCCCGCGGGTCATCCGCGTCTGGTTCCAGAAC
Mus_musculus|44064                  GAGCAGCTAGTAGAGATGACCGGCTTGAGCCCGCGGGTCATCCGCGTGTGGTTTCAGAAC
Rattus_norvegicus|33962             GAGCAGCTGGTAGAGATGACCGGCTTGAGCCCGCGGGTCATCCGCGTGTGGTTTCAGAAC
Procavia_capensis|16748             GAGCAGCTGGTGGAAATGACCGGCCTGAGCCCGCGGGTCATCCGAGTTTGGTTTCAGAAC
Oryctolagus_cuniculus|21892         GAGCAGCTGGTGGAGATGACCGGCCTGAGCCCGCGGGTCATCCGCGTGTGGTTCCAGAAC
Equus_caballus|1290                 GAGCAGCTGGTGGAGATGACTGGCCTGAGCCCGCGGGTCATCCGCGTTTGGTTCCAGAAC
Homo_sapiens|29496                  GAGCAGCTGGTGGAGATGACCGGCCTGAGCCCGCGGGTCATCCGCGTCTGGTTCCAGAAC
Pongo_abelii|9734                   GAGCAGCTGGTGGAGATGACCGGCCTGAGCCCGCGGGTCATCCGCGTCTGGTTCCAGAAC
Pan_troglodytes|13247               GAGCAGCTGGTGGAGATGACCGGCCTGAGCCCGCGGGTCATCCGCGTCTGGTTCCAGAAC
Rhesus_macaque|34621                GAGCAGCTGGTGGAGATGACCGGCCTGAGCCCGCGGGTCATCCGCGTCTGGTTCCAGAAC
Bos_taurus|13136                    GAGCACCTGGTGGAGATGACCGGCCTGAGCCCGCGGGTCATCCGCGTCTGGTTCCAGAAC
Spermophilus_tridecemlineatus|5969  GAACAACTTGTGGAGATGACCGGCCTGAGCCCGCGGGTCATCCGCGTATGGTTCCAGAAC
Dasypus_novemcinctus|10026          GAGCAGCTGGTGGAGATGACCGGCCTGAGCCCGCGGGTCATCCGCGTCTGGTTCCAGAAC
Choloepus_hoffmanni|1405            GAGCAGCTGGTGGAGATGACCGGCCTGAGCCCGCGGGTCATCCGCGTTTGGTTCCAGAAC
Tursiops_truncatus|10256            GAGCAGCTGGTGGAGATGACCGGCCTGAGCCCGCGGGTCATACGCGTCTGGTTCCAGAAC
Nematostella_vectensis|12483        GAACAACTAGTGGAAATGACGGGTCTGAGTCCGCGAGTCATAAGAGTCTGGTTTCAAAAC
Pogonomyrmex_barbatus|2673          ------------------------------------------AGAACTTTTTTTGAGGGT
Daphnia_pulex|19417                 GAGCAGCTGGTGGAGATGACGGGCCTGTCGCCGCGGGTGATCCGCGTCTGGTTCCAGAAC
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              GAACAATTAGTTGAAATGACAGGTTTAAGTCCGAGAGTGATTCGCGTTTGGTTTCAAAAT
Nasonia_vitripennis|9293            GAGCAGCTCGTCGAGATGACGGGATTGAGTCCGAGGGTCATCAGGGTCTGGTTCCAGAAC
Apis_mellifera|33486                GAACAATTAGTCGAGATGACAGGCTTAAGTCCACGAGTAATCAGGGTATGGTTCCAGAAC
Linepithema_humile|6941             GAACAGCTCGTTGAGATGACCGGACTAAGTCCGCGTGTGATCAGGGTATGGTTTCAGAAC
Pogonomyrmex_barbatus|2677          GAACAACTTGTCGAGATGACGGGATTGAGTCCGCGTGTCATCAGGGTATGGTTTCAAAAC
Culex_quinquefasciatus|15641        GAGCAGCTGGTGGAGATGACGGGCCTGTCGCCCCGCGTCATCCGGGTGTGGTTCCAGAAC
Bombyx_mori|3274                    GAGCAGCTCGTGGAGATGACCGGCCTCAGTCCAAGGGTCATCAGGGTCTGGTTCCAGAAC
Drosophila_persimilis|16405         GAGCAACTGGTTGAGATGACAAGCCTCTCGCCGAGAGTCATACGGGTCTGGTTCCAGAAC
Drosophila_yakuba|7048              GAGCAGCTGGTGGAGATGACGAGTCTGTCCCCGCGAGTCATCCGAGTGTGGTTCCAGAAC
Drosophila_melanogaster|3349        GAGCAGCTGGTGGAGATGACGAGCCTGTCGCCGCGAGTCATCCGAGTATGGTTCCAGAAC
Drosophila_simulans|4567            GAGCAGCTGGTGGAGATGACGAGCCTGTCGCCGCGAGTCATCCGAGTGTGGTTCCAGAAC
Drosophila_sechellia|11762          GAGCAGCTGGTGGAGATGACGAGCCTGTCGCCGCGAGTCATCCGAGTGTGGTTCCAGAAC
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         AAACGATGCAAGGACAAGAAGCGACAAATTCAAATAACAGAGAAT---CGGCTAAAC---
Danio_rerio|3280                    AAGAGATGCAAAGATAAGAAGAGAAGTCTGACCATGAGACACACA---CAGAAGCAG---
Xenopus_tropicalis|17501            GCTCGTTGTGCT------------------------------------------------
Branchiostoma_floridae|41009        AAACGATGTAAAGACAAAAAGAAATCTATCCTCATGAAACAAATG---CAAGAACAAGCT
Tarsius_syrichta|14472              AAGCGTTGCAAGGACAACAAACTAAGCATCATGATGAATCAGCTC---CAACAACAG---
Erinaceus_europaeus|8777            AAGCGGTGCAAGGACAAGAAGCGGAGCATCATGATGAAACAGCTC---CAGCAGCAG---
Gorilla_gorilla|31558               GTCCATGCAGAC---------------CTAATAGTCCAGCCCACA---GAGGCAGAA---
Gallus_gallus|22550                 AAGCGATGCAAGGACAAAAAAAGAAGCATTATGATGAAGCAACTT---CAGCAGCAG---
Fugu_rubripes|7786                  AAGCGGTgcaaagacaagaagaagagcCTGCTGAtgaagcagctc---cagcagcag---
Rhesus_macaque|32038                AAGCGGTGCAAGGACAAGAAGCGAAGCATCATGATGAAGCAACTC---CAGCAGCAG---
Otolemur_garnettii|13561            AGGCGG------GGGGGTAAAAAGCGAATTATGCTGCTCCACACA---CATCAGTCC---
Felis_catus|42581                   NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNN---
Microcebus_murinus|2006             NAGCGGTGCAAGGACAAGAAGCGAAGCATCATGATGAAGCAGCTC---CAGCAGCAG---
Macropus_eugenii|9432               AAGAGGTGTAAGGACAAAAAGCGGAGTATCATGATGAAACAGCTC---CAGCAGCAG---
Tupaia_belangeri|2263               AAGCGGTGCAAGGGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---
Canis_familiaris|21922              AAGCGGTGCAAGGACAAGAAGCGGAGCATCATGATGAAGCAGCTC---CAGCAGCAG---
Monodelphis_domestica|13648         AAGAGGTGTAAGGACAAAAAGCGGAGCATCATGATGAAACAGCTC---CAGCAGCAG---
Gasterosteus_aculeatus|19757        AAGCGGTGCAAGGACAAGAAGCGCAGCATCCTGATGAAGCAGCTG---CAGCAGCAG---
Callithrix_jacchus|44206            AAGCGGTGCAAGGACAAGAAGCGAAGCATCATGATGAAGCAACTC---CAGCAGCAG---
Ornithorhynchus_anatinus|25838      AAGCGCTGTAAGGACAAGAAGCGCAGCATCATGATGAAACAGCTG---CAGCAGCAA---
Danio_rerio|26298                   AAGCGCTGCAAGGATAAAAAGAGGAGCATACTGATGAAGCAACTC---CAGCAGCAG---
Anolis_carolinensis|1277            AAGCGCTGCAAGGACAAGAAGCGGAGCATCATGATGAAGCAGCTA---CAGCAGCAG---
Sorex_araneus|14424                 AAGCGGTGCAAGGACAAGAAGCGGAGCATTATGATGAAGCAACTC---CAGCAGCAG---
Pteropus_vampyrus|9384              AAGCGGTGCAAGGACAAGAAGCGGAGCATCATGATGAAGCAGCTC---CAGCAGCAG---
Taeniopygia_guttata|18817           AAGCGAtgcaaggacaaaaaaaggagCATTATGATGAAGcaactt---cagcagcag---
Pongo_abelii|22055                  AAGCGGTGCAAGGACAAGAAGCGAAGCATCATGATGAAGCAACTC---CAGCAGCAG---
Ochotona_princeps|513               AAGCGGTGCAAGGACAAGAAGAGGAGCATCATGATGAAGCAGCTC---CAGCAGCAG---
Dipodomys_ordii|15885               AAGCGGTGCAAAGACAAGAAGCGAAGCATCATGATGAAGCAGCTC---CAGCAACAA---
Procavia_capensis|12972             AAGCGGTGCAAGGACAAGAAGCGCAGCATCATGATGAAGCAGCTT---CAGCAGCAG---
Equus_caballus|14099                AAGCGGTGCAAGGACAAGAAGCGGAGCATCATGATGAAGCAGCTC---CAGCAGCAG---
Dasypus_novemcinctus|4895           AAGCGGTGCAAGGACAAGAAGCGGAGCATCATGATGAAGCAGCTC---CAGCAGCAG---
Bos_taurus|12652                    AAGCGGTGCAAGGATAAGAAGCGGAGCATCATGATGAAGCAGCTC---CAGCAACAG---
Sus_scrofa|7945                     AAGCGGTGCAAGGACAAGAAGCGGAGCATTATGATGAAGCAGCTA---CAGCAGCAG---
Oryctolagus_cuniculus|2869          AAGCGGTGCAAGGACAAGAAGCGGAGCATCATGATGAAGCAACTC---CAGCAGCAG---
Choloepus_hoffmanni|12539           AAGCGGTGCAAGGACAAGAAGCGGAGCATTATGATGAAACAGCTT---CAGCAGCAG---
Cavia_porcellus|12331               AAGCGGTGCAAGGACAAGAAGCGGAGCATCATGATGAAGCAGCTC---CAGCAGCAG---
Echinops_telfairi|13551             AAGCGATGCAAGGACAAGAAACGGAGCATCATGATGAAGCAGCTC---CAGCAGCAG---
Loxodonta_africana|24792            AAGCGCTGCAAGGACAAGAAGCGCAGCATCATGATGAAGCAGCTC---CAGCAGCAG---
Mus_musculus|11820                  AAGCGGTGCAAGGACAAGAAACGCAGCATCATGATGAAGCAGCTC---CAGCAGCAG---
Pan_troglodytes|29600               AAGCGGTGCAAGGACAAGAAGCGAAGCATCATGATGAAGCAACTC---CAGCAGCAG---
Rattus_norvegicus|17976             AAGAGGTGCAAGGACAAGAAACGCAGCATCATGATGAAGCAGCTC---CAGCAGCAG---
Spermophilus_tridecemlineatus|13317 AAGCGGTGCAAGGATAAGAAGCGGAGCATCATGATGAAGCAGCTA---CAGCAGCAG---
Tursiops_truncatus|5249             AAGCGGTGCAAGGACAAGAAGCGGAGCATCATGATGAAGCAGCTC---CAGCAGCAG---
Ornithorhynchus_anatinus|28681      AAGCGCTGCAAGGACAAGAAGAAATCCATCCTCATGAAGCAGCTG---CAACAGCAG---
Macropus_eugenii|7357               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNN---
Xenopus_tropicalis|705              AAGCGATGTAAAGACAAGAAGAAATCCATTCTCATGAAACAGCTC---CAGCAGCAG---
Oryzias_latipes|15600               AAGCGCTGCAAGGACAAGAAGAAATCCATCCTCAtgaagcagctt---cagcagcag---
Felis_catus|40996                   AAGCGCTGCAAAGACAAGAAGAAATCCATCCTCATGAAGCAGCTG---CAGCAGCAG---
Callithrix_jacchus|46809            AAGCGCTGCAAAGACAAGAAGAAATCCATTCTCATGAAGCAGCTG---CAGCAGCAG---
Microcebus_murinus|9605             AAGCGCTGCAAGGACAAGAAGAAATCCATTCTTATGAAGCAGCTG---CAGCAGCAG---
Danio_rerio|29046                   AAGCGCTGCAAGGATAAGAAGAGATCCATACTAATGAAACAGTTA---CAGCAGCAG---
Oryzias_latipes|18527               AAACGCTGCAAAGACAAGAAGAAGTCCATCCTCATGAAGCaaatt---cagcagcag---
Gasterosteus_aculeatus|2399         AAGCGCTGCAAAGACAAGAAGAGGTCCATCTTGATGAAGCAGCTC---CAGCAGCAG---
Tetraodon_nigroviridis|13830        AAGCGCTGCAAAGACAAGAAGAAGGCACAGCTGATGAAGCAACTG---CAGCAGCAG---
Fugu_rubripes|30053                 AAACGCTGCAAAGACAAGAAGAAGGCGCAACTGATGAAGCAGCTG---CAGCAACAG---
Tetraodon_nigroviridis|4572         AAGCGCTGCAAGGACAAGAAGAGATCCATCATGATGAAGCAGCTCCAGCAGCAGCAG---
Fugu_rubripes|1098                  AAGCGCTGCAAGGACAAGAAGAGGTCCATCTTGATGAAGCAGCTG---CAGCAGCAG---
Gasterosteus_aculeatus|22884        AAGCGCTGCAAAGACAAGAAGAGGTCCATCCTGATGAAGCAGCTC---CAAACACAG---
Danio_rerio|20797                   AAACGCTGCAAAGACAAGAAGAAGTCCATACTCATGAAACAACTA---CAGCAACAG---
Otolemur_garnettii|1567             AAGCGGTGCAAGGATAAGAAGCGAAGCATCATGATGAAGCAGCTC---CAACAGCAG---
Monodelphis_domestica|57            AAACGCTGCAAGGACAAGAAGAAATCCATCCTTATGAAGCAGCTG---CAGCAGCAA---
Echinops_telfairi|972               AAGCGCTGCAAGGACCAGAAGAAATCCATCCTCATGAAGCAGCTG---CAGCAGCAG---
Gorilla_gorilla|16948               AAGCGCTGCAAGGACAAGAAGAAATCCATTCTCATGAAGCAGCTG---CAGCAGCAG---
Cavia_porcellus|24856               AAGCGCTGCAAGGACAAGAAGAAGTCGATCCTCATGAAGCAGTTG---CAGCAGCAG---
Pteropus_vampyrus|10382             AAGCGTTGCAAGGACAAGAAGAAATCC---------------------------------
Tupaia_belangeri|12837              AAGCGCTGCAAGGACAAGAAGAAATCCATCCTCATGAAGCAGCTG---CAGCAGCAG---
Otolemur_garnettii|2070             AAGCGCTGCAAGGATAAGAAGAAATCCATTCTAATGAAGCAGCTG---CAGCAGCAG---
Ochotona_princeps|15487             AAGCGCTGCAAGGACAAGAAGAAATCCATCCTTATGAAGCAGCTG---CAGCAGCAA---
Mus_musculus|44064                  AAGCGTTGCAAGGACAAGAAGAAGTCCATTCTCATGAAGCAGCTA---CAGCAGCAG---
Rattus_norvegicus|33962             AAGCGTTGCAAGGACAAGAAGAAGTCCATTCTCATGAAGCAGCTA---CAGCAGCAG---
Procavia_capensis|16748             AAGCGTTGCAAGGACAAGAAGAAATCCATTCTCATGAAGCAGCTG---CAGCAGCAG---
Oryctolagus_cuniculus|21892         AAACGCTGCAAAGACAAGAAGAAATCCATCCTCATGAAGCAGCTG---CAGCAGCAG---
Equus_caballus|1290                 AAGCGTTGCAAGGACAAGAAGAAATCCATCCTCATGAAACAGCTG---CAGCAGCAG---
Homo_sapiens|29496                  AAGCGCTGCAAGGACAAGAAGAAATCCATTCTCATGAAGCAGCTG---CAGCAGCAG---
Pongo_abelii|9734                   AAGCGCTGCAAGGACAAGAAGAAATCCATTCTCATGAAGCAGCTG---CAGCAGCAG---
Pan_troglodytes|13247               AAGCGCTGCAAGGACAAGAAGAAATCCATTCTCATGAAGCAGCTG---CAGCAGCAG---
Rhesus_macaque|34621                AAGCGCTGCAAGGACAAGAAGAAATCCATTCTCATGAAGCAGCTG---CAGCAGCAG---
Bos_taurus|13136                    AAGCGGTGCAAGGACAAGAAGAAATCCATCCTCATGAAGCAACTG---CAGCAGCAG---
Spermophilus_tridecemlineatus|5969  AAGCGGTGCAAGGACAAGAAGAAATCCATTCTTATGAAGCAGCTG---CAACAACAG---
Dasypus_novemcinctus|10026          AAGCGCTGCAAGGACAAGAAGAAATCCATCCTCATGAAGCAGCTG---CAGCAGCAG---
Choloepus_hoffmanni|1405            AAGCGCTGCAAGGACAAGAAGAAATCCATCCTCATGAAGCAGCTG---CAGCAGCAG---
Tursiops_truncatus|10256            AAGCGGTGCAAGGACAAGAAGAAATCCATCCTCATGAAGCAGCTG---CAGCAGCAG---
Nematostella_vectensis|12483        AAGCGTTGCAAGGATAAGAAAAAGAAC------CCTAATAGTCTT---------------
Pogonomyrmex_barbatus|2673          GAAAGA------------------------------------------------------
Daphnia_pulex|19417                 AAGCGCTGCAAGGACAAGAAGAAGGCCATCCTGATGAAGCAGATC---CAGCAGCAA---
Ixodes_scapularis|17836             ------------------------------------------------GAGGAAGAG---
Pediculus_humanus|2973              AAAAGGTGTAAAGATAAAAAAAGAGCAATATTAATGAAACAGCAA---TTGCAACAG---
Nasonia_vitripennis|9293            AAGCGCTGCAAGGACAAGAAGAAGACCATCGCTATGAAGCAGCAGATGCAGCAGGAG---
Apis_mellifera|33486                AAACGGTGCAAAGATAAAAAGAAAACGATCGCCATGAAACAACAA---ATGCAAGAA---
Linepithema_humile|6941             AAGAGATGCAAGGATAAGAAAAAGACGATCGCTCTGAAGCAGCAA---ATGCAAGAA---
Pogonomyrmex_barbatus|2677          AAGAGGTGCAAGGATAAAAAAAAGACAATCGCCATGAAGCAGCAA---ATGCAGGAG---
Culex_quinquefasciatus|15641        AAACGCTGCAAGGACAAGAAGAAAACCATCCAGATGAAGCTGCAGATGCAACAGGAGAAG
Bombyx_mori|3274                    AAACGGTGCAAAGACAAAAAAAAGACGTTGCAGCTCAAAATGCAG---ATGCAACAA---
Drosophila_persimilis|16405         AAGCGCTGCAAGGACAAGAAGAAGACCATCCAAATGAAGCTGCAAATGCAACAGGAG---
Drosophila_yakuba|7048              AAGCGCTGCAAGGACAAGAAGAAGACCATCCAGATGAAGCTGCAAATGCAGCAGGAG---
Drosophila_melanogaster|3349        AAGCGCTGCAAGGACAAGAAGAAGACCATTCAGATGAAGCTGCAAATGCAGCAGGAG---
Drosophila_simulans|4567            AAGCGCTGCAAGGACAAGAAGAAGACCATCCAGATGAAGCTGCAA---ATGCAGCAG---
Drosophila_sechellia|11762          AAGCGCTGCAAGGACAAAAAGAAGACCATCCAGATGAAGCTGCAA---ATGCAGCAG---
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         ------------------------------------------------------------
Danio_rerio|3280                    ------------------------------------------------------------
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        TCAAAACAGGACCTTTCTTCAGACTCTATCGTGTGGGACACGCTACCTGATGACATGACT
Tarsius_syrichta|14472              ------------------------------------------------------------
Erinaceus_europaeus|8777            ------------------------------------------------------------
Gorilla_gorilla|31558               ------------------------------------------------------------
Gallus_gallus|22550                 ------------------------------------------------------------
Fugu_rubripes|7786                  ------------------------------------------------------------
Rhesus_macaque|32038                ------------------------------------------------------------
Otolemur_garnettii|13561            ------------------------------------------------------------
Felis_catus|42581                   ------------------------------------------------------------
Microcebus_murinus|2006             ------------------------------------------------------------
Macropus_eugenii|9432               ------------------------------------------------------------
Tupaia_belangeri|2263               ------------------------------------------------------------
Canis_familiaris|21922              ------------------------------------------------------------
Monodelphis_domestica|13648         ------------------------------------------------------------
Gasterosteus_aculeatus|19757        ------------------------------------------------------------
Callithrix_jacchus|44206            ------------------------------------------------------------
Ornithorhynchus_anatinus|25838      ------------------------------------------------------------
Danio_rerio|26298                   ------------------------------------------------------------
Anolis_carolinensis|1277            ------------------------------------------------------------
Sorex_araneus|14424                 ------------------------------------------------------------
Pteropus_vampyrus|9384              ------------------------------------------------------------
Taeniopygia_guttata|18817           ------------------------------------------------------------
Pongo_abelii|22055                  ------------------------------------------------------------
Ochotona_princeps|513               ------------------------------------------------------------
Dipodomys_ordii|15885               ------------------------------------------------------------
Procavia_capensis|12972             ------------------------------------------------------------
Equus_caballus|14099                ------------------------------------------------------------
Dasypus_novemcinctus|4895           ------------------------------------------------------------
Bos_taurus|12652                    ------------------------------------------------------------
Sus_scrofa|7945                     ------------------------------------------------------------
Oryctolagus_cuniculus|2869          ------------------------------------------------------------
Choloepus_hoffmanni|12539           ------------------------------------------------------------
Cavia_porcellus|12331               ------------------------------------------------------------
Echinops_telfairi|13551             ------------------------------------------------------------
Loxodonta_africana|24792            ------------------------------------------------------------
Mus_musculus|11820                  ------------------------------------------------------------
Pan_troglodytes|29600               ------------------------------------------------------------
Rattus_norvegicus|17976             ------------------------------------------------------------
Spermophilus_tridecemlineatus|13317 ------------------------------------------------------------
Tursiops_truncatus|5249             ------------------------------------------------------------
Ornithorhynchus_anatinus|28681      ------------------------------------------------------------
Macropus_eugenii|7357               ------------------------------------------------------------
Xenopus_tropicalis|705              ------------------------------------------------------------
Oryzias_latipes|15600               ------------------------------------------------------------
Felis_catus|40996                   ------------------------------------------------------------
Callithrix_jacchus|46809            ------------------------------------------------------------
Microcebus_murinus|9605             ------------------------------------------------------------
Danio_rerio|29046                   ------------------------------------------------------------
Oryzias_latipes|18527               ------------------------------------------------------------
Gasterosteus_aculeatus|2399         ------------------------------------------------------------
Tetraodon_nigroviridis|13830        ------------------------------------------------------------
Fugu_rubripes|30053                 ------------------------------------------------------------
Tetraodon_nigroviridis|4572         ------------------------------------------------------------
Fugu_rubripes|1098                  ------------------------------------------------------------
Gasterosteus_aculeatus|22884        ------------------------------------------------------------
Danio_rerio|20797                   ------------------------------------------------------------
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            ------------------------------------------------------------
Echinops_telfairi|972               ------------------------------------------------------------
Gorilla_gorilla|16948               ------------------------------------------------------------
Cavia_porcellus|24856               ------------------------------------------------------------
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------------------------------------
Otolemur_garnettii|2070             ------------------------------------------------------------
Ochotona_princeps|15487             ------------------------------------------------------------
Mus_musculus|44064                  ------------------------------------------------------------
Rattus_norvegicus|33962             ------------------------------------------------------------
Procavia_capensis|16748             ------------------------------------------------------------
Oryctolagus_cuniculus|21892         ------------------------------------------------------------
Equus_caballus|1290                 ------------------------------------------------------------
Homo_sapiens|29496                  ------------------------------------------------------------
Pongo_abelii|9734                   ------------------------------------------------------------
Pan_troglodytes|13247               ------------------------------------------------------------
Rhesus_macaque|34621                ------------------------------------------------------------
Bos_taurus|13136                    ------------------------------------------------------------
Spermophilus_tridecemlineatus|5969  ------------------------------------------------------------
Dasypus_novemcinctus|10026          ------------------------------------------------------------
Choloepus_hoffmanni|1405            ------------------------------------------------------------
Tursiops_truncatus|10256            ------------------------------------------------------------
Nematostella_vectensis|12483        ------------------------------------------------------------
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 ------------------------------------------------------------
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              ------------------------------------------------------------
Nasonia_vitripennis|9293            ------------------------------------------------------------
Apis_mellifera|33486                ------------------------------------------------------------
Linepithema_humile|6941             ------------------------------------------------------------
Pogonomyrmex_barbatus|2677          ------------------------------------------------------------
Culex_quinquefasciatus|15641        GTACCACAACTGCTCTACTACTCGAGC---------------------------------
Bombyx_mori|3274                    ------------------------------------------------------------
Drosophila_persimilis|16405         ------------------------------------------------------------
Drosophila_yakuba|7048              ------------------------------------------------------------
Drosophila_melanogaster|3349        ------------------------------------------------------------
Drosophila_simulans|4567            ------------------------------------------------------------
Drosophila_sechellia|11762          ------------------------------------------------------------
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         TCTGAACGAGAAGAG---------------------------------GTGCTC------
Danio_rerio|3280                    CTT---------------------------------------------------------
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        GCCAGCCCGAACGGG---------------------------------ATGTCT------
Tarsius_syrichta|14472              ---CAGCCCAATGAC---------------------------------AAAACT------
Erinaceus_europaeus|8777            ---CAGCCGAATGAC---------------------------------AAAACT------
Gorilla_gorilla|31558               ---AAACAAAACAAT---------------------------------AAAACA------
Gallus_gallus|22550                 ---CAACCCAATGAC---------------------------------AAAACT------
Fugu_rubripes|7786                  ---cagaccaaCGAC---------------------------------AAAACGGTGAGG
Rhesus_macaque|32038                ---CAGCCCAATGAC---------------------------------AAAACT------
Otolemur_garnettii|13561            ---CATGAGAACCAT---------------------------------------------
Felis_catus|42581                   ---NNNNNNNNNNNN---------------------------------NNNNNN------
Microcebus_murinus|2006             ---CAGCCCAATGAC---------------------------------AAAACT------
Macropus_eugenii|9432               ---CAACCTAATGAC---------------------------------AAAACT------
Tupaia_belangeri|2263               ---NNNNNNNNNNNN---------------------------------NNNNNN------
Canis_familiaris|21922              ---CAGCCCAATGAC---------------------------------AAAACT------
Monodelphis_domestica|13648         ---CAACCTAATGAC---------------------------------AAAACT------
Gasterosteus_aculeatus|19757        ---CAGCCCAACGAC---------------------------------AAGACG------
Callithrix_jacchus|44206            ---CAGCCCAATGAC---------------------------------AAAACT------
Ornithorhynchus_anatinus|25838      ---CAGCCCAACGAC---------------------------------AAGACG------
Danio_rerio|26298                   ---CAACCCAACGAC---------------------------------AAAACG------
Anolis_carolinensis|1277            ---CAACCCAACGAC---------------------------------AAGACG------
Sorex_araneus|14424                 ---CAGCCCAATGAC---------------------------------AAAACG------
Pteropus_vampyrus|9384              ---CAGCCCAATGAC---------------------------------AAAACT------
Taeniopygia_guttata|18817           ---caacccAATGAC---------------------------------AAAACT------
Pongo_abelii|22055                  ---CAGCCCAATGAC---------------------------------AAAACT------
Ochotona_princeps|513               ---CAACCCAATGAC---------------------------------AAAACT------
Dipodomys_ordii|15885               ---CAACCCAATGAC---------------------------------AAAACG------
Procavia_capensis|12972             ---CAACCGAATGAC---------------------------------AAAACT------
Equus_caballus|14099                ---CAGCCCAATGAC---------------------------------AAAACT------
Dasypus_novemcinctus|4895           ---CAGCCAAACGAC---------------------------------AAAACT------
Bos_taurus|12652                    ---CAGCCCAATGAT---------------------------------AAAACT------
Sus_scrofa|7945                     ---CAGCCCAATGAC---------------------------------AAAACT------
Oryctolagus_cuniculus|2869          ---CAGCCCAATGAC---------------------------------AAAACT------
Choloepus_hoffmanni|12539           ---CAGCCGAATGAC---------------------------------AAAACT------
Cavia_porcellus|12331               ---CAGCCCAATGAC---------------------------------AAAACT------
Echinops_telfairi|13551             ---CAACCGAATGAC---------------------------------AAAACT------
Loxodonta_africana|24792            ---CAACCGAATGAC---------------------------------AAAACT------
Mus_musculus|11820                  ---CAACCCAACGAC---------------------------------AAAACT------
Pan_troglodytes|29600               ---CAGCCCAATGAC---------------------------------AAAACT------
Rattus_norvegicus|17976             ---CAACCCAACGAC---------------------------------AAAACT------
Spermophilus_tridecemlineatus|13317 ---CAACCCAATGAC---------------------------------AAAACT------
Tursiops_truncatus|5249             ---CAACCCAATGAC---------------------------------AAAACT------
Ornithorhynchus_anatinus|28681      ---CAGCACAACGAC---------------------------------AAGACG------
Macropus_eugenii|7357               ---NNNNNNNNNNNN---------------------------------NNNNNN------
Xenopus_tropicalis|705              ---CAACTGAATGAC---------------------------------AAAACA------
Oryzias_latipes|15600               ---cagcacagtgaT---------------------------------AAGACTGTAAGC
Felis_catus|40996                   ---CAACACAACGAC---------------------------------AAGACG------
Callithrix_jacchus|46809            ---CAGCACAGCGACAATCACTCCCCAAGGCCTGGAGCTCCAGTCTCAAAGACTGCAGAA
Microcebus_murinus|9605             ---CAACACAACGAC---------------------------------AAGACG------
Danio_rerio|29046                   ------CATGGCGAT---------------------------------AAGACG------
Oryzias_latipes|18527               ---cagcacaacgAC---------------------------------AAAACCGTGAGT
Gasterosteus_aculeatus|2399         ---CACCACAGTGAC---------------------------------AAGACT------
Tetraodon_nigroviridis|13830        ---CAGCACAGTGAT---------------------------------AAGACT------
Fugu_rubripes|30053                 ---CAACACAGTGAT---------------------------------AAGACTGTAAGC
Tetraodon_nigroviridis|4572         ---CAGCACAGCGAC---------------------------------AAAACC------
Fugu_rubripes|1098                  ---CAGCACAGCGAC---------------------------------AAAACCGTGAGT
Gasterosteus_aculeatus|22884        ---CAACACAGCGAG---------------------------------AAAACCGTGGGT
Danio_rerio|20797                   ---CAACACAACGAC---------------------------------AAAACG------
Otolemur_garnettii|1567             ---CAGCCCAATGAC---------------------------------AAAACC------
Monodelphis_domestica|57            ---CAGCACAGCGAC---------------------------------AAGACG------
Echinops_telfairi|972               ---CAGCACAGCGAC---------------------------------AAGACG------
Gorilla_gorilla|16948               ---CAGCACAGCGAC---------------------------------AAGACG------
Cavia_porcellus|24856               ---CAGCACAGCGAC---------------------------------AAAACG------
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ---CAGCACAACGAC---------------------------------AAGACG------
Otolemur_garnettii|2070             ---CAGCACAACGAC---------------------------------AAGACG------
Ochotona_princeps|15487             ---CAGCACAGCGAT---------------------------------AAGACG------
Mus_musculus|44064                  ---CAACACAGTGAC---------------------------------AAGGCG------
Rattus_norvegicus|33962             ---CAACACAGCGAC---------------------------------AAGGCG------
Procavia_capensis|16748             ---CAGCACAGCGAC---------------------------------AAGACG------
Oryctolagus_cuniculus|21892         ---CAGCACAGCGAC---------------------------------AAGACG------
Equus_caballus|1290                 ---CAGCACAACGAC---------------------------------AAGACG------
Homo_sapiens|29496                  ---CAGCACAGCGAC---------------------------------AAGACG------
Pongo_abelii|9734                   ---CAGCACAGCGAC---------------------------------AAGACG------
Pan_troglodytes|13247               ---CAGCACAGCGAC---------------------------------AAGACG------
Rhesus_macaque|34621                ---CAGCACAGCGAC---------------------------------AAGACG------
Bos_taurus|13136                    ---CAGCACAACGAC---------------------------------AAGACG------
Spermophilus_tridecemlineatus|5969  ---CAGCACAATGAC---------------------------------AAGACG------
Dasypus_novemcinctus|10026          ---CAGCACAGCGAC---------------------------------AAGACG------
Choloepus_hoffmanni|1405            ---CAGCACAACGAT---------------------------------AAGACG------
Tursiops_truncatus|10256            ---CAGCACAATGAC---------------------------------AAGACG------
Nematostella_vectensis|12483        ---TCGCCCACCGGA---------------------------------GCGCCA------
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 ---GAGAAGGACGGAAGG------------------------------AAGCTG------
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              ---GAAAAAGATGGT------------AGA------------------AAATTA------
Nasonia_vitripennis|9293            ---AAGGACGGGCGC---------------------------------AAGTTG------
Apis_mellifera|33486                ---AAGGATGGCCGT---------------------------------AAATTA------
Linepithema_humile|6941             ---AAGGACGGGCGT---------------------------------AAATTA------
Pogonomyrmex_barbatus|2677          ---AAGGACGGGCGT---------------------------------AAATTG------
Culex_quinquefasciatus|15641        ---TCCCCCGAAGGT---------------------------------CGCAAG------
Bombyx_mori|3274                    ------------------------------------------------------------
Drosophila_persimilis|16405         ---AAGGAGGGTCGC---------------------------------AAACTC------
Drosophila_yakuba|7048              ---AAGGAGGGTCGC---------------------------------AAGCTC------
Drosophila_melanogaster|3349        ---AAGGAGGGTCGC---------------------------------AAGCTG------
Drosophila_simulans|4567            ---GAGAAGGAGGGTCGC------------------------------AAGCTG------
Drosophila_sechellia|11762          ---GAGAAGGAGGGTCGC------------------------------AAGCTG------
                                                                                                

Ixodes_scapularis|17839             ------------------------------AGCCTGGGCGCCCTCCGCGGCGTG---CCC
Caenorhabditis_elegans|1417         ------------------------------AATAGGGTACGTGTAAATGGTATCGGTCCT
Danio_rerio|3280                    ------------------------------GAGGGGCATCTGGTTTCAGAGGAG---CCG
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        ------------------------------GGGATCGGACGGCTGAACGGGGTG---CCC
Tarsius_syrichta|14472              ------------------------------NNNNNNNNNNNNATGACAGGAACT---CCC
Erinaceus_europaeus|8777            ------------------------------AATATCCAGGGGATGACAGGAACC---CCC
Gorilla_gorilla|31558               AAT---------------------------AATATCCAGGGGATGACAGGAACT---CCC
Gallus_gallus|22550                 ------------------------------AATATCCAAGGGATGACAGGAACT---CCG
Fugu_rubripes|7786                  TGC---------------------------CACATCAGATCTCCATTCAGCACT---GTC
Rhesus_macaque|32038                ------------------------------AATATCCAGGGGATGACAGGAACT---CCC
Otolemur_garnettii|13561            ------------------------------AATATCCAGGGGATGACAGGAACT---CCT
Felis_catus|42581                   ------------------------------AATATCCAGGGGATGACAGGAACT---CCC
Microcebus_murinus|2006             ------------------------------AATATCCAGGGGATGACAGGAACT---CCC
Macropus_eugenii|9432               ------------------------------AATATCCAGGGGATGACAGGAACT---CCG
Tupaia_belangeri|2263               ------------------------------AATATCCAGGGGATGACAGGAACT---CCT
Canis_familiaris|21922              ------------------------------AATATCCAGGGGATGACAGGAACT---CCC
Monodelphis_domestica|13648         ------------------------------AATATCCAAGGGATGACAGGAACT---CCG
Gasterosteus_aculeatus|19757        ------------------------------AACATCCAGGGAATGACGGGCACC---CCG
Callithrix_jacchus|44206            ------------------------------AATATCCAGGGGATGACAGGAACT---CCC
Ornithorhynchus_anatinus|25838      ------------------------------AATATCCAGGGGATGGCGGGGACC---CCC
Danio_rerio|26298                   ------------------------------AACATCCAGGGGATGACAGGTACT---CCA
Anolis_carolinensis|1277            ------------------------------AACATCCAGGGCCTGACGGGCACT---CCG
Sorex_araneus|14424                 ------------------------------AATATCCAGGGGATGACAGGAACT---CCC
Pteropus_vampyrus|9384              ------------------------------AATATCCAGGGTATGACAGGAACT---CCC
Taeniopygia_guttata|18817           ------------------------------AATATCCAAGGGATGACAGGAACT---CCA
Pongo_abelii|22055                  ------------------------------AATATCCAGGGGATGACAGGAACT---CCC
Ochotona_princeps|513               ------------------------------AATATCCAGGGCATGACAGGAACT---CCC
Dipodomys_ordii|15885               ------------------------------AATATACAGGGGATGACAGGAACT---CCC
Procavia_capensis|12972             ------------------------------AATATCCAGGGGATGACAGGAACT---CCC
Equus_caballus|14099                ------------------------------AATATCCAGGGGATGACAGGAACT---CCT
Dasypus_novemcinctus|4895           ------------------------------AATATCCAGGGGATGACAGGAACT---CCC
Bos_taurus|12652                    ------------------------------AATATCCAAGGGATGACAGGAACT---CCC
Sus_scrofa|7945                     ------------------------------AATATCCAGGGGATGACAGGAACT---CCC
Oryctolagus_cuniculus|2869          ------------------------------AATATCCAGGGCATGACAGGAACT---CCC
Choloepus_hoffmanni|12539           ------------------------------AATATCCAGGGGATGACAGGAACT---CCC
Cavia_porcellus|12331               ------------------------------AATATCCAGGGAATGACAGGAACT---CCC
Echinops_telfairi|13551             ------------------------------AATATCCAGGGGATGACAGGAACT---CCC
Loxodonta_africana|24792            ------------------------------AATATCCAAGGGATGACAGGAACT---CCC
Mus_musculus|11820                  ------------------------------AATATCCAGGGGATGACAGGAACT---CCC
Pan_troglodytes|29600               ------------------------------AATATCCAGGGGATGACAGGAACT---CCC
Rattus_norvegicus|17976             ------------------------------AATATCCAGGGGATGACAGGAACT---CCC
Spermophilus_tridecemlineatus|13317 ------------------------------AATATCCAGGGGATGACAGGAACT---CCC
Tursiops_truncatus|5249             ------------------------------AATATCCAGGGGATGACAGGAACT---CCC
Ornithorhynchus_anatinus|28681      ------------------------------NCCTCTCAGGCATCATCACCATCATCCCCG
Macropus_eugenii|7357               ------------------------------AGCCTGCAGGGTCTGACTGGGACA---CCT
Xenopus_tropicalis|705              ------------------------------AGCCTGCAGGGTTTGACAGGAACA---CCA
Oryzias_latipes|15600               ATCTTC------------------------AACCTGCAAGGCCTTACAGGGACC---CCC
Felis_catus|40996                   ------------------------------AGCCTCCAAGGACTGACCGGGACG---CCC
Callithrix_jacchus|46809            AAG---------------------------AGCCTTCAGGGACTAACCGGGACG---CCC
Microcebus_murinus|9605             ------------------------------NNNNNNNNNNNNNNNNNNNNNNNN---NNN
Danio_rerio|29046                   ------------------------------AATCTGCAGGGTATGACGGGCACT---GCG
Oryzias_latipes|18527               GACAGA------------------------AATCTGCAGGGCCTGACAGGCACC---CCT
Gasterosteus_aculeatus|2399         ------------------------------AACCTGCAGGGCCTCACGGGGACG---CCT
Tetraodon_nigroviridis|13830        ------------------------------AACCTGCAGGGCCTCACAGGAACG---CCT
Fugu_rubripes|30053                 ATCTTC------------------------AACCTGCAGGGCCTCACAGGAACC---CCT
Tetraodon_nigroviridis|4572         ------------------------------AACCTGCAGGGCCTCACGGGCACC---GCC
Fugu_rubripes|1098                  CCTGCAGCTTTT------------ATTCAGAACCTGCAGGGCCTGACGGGCACC---GCG
Gasterosteus_aculeatus|22884        GATGTTGTCTTTTATATTTTTAGGGTACAGAATCTGCAGGGACTGACAGGCACA---CCT
Danio_rerio|20797                   ------------------------------AATCTCCAAGGTCTCACGGGAACG---CCT
Otolemur_garnettii|1567             ------------------------------NNNNNNNNNNNNNNNNNNNNNNNN---NNN
Monodelphis_domestica|57            ------------------------------AGCTTGCAGGGGCTGACGGGGACG---CCC
Echinops_telfairi|972               ------------------------------NNNNNNNNNNNNNNNNNNNNNNNN---NNN
Gorilla_gorilla|16948               ------------------------------AGCCTTCAGGGACTGACTGGGACG---CCC
Cavia_porcellus|24856               ------------------------------AGCCTCCAGGGCCTGACTGGGACG---CCG
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------AGTCTGCAGGGACTGACCGGGACG---CCC
Otolemur_garnettii|2070             ------------------------------AGCCTCCAGGGACTGACTGGGACG---CCC
Ochotona_princeps|15487             ------------------------------AGCCTCCAGGGACTGACCGGGACG---CCC
Mus_musculus|44064                  ------------------------------AGCCTCCAGGGACTGACTGGGACG---CCT
Rattus_norvegicus|33962             ------------------------------AGTCTCCAGGGACTAACTGGGACG---CCT
Procavia_capensis|16748             ------------------------------AGCCTCCAGGGACTGACCGGGACG---CCC
Oryctolagus_cuniculus|21892         ------------------------------AGCCTCCAGGGACTGACCGGGACG---CCC
Equus_caballus|1290                 ------------------------------AGTCTCCAGGGACTGACCGGGACG---CCC
Homo_sapiens|29496                  ------------------------------AGCCTTCAGGGACTGACTGGGACG---CCC
Pongo_abelii|9734                   ------------------------------AGCCTTCAGGGACTGACCGGGACG---CCC
Pan_troglodytes|13247               ------------------------------AGCCTTCAGGGACTGACTGGGACG---CCC
Rhesus_macaque|34621                ------------------------------AGCCTTCAGGGACTGACCGGGACG---CCC
Bos_taurus|13136                    ------------------------------AGCCTCCAGGGACTGACCGGGACG---CCC
Spermophilus_tridecemlineatus|5969  ------------------------------AGCCTGCAGGGACTTACCGGGACG---CCC
Dasypus_novemcinctus|10026          ------------------------------AGCCTCCAGGGACTGACAGGAACG---CCG
Choloepus_hoffmanni|1405            ------------------------------AGCCTCCAGGGACTGACCGGAACG---CCC
Tursiops_truncatus|10256            ------------------------------AGCCTGCAGGGACTGACCGGGACG---CCC
Nematostella_vectensis|12483        ------------------------------CCTAGAACTCTACCACAGCAAACATTACCA
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 ------------------------------GGCTTTGGTTCGATGCAAGGCATC---CCG
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              ------------------------------GGTTACGGTGGAATGCAAGGTATA---CCA
Nasonia_vitripennis|9293            ------------------------------GGCTTCGGAGGTATGCACGGGATA---CCC
Apis_mellifera|33486                ------------------------------GGGTTTGGTGGAATGCATGGCATT---CCT
Linepithema_humile|6941             ------------------------------GGTTTCGGGGGCATGCATGGCATT---CCC
Pogonomyrmex_barbatus|2677          ------------------------------GGCTTCGGCGGCATGCATGGCATA---CCT
Culex_quinquefasciatus|15641        ------------------------------CTCGGGTACGGCATGCAGGGCATC---CCG
Bombyx_mori|3274                    ------------------------------------GAGAAGATGCACGGGTAC------
Drosophila_persimilis|16405         ------------------------------GGCTACGGCGCCATGCAGGGCATC---CCG
Drosophila_yakuba|7048              ------------------------------GGCTACGGCGCCATGCAGGGCATC---CCC
Drosophila_melanogaster|3349        ------------------------------GGCTACGGCGCCATGCAGGGCATC---CCC
Drosophila_simulans|4567            ------------------------------GGCTACGGCGCCATGCAGGGCATC---CCC
Drosophila_sechellia|11762          ------------------------------GGCTACGGCGCCATGCAGGGCATC---CCC
                                                                                                

Ixodes_scapularis|17839             ATGGTGGCCAGCAGCCCCGTGCGGCACGAGGGCAGCGCCAGCCCCCAGCCGCTC---GAG
Caenorhabditis_elegans|1417         TTGATGGTTCAACCAGCTACACCACATATTGATAATACACTTGGTGGACCAATT---GAT
Danio_rerio|3280                    CTACTGCTGGTCAGTACAGAGAGTCAGGACAGTGATGTGATGATCAGC------------
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        ATGGTGGCGCAGGAGCCCGTCAGACACGAGAGCCAGATGCAGGCCAACCCCGTA---GAA
Tarsius_syrichta|14472              ATGGTGGCTGCCAGTCCAGAGAGACACGACGGTGGCTTACAGGCTAACCCAGTG---GAA
Erinaceus_europaeus|8777            ATGGTGGCTGCCAGTCCAGAAAGACATGATGGTGGCTTACAGGCCAACCCGGTG---GAA
Gorilla_gorilla|31558               ATGGTGGCTGCCAGTCCAGAGAGACACGACGGTGGCTTACAGGCTAACCCAGTG---GAA
Gallus_gallus|22550                 ATGGTGGCTGCTAGTCCGGAGAGACATGATGGTGGTTTACAGGCGAACCCGGTG---GAG
Fugu_rubripes|7786                  ACACAAGCAATGAAACCTGATCCCGACTCTGACAACTTTGTCTCAAAGTCTTTA---ACC
Rhesus_macaque|32038                ATGGTGGCTGCCAGTCCAGAGAGACACGACGGTGGCTTACAGGCTAACCCAGTG---GAG
Otolemur_garnettii|13561            ATGGTGGCTGCCAGTCCAGAGAGACACGATGGTGGCTTACAGGCTAACCCAGTG---GAG
Felis_catus|42581                   ATGGTGGCTGCCAGTCCAGAGAGACACGATGGTGGCTTACAGGCAAACCCAGTG---GAG
Microcebus_murinus|2006             ATGGTGGCTGCCAGTCCAGAGAGACACGACGGTGGCTTACAGGCTAACCCAGTT---GAG
Macropus_eugenii|9432               ATGGTGGCGGCTAGCCCAGAGAGACACGATGGCGGTTTACAGGCTAACCCTGTG---GAG
Tupaia_belangeri|2263               ATGGTGGCTGCCAGCCCAGAGAGACACGATGGTGGCTTACAGGCTAACCCAGTG---GAG
Canis_familiaris|21922              ATGGTGGCTGCCAGTCCAGAGAGACACGATGGTGGCTTACAGGCAAACCCAGTG---GAG
Monodelphis_domestica|13648         ATGGTGGCTGCTAGCCCAGAGAGACATGATGGCGGTTTACAGGCTAACCCTGTG---GAG
Gasterosteus_aculeatus|19757        ATGGTGGCGGCCAGTCCGGAGCGGCACGACGGCGGCCTGCAGGCCAACCCGGTG---GAG
Callithrix_jacchus|44206            ATGGTGGCTGCCAGTCCAGAGAGACACGACGGTGGCTTACAGGCTAACCCAGTG---GAG
Ornithorhynchus_anatinus|25838      ATGGTGGCCGCCAGCCCGGAGAGGCACGACGGCGGTTTGCAGGCCAACCCCGTG---GAG
Danio_rerio|26298                   ATGGTGGCGACCAGTCCAGAGAGACACGACGGTGGTTTGCAGGCAAACCAAGTG---GAG
Anolis_carolinensis|1277            ATGGTGGCCTCCAGTCCGGAGCGGCACGACGGGGGTTTGCAGGCGAACCCGGTG---GAG
Sorex_araneus|14424                 ATGGTGGCCGCCAGTCCAGAGAGGCACGATGGTGGCTTACAGGCGAACCCAGTG---GAG
Pteropus_vampyrus|9384              ATGGTGGCTGCCAGTCCAGAGAGACACGACGGTGGCTTACAGGCAAACCCAGTG---GAG
Taeniopygia_guttata|18817           ATGGTGGCTGCAAGTCCGGAGAGACATGACGGCGGTTTGCAGGCGAACCCCGTG---GAG
Pongo_abelii|22055                  ATGGTGGCTGCCAGTCCAGAGAGACACGACGGTGGCTTACAGGCTAACCCAGTG---GAA
Ochotona_princeps|513               ATGGTGGCTGCCAGTCCAGAGAGACACGACGGTGGCTTACAGGCTAACCCAGTG---GAA
Dipodomys_ordii|15885               ATGGTGGCTGCCAGTCCAGAGAGACATGATGGTGGCTTACAGGCTAACCCAGTT---GAG
Procavia_capensis|12972             ATGGTGGCTGCCAGTCCAGAGAGACACGATGGTGGCTTACAGGCTAACCCAGTG---GAA
Equus_caballus|14099                ATGGTGGCTGCCAGTCCAGAGAGACACGACGGTGGCTTACAGGCAAACCCAGTG---GAG
Dasypus_novemcinctus|4895           ATGGTGGCTGCCAGTCCAGAGAGACACGACGGTGGCTTACAGGCTAACCCAGTG---GAG
Bos_taurus|12652                    ATGGTGGCTGCCAGTCCGGAGAGACATGACGGTGGCTTACAGGCAAACCCAGTG---GAG
Sus_scrofa|7945                     ATGGTGGCTGCCAGTCCAGAGAGACATGACGGTGGCTTACAGGCAAACCCCGTG---GAG
Oryctolagus_cuniculus|2869          ATGGTGGCTGCCAGTCCAGAGAGACACGACGGTGGCTTACAGGCTAACCCAGTG---GAG
Choloepus_hoffmanni|12539           ATGGTGGCTGCCAGTCCAGAGAGACACGATGGTGGCTTACAGGCTAACCCAGTG---GAG
Cavia_porcellus|12331               ATGGTGGCTGCCAGTCCAGAGAGACACGACGGTGGCTTACAAGCTAACCCAGTT---GAG
Echinops_telfairi|13551             ATGGTGGCTGCCAGTCCGGAGAGGCACGATGGTGGCTTACAGGCTAACCCAGTG---GAG
Loxodonta_africana|24792            ATGGTGGCTGCCAGTCCAGAAAGACACGATGGTGGCTTACAGGCTAACCCAGTG---GAG
Mus_musculus|11820                  ATGGTGGCTGCTAGTCCGGAGAGACATGATGGTGGTTTACAGGCTAACCCAGTA---GAG
Pan_troglodytes|29600               ATGGTGGCTGCCAGTCCAGAGAGACACGACGGTGGCTTACAGGCTAACCCAGTG---GAA
Rattus_norvegicus|17976             ATGGTGGCTGCTAGTCCGGAGAGACATGATGGTGGTTTACAGGCTAACCCAGTT---GAG
Spermophilus_tridecemlineatus|13317 ATGGTAGCTGCCAGTCCAGAGAGGCACGACGGTGGCTTACAGGCTAACCCAGTT---GAG
Tursiops_truncatus|5249             ATGGTGGCTGCCAGTCCAGAGAGACACGACGGTGGCTTACAGGCAAACCCAGTG---GAG
Ornithorhynchus_anatinus|28681      ------GCATCATCATCTTATCGTCGGGGTCCCGGCCTTCCCGTGGCCGCTTTGCTCCGG
Macropus_eugenii|7357               CTGGTGGCTGGCAGCCCCATTCGCCATGAGAGTGCGGTGCAGGGTAGTGCAGTG---GAG
Xenopus_tropicalis|705              ATGGTAGCAGGAAGTCCAATCCGGCATGACAGTGCTGTGCAGGGAAGTGCCGTT---GAG
Oryzias_latipes|15600               CTTGTCGCTGGAAGTCCCATTCGGCATGAGAGCACGGTGCAGGGGAACCCAGTG---GAG
Felis_catus|40996                   CTCGTGGCGGGCAGTCCCATCCGCCACGAGAGTGCTGTTCAGGGCAGCGCAGTG---GAG
Callithrix_jacchus|46809            CTGGTAGCGGGCAGCCCCATCCGCCACGAGAATGCTGTGCAGGGCAGTGCAGTG---GAG
Microcebus_murinus|9605             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNN
Danio_rerio|29046                   CTGGTTGCAGGCAGCCCAATAAGACACAACCCCTCAGTGCCAGGACACCCGGTG---GAT
Oryzias_latipes|18527               TTGGTGGCAGGCAGTCCTATCCGACACGACACGACCGTCCAGGGGAATCCAGTG---GAG
Gasterosteus_aculeatus|2399         CTTGTGGCGGGGAGTCCTATTCGTCATGAAAGCTCTGTGCAAGGAAACCCAGTG---GAG
Tetraodon_nigroviridis|13830        CTGGTGGCTGGAAGTCCGATCCGACACGAGAGCGCCGTG---GGGAACCCGGTG---GAG
Fugu_rubripes|30053                 CTGGTTGCTGGAAGCCCCATTCGACATGAGAGCGCCGTGCAGGGGAACCCGGTG---GAG
Tetraodon_nigroviridis|4572         ATGGTGGCAGGCAGTCCTATCCGGCATGAGAACACGGTTCAGGGGAACCCTGTG---GAG
Fugu_rubripes|1098                  ATGGTGGCAGGCAGTCCGATCCGGCATGAGAACACTGTTCAGGGGAACCCTGTG---GAG
Gasterosteus_aculeatus|22884        CTGGTGGCAGGTAGTCCAATCCGGCACGACAACACCGTGCAGGGGAATCCTGTG---GAG
Danio_rerio|20797                   TTGGTGGCAGGCAGCCCGATTAGACATGACACCACAGTCCAGGGAAATCCTGTA---GAA
Otolemur_garnettii|1567             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNN
Monodelphis_domestica|57            CTGGTGGCCGGCAGCCCCATCCGCCATGAGAGCGCGGTGCAGGGCAGCGCCGTG---GAG
Echinops_telfairi|972               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGCAGGGCAGCGCAGTC---GAG
Gorilla_gorilla|16948               CTGGTGGCGGGCAGTCCCATCCGCCATGAGAACGCCGTGCAGGGCAGCGCAGTG---GAG
Cavia_porcellus|24856               CTGGTGGCCGGCAGTCCCATCCGCCACGACAGCGCCGTGCAGGGCAGTGCGGTG---GAG
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------------------------------------
Otolemur_garnettii|2070             CTGGTGGCCGGCAGCCCCATCCGCCACGAGAGCGCCGTGCAGGGCAGCGCCGTC---GAG
Ochotona_princeps|15487             CTGGTGGCCGGCAGCCCCATCCGCCACGAGAGCGCCGTGCAGGGCAGCGCCGTG---GAG
Mus_musculus|44064                  CTGGTGGCAGGCAGCCCCATCCGCCATGAGAACGCGGTGCAGGGCAGCGCAGTC---GAG
Rattus_norvegicus|33962             CTGGTGGCGGGCAGCCCCATCCGCCATGAGAACGCCGTGCAGGGCAGCGCAGTC---GAG
Procavia_capensis|16748             TTGGTGGCGGGCAGCCCTATCCGCCACGAAAGTGCGGTGCAGGGCAGCGCAGTA---GAG
Oryctolagus_cuniculus|21892         CTGGTGGCGGGCAGCCCCATCCGCCACGAGAGCGCCGTGCAGGGCAGCGCCGTC---GAG
Equus_caballus|1290                 CTGGTGGCGGGCAGCCCCATCCGCCATGAGAGCGCCGTGCAAGGCAGCGCAGTC---GAG
Homo_sapiens|29496                  CTGGTGGCGGGCAGTCCCATCCGCCATGAGAACGCCGTGCAGGGCAGCGCAGTG---GAG
Pongo_abelii|9734                   CTGGTGGCGGGCAGTCCCATCCGCCATGAGAACGCCGTGCAGGGCAGCGCAGTG---GAG
Pan_troglodytes|13247               CTGGTGGCGGGCAGTCCCATCCGCCATGAGAACGCCGTGCAGGGCAGCGCAGTG---GAG
Rhesus_macaque|34621                CTGGTGGCGGGCAGCCCCATCCGCCATGAGAACGCTGTGCAGGGCAGCGCAGTG---GAG
Bos_taurus|13136                    CTGGTGGCGGGCAGCCCCATCCGCCACGAGAGCGCCGTGCAGGGCAGTGCAGTC---GAG
Spermophilus_tridecemlineatus|5969  CTGGTGGCGGGCAGCCCCATTCGCCACGAGAGCGCGGTGCAGGGCAGCGCAGTT---GAG
Dasypus_novemcinctus|10026          CTGGTGGCAGGCAGCCCCATCCGCCACGAGAGCGCCGTGCAGGGCAGCGCAGTG---GAG
Choloepus_hoffmanni|1405            CTGGTGGCAGGCAGCCCCATCCGCCACGAGAGCACTGTGCAGGGCAGC---GTG---GAG
Tursiops_truncatus|10256            CTGGTGGCGGGCAGCCCCATCCGTCACGAGAGCGCCGTGCAGGGCAGTGCAGTT---GAG
Nematostella_vectensis|12483        GCTATTTCGGGTGTTCCGTATGGAAACTCGGGATCGATGAGGCCCGATGCTATGTCTGAT
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 CTGATCGCGTCCAGTCCAGTCAGGCACGGCGAGTCGTCGCCCAGCGGAGGCAGCGGCGTC
Ixodes_scapularis|17836             ---------------------------GAGGGAGAGGAGGATGCGGCG------------
Pediculus_humanus|2973              ATGGTAGCATCGAGTCCTGTAAGACACGAAAGTCCTCTCGGTCTTAATCCAATA---GAA
Nasonia_vitripennis|9293            ATGGTGGCGAGCAGTCCCGTCAGACACGAGAGCCCCATCGGGATGACGCCGCTC---GAG
Apis_mellifera|33486                ATGGTGGCCAGTAGTCCTGTAAGACACGAGAGTTCTATAGGAATGACGCCATTG---GAA
Linepithema_humile|6941             ATGGTTGCCAGCAGCCCCGTGAGACACGAGAGCCCCATCGGCATGACGCCTTTG---GAG
Pogonomyrmex_barbatus|2677          ATGGTTGCCAGCAGCCCCGTGAGACACGAGAGTCCCATTGGTATGACGCCTCTA---GAA
Culex_quinquefasciatus|15641        ATGGTGGCCAGCTCGCCGGTGCGGCACGACTCGCCGCTGAACCTGCACGGGCTG---GAG
Bombyx_mori|3274                    ---------------------------GACGTG---------------------------
Drosophila_persimilis|16405         ATGATCGCCAGCTCGCCGGTGCGCCACGACTCGCCGCTCAATCTGCAGGGTCTG---GAC
Drosophila_yakuba|7048              ATGATCGCCAGCTCCCCGGTGCGACATGACTCCCCACTGAATCTCCAGGGCCTG---GAT
Drosophila_melanogaster|3349        ATGATCGCCAGTTCCCCGGTGCGGCATGACTCCCCACTGAATCTTCAGGGCCTG---GAT
Drosophila_simulans|4567            ATGATCGCCAGCTCCCCGGTGCGGCATGACTCCCCACTGAATCTTCAGGGCCTG---GAT
Drosophila_sechellia|11762          ATGATCGCCAGCTCCCCGGTGCGGCATGACTCCCCACTGAATCTTCAGGGCCTG---GAT
                                                                                                

Ixodes_scapularis|17839             GTGCACGCGTACCAA------------------CCTCCGTGGAAGGCGCTCGCAGAGTAC
Caenorhabditis_elegans|1417         ATTCAACATTTTGCACAATGGAATGGTACACCACCACCACCGCCTCCTCAATATGGGAAT
Danio_rerio|3280                    ---------------------------------CCACCATGGAAACTACTGACCGACTTC
Xenopus_tropicalis|17501            ---------------------------------CTGCCCACAGGATCGTTGTTTATTTTT
Branchiostoma_floridae|41009        GTACAGAGTTACCAACAA------------CCACCGCCATGGAAAGCCCTGAGCGACTTC
Tarsius_syrichta|14472              GTACAAAGTTACCAG------------------CCGCCTTGGAAAGTACTGAGCGACTTT
Erinaceus_europaeus|8777            GTGCAGAGCTACCAA------------------CCACCTTGGAAAGTACTGAGTGACTTC
Gorilla_gorilla|31558               GTACAAAGTTACCAG------------------CCACCTTGGAAAGTACTGAGCGACTTC
Gallus_gallus|22550                 GTGCAAAGTTACCAG------------------CCACCCTGGAAAGTACTGAGTGACTTC
Fugu_rubripes|7786                  GGCCGGGtg---ggg------------------ctggggtgggggtcgTCGTCACAAAGG
Rhesus_macaque|32038                GTACAAAGTTACCAG------------------CCACCTTGGAAAGTACTGAGCGACTTC
Otolemur_garnettii|13561            GTACAAAGTTACCAG------------------CCGCCTTGGAAAGTACTGAGCGACTTC
Felis_catus|42581                   GTGCAAAGTTACCAG------------------CCGCCTTGGAAAGTACTGAGTGACTTC
Microcebus_murinus|2006             GTACAAAGTTACCAG------------------CCACCTTGGAAAGTACTGAGCGACTTC
Macropus_eugenii|9432               GTGCAAAGTTACCAG------------------CCNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|2263               GTGCAAAGTTACCAG------------------CCGCCCTGGAAAGTACTGAGTGACTTT
Canis_familiaris|21922              GTGCAAAGTTACCAG------------------CCGCCTTGGAAAGTACTGAGTGACTTC
Monodelphis_domestica|13648         GTGCAAAGTTACCAG------------------CCTCCTTGGAAAGTACTGAGTGACTTC
Gasterosteus_aculeatus|19757        GTGCAGAGCTACCAG------------------CCGCCCTGGAAGGTGCTCAGCGACTTC
Callithrix_jacchus|44206            GTACAAAGTTACCAG------------------CCTCCTTGGAAAGTACTGAGTGACTTC
Ornithorhynchus_anatinus|25838      GTGCAGAGCTACCAG------------------CCGCCCTGGAAAGTTCTGAGCGACTTC
Danio_rerio|26298                   GTGCAGAGTTACCAA------------------CCGCCTTGGAAAGTCCTAAGTGACTTC
Anolis_carolinensis|1277            GTGCAGAGCTACCAG------------------CCGCCTTGGAAAGTCCTCAGCGACTTC
Sorex_araneus|14424                 GTGCAAAGTTACCAG------------------CCTCCTTGGAAAGTATTGAGTGACTTC
Pteropus_vampyrus|9384              GTGCAAAGTTACCAG------------------CCACCTTGGAAAGTACTGAGTGACTTC
Taeniopygia_guttata|18817           GTGCAGAGTTACCAG------------------CCTCCCTGGAAAGTACTGAGTGACTTC
Pongo_abelii|22055                  GTACAAAGTTACCAG------------------CCACCTTGGAAAGTACTGAGCGACTTC
Ochotona_princeps|513               GTGCAAAGTTACCAG------------------CCGCCTTGGAAAGTACTGAGTGACTTC
Dipodomys_ordii|15885               GTGCAAAGTTACCAG------------------CCGCCTTGGAAAGTACTGAGCGACTTC
Procavia_capensis|12972             GTGCAAAGTTACCAG------------------CCACCTTGGAAAGTACTGAGTGACTTC
Equus_caballus|14099                GTGCAAAGTTACCAG------------------CCGCCTTGGAAAGTCCTGAGTGACTTC
Dasypus_novemcinctus|4895           GTGCAAAGTTACCAG------------------CCGCCTTGGAAAGTACTGAGTGACTTC
Bos_taurus|12652                    GTGCAAAGTTACCAG------------------CCGCCTTGGAAAGTACTCAGTGACTTC
Sus_scrofa|7945                     GTGCAAAGTTACCAA------------------CCACCTTGGAAAGTACTGAGTGACTTC
Oryctolagus_cuniculus|2869          GTGCAAAGTTACCAG------------------CCGCCTTGGAAAGTACTGAGCGACTTC
Choloepus_hoffmanni|12539           GTGCAAAGTTACCAG------------------CCGCCTTGGAAAGTACTGAGTGACTTC
Cavia_porcellus|12331               GTGCAAAGTTACCAG------------------CCACCTTGGAAAGTACTGAGTGACTTC
Echinops_telfairi|13551             GTGCAAAGTTACCAA------------------CCACCTTGGAAAGTACTGAGTGACTTC
Loxodonta_africana|24792            GTGCAAAGTTACCAG------------------CCACCTTGGAAAGTACTGAGTGACTTC
Mus_musculus|11820                  GTGCAAAGTTACCAG------------------CCGCCCTGGAAAGTACTGAGTGACTTC
Pan_troglodytes|29600               GTACAAAGTTACCAG------------------CCACCTTGGAAAGTACTGAGCGACTTC
Rattus_norvegicus|17976             GTGCAAAGTTACCAG------------------CCGCCCTGGAAAGTACTGAGTGACTTC
Spermophilus_tridecemlineatus|13317 GTGCAAAGTTACCAG------------------CCGCCTTGGAAAGTACTGAGCGACTTC
Tursiops_truncatus|5249             GTGCAAAGTTACCAG------------------CCGCCTTGGAAAGTACTGAGTGACTTC
Ornithorhynchus_anatinus|28681      GGCAGGGGGAGGGGA------------------TGTGCCCTCCGCATCCTCTCCGGCCTG
Macropus_eugenii|7357               GTGCAGACTTATCAG------------------CCGCCCTGGAAAGCACTCAGCGAATTT
Xenopus_tropicalis|705              GTACAGACATATCAG------------------CCACCATGGAAAGCACTCAGTGACTTT
Oryzias_latipes|15600               GTTCAGACATACCAG------------------CCTCCATGGAAAGCCCTGAGTGACTTT
Felis_catus|40996                   GTGCAGACGTACCAG------------------CCACCGTGGAAAGCCCTCAGCGAATTT
Callithrix_jacchus|46809            GTGCAGACGTACCAG------------------CCGCCATCCGGCGGCCGGTCCCCA---
Microcebus_murinus|9605             NNNNNNNNNNNNNNN------------------NNNNNNNNNNNNNNNNNNNNNNNNNNN
Danio_rerio|29046                   GTGCAGGCTTACCAA------------------CCACCATGGAAAGCGCTCAGCGAATTT
Oryzias_latipes|18527               GTGCAAACCTACCAA------------------ACCCCGTGGAAGACACTTAGTGATCTA
Gasterosteus_aculeatus|2399         GTCCAGACCTACCAG------------------CCTCCATGGAAAGCCCTCAGTGAGTTT
Tetraodon_nigroviridis|13830        GTCCAGACCTACCAG------------------CCTCCCTGGAAGGCCCTGAGCGAGTTC
Fugu_rubripes|30053                 GTCCAGACCTACCAG------------------CCTCCATGGAAAGCCCTGAGTGAGTTT
Tetraodon_nigroviridis|4572         GTGCAGACATACCAG------------------CCACCGTGGAAAAGCCTCAGCGACTTC
Fugu_rubripes|1098                  GTGCAGACCTACCAG------------------CCACCGTGGAAGAGTCTCAGCGACTTC
Gasterosteus_aculeatus|22884        GTCCAAACCTACCAG------------------CCACCGTGGAAGACTCTCAGCGACTTC
Danio_rerio|20797                   GTTCAAACCTATCAG------------------CCTCCATGGAAAGCCTTAAGCGAATTT
Otolemur_garnettii|1567             NNNNNNNNNNNNNNN------------------NNNNNNNNNNNNNNNNNNNNNNNNNNN
Monodelphis_domestica|57            GTGCAGACCTACCAG------------------CCGCCCTGGAAGGCGCTCAGCGAGTTC
Echinops_telfairi|972               GTGCAGACGTACCAG------------------CCGCCCTTGAAAGCGCTCAGCGAATTC
Gorilla_gorilla|16948               GTGCAGACGTACCAG------------------CCGCCGTGGAAGGCGCTCAGCGAGTTT
Cavia_porcellus|24856               GTGCAGACGTTCCAG------------------CCGCCGTGGAAGGCACTCAGCGAGTTC
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------------------------------------
Otolemur_garnettii|2070             GTACAGACATACCAG------------------CCGCCGTGGAAAGCGCTCAGCGAGTTC
Ochotona_princeps|15487             GTGCAGACGTACCAG------------------CCGCCGTGGAAGGCGCTCAGCGAGTTT
Mus_musculus|44064                  GTGCAGACGTACCAG------------------CCGCCCTGGAAAGCACTCAGCGAGTTT
Rattus_norvegicus|33962             GTGCAGACGTACCAG------------------CCGCCCTGGAAAGCTCTCAGCGAGTTC
Procavia_capensis|16748             GTGCAGACGTACCAG------------------CCACCATGGAAAGCCCTCAGCGAGTTC
Oryctolagus_cuniculus|21892         GTCCAGACGTACCAG------------------CCGCCGTGGAAAGCGCTCAGCGAGTTC
Equus_caballus|1290                 GTGCAGACGTACCAG------------------CCGCCGTGGAAAGCTCTCAGCGAGTTC
Homo_sapiens|29496                  GTGCAGACGTACCAG------------------CCGCCGTGGAAGGCGCTCAGCGAGTTT
Pongo_abelii|9734                   GTGCAAACGTACCAG------------------CCGCCGTGGAAAGCGCTCAGCGAGTTT
Pan_troglodytes|13247               GTGCAGACGTACCAG------------------CCGCCGTGGAAGGCGCTCAGCGAGTTT
Rhesus_macaque|34621                GTGCAGACGTACCAG------------------CCGCCGTGGAAGGCGCTCAGCGAATTT
Bos_taurus|13136                    GTGCAGACGTACCAG------------------CCGCCGTGGAAAGCGCTCAGCGAGTTC
Spermophilus_tridecemlineatus|5969  GTGCAGACCTACCAG------------------CCTCCATGGAAAGCACTCAGCGAGTTC
Dasypus_novemcinctus|10026          GTGCAGACGTACCAG------------------CCGCCGTGGAAAGCGCTCAGCGAGTTC
Choloepus_hoffmanni|1405            GTGCAGACGTACCAG------------------CCTCCGTGGAAAGCGCTCAGCGAGTTC
Tursiops_truncatus|10256            GTGCAGACGTACCAG------------------CCGCCATGGAAAGCGCTCAGCGAGTTC
Nematostella_vectensis|12483        ATGTCAGGTTACCAA---------------------CCATGGAAAGCGCTAAATGATTTC
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 GTGCACGCCTTCGCC------------------CCGCCCTGGAAGGCCCTGGCCGAGTTC
Ixodes_scapularis|17836             ---------------------------------GCAAGATGGCGAAGCCTCCAATTAATT
Pediculus_humanus|2973              GTACATTCTTATCAA------------------CCTCCTTGGAAAGCTCTGTCGGATTTT
Nasonia_vitripennis|9293            GTGCAGGCTTATCAG------------------CCGCCCTGGAAGGCTCTGTCGGATTTC
Apis_mellifera|33486                GTGCAAGCTTATCAA------------------CCACCGTGGAAAGCTCTTTCAGATTTC
Linepithema_humile|6941             GTTCAGGCTTATCAG------------------CCACCATGGAAAGCGCTTTCAGACTTC
Pogonomyrmex_barbatus|2677          GTCCAGGCTTATCAG------------------CCACCGTGGAAAGCGCTTTCGGAGTTT
Culex_quinquefasciatus|15641        GTGACCGCGTACCAA------------------CCGCCCTGGAAGGCCCTGTCCGACTTT
Bombyx_mori|3274                    ---------------------------------CCCCCCCTG------------------
Drosophila_persimilis|16405         GTGCAGACATATCAA------------------CCGCCGTGGAAAGCCTTAAGCGATTTT
Drosophila_yakuba|7048              GTGCAGACATATCAA------------------CCGCCGTGGAAAGCCTTAAGCGACTTC
Drosophila_melanogaster|3349        GTGCAGACATATCAA------------------CCGCCATGGAAAGCCTTAAGCGACTTC
Drosophila_simulans|4567            GTGCAGACATATCAA------------------CCGCCGTGGAAAGCCTTAAGCGACTTC
Drosophila_sechellia|11762          GTGCAGACATATCAA------------------CCGCCGTGGAAAGCCTTAAGCGACTTC
                                                                                                

Ixodes_scapularis|17839             GCCATGCAC---------CCGCAGGACGTGGACCCG------------------TCCACG
Caenorhabditis_elegans|1417         CCTATGATGTTCAACTCTCCTTCGACATTTGATGTTTCGGTTATTCTTGCCCCAGTTGCT
Danio_rerio|3280                    ATTCTGGAA------------AACGAAGCTGAGCAC------------------------
Xenopus_tropicalis|17501            GGGAAACTG---------------------------------------------------
Branchiostoma_floridae|41009        GCCTTGCAA------------AGTGATATAGAACAG------------------------
Tarsius_syrichta|14472              GCCTTGCAG------------AGTGACATAGATCAG------------------------
Erinaceus_europaeus|8777            GCCTTGCAG------------AGTGACATAGATCAG------------------------
Gorilla_gorilla|31558               GCCTTGCAG------------AGTGACATAGATCAG------------------------
Gallus_gallus|22550                 GCATTGCAG------------AGTGACATAGATCAA------------------------
Fugu_rubripes|7786                  GATGACATC------------ATCGATCGGGAAGTA------------------------
Rhesus_macaque|32038                GCCTTGCAG------------AGTGACATAGATCAG------------------------
Otolemur_garnettii|13561            GCTTTGCAA------------AGTGACATAGATCAG------------------------
Felis_catus|42581                   GCCTTGCAG------------AGTGACATAGATCAG------------------------
Microcebus_murinus|2006             GCCTTGCAA------------AGTGACATAGATCAG------------------------
Macropus_eugenii|9432               NNNNNNNNN------------NNNNNNNNNNNNNNN------------------------
Tupaia_belangeri|2263               GCCTTGCAG------------AGTGACATAGATCAG------------------------
Canis_familiaris|21922              GCCTTGCAG------------AGTGACATAGATCAG------------------------
Monodelphis_domestica|13648         GCTTTGCAG------------AGTGACATTGATCAG------------------------
Gasterosteus_aculeatus|19757        GCCCTGCAG------------AGCGACATCGACCAG------------------------
Callithrix_jacchus|44206            GCCTTGCAG------------AGTGACATAGATCAG------------------------
Ornithorhynchus_anatinus|25838      GCCCTGCAG------------AGCGACATCGATCAG------------------------
Danio_rerio|26298                   GCACTGCAG------------AGTGACATCGACCAG------------------------
Anolis_carolinensis|1277            GCCTTGCAG------------AGTGACATCGACCAA------------------------
Sorex_araneus|14424                 GCCTTGCAG------------AGTGACATAGATCAG------------------------
Pteropus_vampyrus|9384              GCCTTGCAG------------AGTGACATAGATCAG------------------------
Taeniopygia_guttata|18817           GCATTGCAG------------AGTGACATAGACCAA------------------------
Pongo_abelii|22055                  GCCTTGCAG------------AGTGACATAGATCAG------------------------
Ochotona_princeps|513               GCCTTGCAG------------AGTGACATAGATCAG------------------------
Dipodomys_ordii|15885               GCCTTGCAG------------AGTGACATAGATCAG------------------------
Procavia_capensis|12972             GCCTTGCAG------------AGTGACATAGATCAG------------------------
Equus_caballus|14099                GCCTTGCAG------------AGTGACATAGATCAG------------------------
Dasypus_novemcinctus|4895           GCCTTGCAG------------AGTGACATAGATCAG------------------------
Bos_taurus|12652                    GCCTTGCAG------------AGTGACATCGATCAG------------------------
Sus_scrofa|7945                     GCCTTGCAG------------AGTGACATAGATCAG------------------------
Oryctolagus_cuniculus|2869          GCCTTGCAG------------AGTGACATAGATCAG------------------------
Choloepus_hoffmanni|12539           GCCTTGCAG------------AGTGACATAGATCAG------------------------
Cavia_porcellus|12331               GCCTTGCAG------------AGTGACATAGATCAG------------------------
Echinops_telfairi|13551             GCCTTGCAG------------AGTGACATAGATCAG------------------------
Loxodonta_africana|24792            GCCTTGCAG------------AGTGACATAGATCAG------------------------
Mus_musculus|11820                  GCCTTGCAA------------AGCGACATAGATCAG------------------------
Pan_troglodytes|29600               GCCTTGCAG------------AGTGACATAGATCAG------------------------
Rattus_norvegicus|17976             GCCTTGCAA------------AGTGACATAGATCAG------------------------
Spermophilus_tridecemlineatus|13317 GCCTTGCAG------------AGTGACATAGATCAG------------------------
Tursiops_truncatus|5249             GCCTTGCAG------------AGTGACATAGATCAG------------------------
Ornithorhynchus_anatinus|28681      ---------------------TCCACCCTTCATCGC------------------------
Macropus_eugenii|7357               GCCCTACAA------------AGTGACCTAGACCAG------------------------
Xenopus_tropicalis|705              GCATTACAG------------AGTGACCTGGATCAG------------------------
Oryzias_latipes|15600               GCCCTGCAG------------AGTGACCTGGACCAG------------------------
Felis_catus|40996                   GCCCTCCAG------------AGTGACTTGGACCAA------------------------
Callithrix_jacchus|46809            ---------------------GGGGACACTCCCCGACTTGGAGCACGCGGCCCTGGAGCA
Microcebus_murinus|9605             NNNNNNNNN------------NNNNNNNNNNNNNNN------------------------
Danio_rerio|29046                   GCACTTCAG------------AGTGACTTAGATCAA------------------------
Oryzias_latipes|18527               GCCCTAGAG------------ACTGACTTGGATCAG------------------------
Gasterosteus_aculeatus|2399         GCCCTGCAG------------AGCGACCTGGACCAG------------------------
Tetraodon_nigroviridis|13830        GCCCTGCAG------------AGCGACCTGGACCAG------------------------
Fugu_rubripes|30053                 GCCCTACAG------------AGTGACCTGGACCAG------------------------
Tetraodon_nigroviridis|4572         GCGCTGCAG------------AGCGACCTGGAGCAG------------------------
Fugu_rubripes|1098                  GCGCTGCAG------------AGCGACCTGGAGCAG------------------------
Gasterosteus_aculeatus|22884        GCCCTGCAG------------AGCGACCTGGACCAG------------------------
Danio_rerio|20797                   GCCTTACAG------------AGCGACCTGGACCAG------------------------
Otolemur_garnettii|1567             NNNNNNNNN------------NNNNNNNNNNNNNNN------------------------
Monodelphis_domestica|57            GCTCTCCAA------------AGTGACCTGGACCAG------------------------
Echinops_telfairi|972               GCCCTCCAG------------AGTGACCTGGACCAG------------------------
Gorilla_gorilla|16948               GCCCTCCAG------------AGCGACCTGGACCAA------------------------
Cavia_porcellus|24856               GCGTTGCAG------------AGCGACCTAGACCAA------------------------
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------------------------------------
Otolemur_garnettii|2070             GCCCTTCAG------------AGTGACCTGGACCAA------------------------
Ochotona_princeps|15487             GCTCTCCAG------------AGTGACCTGGATCAA------------------------
Mus_musculus|44064                  GCACTCCAG------------AGCGACCTGGACCAA------------------------
Rattus_norvegicus|33962             GCACTCCAG------------AGCGACCTGGATCAA------------------------
Procavia_capensis|16748             GCTCTCCAG------------AGTGACCTGGACCAA------------------------
Oryctolagus_cuniculus|21892         GCCCTGCAG------------AGTGATTTGGACCAA------------------------
Equus_caballus|1290                 GCCCTCCAG------------AGTGACCTGGACCAA------------------------
Homo_sapiens|29496                  GCCCTCCAG------------AGCGACCTGGACCAA------------------------
Pongo_abelii|9734                   GCCCTCCAG------------AGCGACCTGGACCAA------------------------
Pan_troglodytes|13247               GCCCTCCAG------------AGCGACCTGGACCAA------------------------
Rhesus_macaque|34621                GCCCTCCAG------------AGCGACCTGGACCAA------------------------
Bos_taurus|13136                    GCGCTCCAG------------AGTGACCTGGACCAA------------------------
Spermophilus_tridecemlineatus|5969  GCACTCCAG------------AGTGACCTGGACCAA------------------------
Dasypus_novemcinctus|10026          GCTCTCCAA------------AGTGACCTGGACCAA------------------------
Choloepus_hoffmanni|1405            GCCCTCCAT------------AGTGACTTGCACCAA------------------------
Tursiops_truncatus|10256            GCCCTCCAG------------AGTGACCTGGACCAA------------------------
Nematostella_vectensis|12483        GCGATGCAT------------AGCGAGATGGACCAA------------------------
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 GCCTTGCAC------------AACGATCTGGAGCGC---------ATCGATCCGTCCGCA
Ixodes_scapularis|17836             GCGGAGGAG---------------------------------------------------
Pediculus_humanus|2973              GCATTGCAT------------ACGGATTTAGACAGG---------CTTGATCCGGCAGCT
Nasonia_vitripennis|9293            GCGCTGCAT------------ACTGATCTGGACAGG---------CTCGACCCGAACGCG
Apis_mellifera|33486                GCTCTGCAC------------ACTGATTTAGATAGG---------CTAGATCCTAACACT
Linepithema_humile|6941             GCGCTTCAC------------ACGGACTTGGACCGA---------TTAGATCCCAACGCA
Pogonomyrmex_barbatus|2677          GCGCTTCAC------------ACAGACTTGGAACGA---------TTGGATCCCACTACG
Culex_quinquefasciatus|15641        GCGCTGCAC------------TCCGACCTGGACAGCAACGGCGCGATCAACACCCACACG
Bombyx_mori|3274                    ------------------------------------------------------------
Drosophila_persimilis|16405         GCCCTGCAC------------GCCGATCTCGACAGCAATGGAGCAATCAATACGCACACA
Drosophila_yakuba|7048              GCCCTCCAC------------GCCGATCTCGACAGCAATGGAGCGATCAATACCCACACG
Drosophila_melanogaster|3349        GCCCTTCAC------------GCCGATCTCGACAGCAATGGAGCGATCAATACCCACACG
Drosophila_simulans|4567            GCCCTTCAC------------GCCGATCTCGACAGCAATGGAGCGATCAATACCCACACG
Drosophila_sechellia|11762          GCCCTTCAC------------GCCGATCTCGACAGCAATGGAGCGATCAATACCCACACG
                                                                                                

Ixodes_scapularis|17839             CCACACTTCCAGCACCTC---GTCAACCAGATGCACGGCTACGACACGGGCGACCCCGGC
Caenorhabditis_elegans|1417         CCAAACGTCACATCACCA------------------------------------------
Danio_rerio|3280                    AGATCATTCCCACAAATG------------------------------------------
Xenopus_tropicalis|17501            ---------------CTT------------------------------------------
Branchiostoma_floridae|41009        CCCGCCTTTCAACAGTTG---AAATCCGGGGATGTCCACGCTCAGCTACCGTGTGGGGGA
Tarsius_syrichta|14472              CCTGCTTTTCAGCAACTG---GTCAAT---------------------------------
Erinaceus_europaeus|8777            CCGGCCTTTCAGCAGCTG---GTCAAT---------------------------------
Gorilla_gorilla|31558               CCTGCTTTTCAGCAACTG---GTCAAT---------------------------------
Gallus_gallus|22550                 CCTGCTTTTCACCAACTA---GTTAAT---------------------------------
Fugu_rubripes|7786                  AACTTGCAAACGGTCATG---GTCAGT---------------------------------
Rhesus_macaque|32038                CCTGCTTTTCAGCAACTG---GTCAAT---------------------------------
Otolemur_garnettii|13561            CCAGCTTTTCAGCAACTG---GTCAAT---------------------------------
Felis_catus|42581                   CCTGCTTTTCAGCAACTG------------------------------------------
Microcebus_murinus|2006             CCTGCTTTTCAGCAACTG------------------------------------------
Macropus_eugenii|9432               NNNNNNNNNNNNNNNNNN---GTCAAT---------------------------------
Tupaia_belangeri|2263               CCCGCTTTTCAGCAACTG---GTCAAT---------------------------------
Canis_familiaris|21922              CCTGCTTTTCAGCAACTG---GTAAGT---------------------------------
Monodelphis_domestica|13648         CCTGCCTTTCAGCAACTG---GTCAAT---------------------------------
Gasterosteus_aculeatus|19757        CCGGCCTTCCAGCAACTG---GTCAGC---------------------------------
Callithrix_jacchus|44206            CCTGCTTTTCAGCAACTG---GTCAAT---------------------------------
Ornithorhynchus_anatinus|25838      CCCGCCTTCCAACAACTG---GTTAAT---------------------------------
Danio_rerio|26298                   CCTGCTTTCCAACAACTG---GTTAAT---------------------------------
Anolis_carolinensis|1277            CCCGCCTTTCAGCAACTC---GTCAAT---------------------------------
Sorex_araneus|14424                 CCTGCTTTTCAGCAACCC---GTCAAT---------------------------------
Pteropus_vampyrus|9384              CCTGCTTTTCAGCAACTG------------------------------------------
Taeniopygia_guttata|18817           CCTGCTTTTCAGCAACTA---GTTAAT---------------------------------
Pongo_abelii|22055                  CCTGCTTTTCAGCAACTG---GTCAAT---------------------------------
Ochotona_princeps|513               CCTGCTTTTCAGCAATTG---GTCAAT---------------------------------
Dipodomys_ordii|15885               CCTGCTTTTCAGCAACTG---GTCAAT---------------------------------
Procavia_capensis|12972             CCTGCTTTTCAGCAACTG---GTCAAC---------------------------------
Equus_caballus|14099                CCTGCTTTTCAGCAACTG---GTCAAT---------------------------------
Dasypus_novemcinctus|4895           CCTGCTTTTCAGCAACTG---GTCAAT---------------------------------
Bos_taurus|12652                    CCGGCTTTTCAGCAACTG---GTTAAT---------------------------------
Sus_scrofa|7945                     CCGGCTTTTCAGCAACTG---GTCAAT---------------------------------
Oryctolagus_cuniculus|2869          CCTGCTTTTCAGCAACTG---GTCAAT---------------------------------
Choloepus_hoffmanni|12539           CCTGCTTTTCAGCAACTG---GTCAAT---------------------------------
Cavia_porcellus|12331               CCTGCTTTTCAGCAACTG---GTCAAT---------------------------------
Echinops_telfairi|13551             CCTGCTTTTCAGCAACTG---GTCAAT---------------------------------
Loxodonta_africana|24792            CCTGCTTTTCAGCAACTG---GTCAAT---------------------------------
Mus_musculus|11820                  CCTGCTTTTCAGCAACTG---GTCAAT---------------------------------
Pan_troglodytes|29600               CCTGCTTTTCAGCAACTG---GTCAAT---------------------------------
Rattus_norvegicus|17976             CCTGCTTTTCAGCAACTG---GTCAAT---------------------------------
Spermophilus_tridecemlineatus|13317 CCTGCTTTTCAGCAACTG---GTCAAT---------------------------------
Tursiops_truncatus|5249             CCGGCTTTTCAGCAACTG---GTCAAT---------------------------------
Ornithorhynchus_anatinus|28681      CTCTCTCTCCGGTCCCAG---GTGTCT---------------------------------
Macropus_eugenii|7357               CCAGCCTTCCAGCAACTG---GTGTCC---------------------------------
Xenopus_tropicalis|705              CCTGCATTCCAACAACTG---GTGTCT---------------------------------
Oryzias_latipes|15600               CCAGCCTTTCAGCAACTG---GTG------------------------------------
Felis_catus|40996                   CCCGCCTTCCAGCAGCTG---GTCTCC---------------------------------
Callithrix_jacchus|46809            CCAGCTTGGGTGCCTCTTCACCCGCCT---------------------------------
Microcebus_murinus|9605             NNNNNNNNNNNNNNNNNN---GTCTCC---------------------------------
Danio_rerio|29046                   CCTGCCTTTCAACAGCTG---GTCTCT---------------------------------
Oryzias_latipes|18527               CCTGCTTTCCAACATctg---GTGTCT---------------------------------
Gasterosteus_aculeatus|2399         CCGGCCTTCCAACAACTG---GTGTCT---------------------------------
Tetraodon_nigroviridis|13830        CCCGCCTTCCAACAACTG---GTGTCT---------------------------------
Fugu_rubripes|30053                 CCTGCCTTCCAACAACTG---GTATCT---------------------------------
Tetraodon_nigroviridis|4572         CCGGCCTTCCAACAACTG---GTGTCC---------------------------------
Fugu_rubripes|1098                  CCAGCCTTCCAGCAACTG---GTGTCC---------------------------------
Gasterosteus_aculeatus|22884        CCCGCTTTCCAACAGCTGCAGGTGTCT---------------------------------
Danio_rerio|20797                   CCTGCTTTCCAACAGCTG---GTGTCA---------------------------------
Otolemur_garnettii|1567             NNNNNNNNNNNNNNNNNN---GTCAAT---------------------------------
Monodelphis_domestica|57            CCGGCCTTCCAGCAACTG---GTGTCC---------------------------------
Echinops_telfairi|972               CCGGCTTTCCAGCAGCTG---GTCTCC---------------------------------
Gorilla_gorilla|16948               CCCGCCTTCCAACAGCTG---GTCTCC---------------------------------
Cavia_porcellus|24856               CCGGCCTTTCAGCAGCTG---GTCTCC---------------------------------
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------------------------------------
Otolemur_garnettii|2070             CCTGCTTTCCAGCAGCTG---GTCTCC---------------------------------
Ochotona_princeps|15487             CCCGCCTTCCAGCAGCTG---GTCTCT---------------------------------
Mus_musculus|44064                  CCCGCCTTTCAACAGCTG---GTTTCC---------------------------------
Rattus_norvegicus|33962             CCCGCCTTTCAACAGCTG---GTCTCC---------------------------------
Procavia_capensis|16748             CCCGCCTTCCAGCAGCTG---GTCTCC---------------------------------
Oryctolagus_cuniculus|21892         CCCGCCTTCCAGCAGTTG---GTCTCC---------------------------------
Equus_caballus|1290                 CCCGCCTTCCAGCAGCTG---GTATCC---------------------------------
Homo_sapiens|29496                  CCCGCCTTCCAACAGCTG---GTCTCC---------------------------------
Pongo_abelii|9734                   CCCGCCTTCCAACAGCTG---GTCTCC---------------------------------
Pan_troglodytes|13247               CCCGCCTTCCAACAGCTG---GTCTCC---------------------------------
Rhesus_macaque|34621                CCCGCCTTCCAGCAGCTG---GTCTCC---------------------------------
Bos_taurus|13136                    CCCGCCTTCCAGCAGCTG---GTCTCC---------------------------------
Spermophilus_tridecemlineatus|5969  CCAGCCTTCCAGCAGCTG---TTCTTC---------------------------------
Dasypus_novemcinctus|10026          CCCGCCTTCCAGCAGCTG------------------------------------------
Choloepus_hoffmanni|1405            CCCGACTTCCAGCAGCTG---GTCTCC---------------------------------
Tursiops_truncatus|10256            CCCGCCTTCCAGCAGCTG---GTCTCC---------------------------------
Nematostella_vectensis|12483        GGCGCATTTCAGCAATTG---GTTCAC---------------------------------
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 CCGCATTTCCAGCAGCTC------------------------------------------
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              CCGCCATTTCAACATTTG---GTCAATCAGGTAAATTTTTTTAATTTA------------
Nasonia_vitripennis|9293            CCTTCCTTCCATCATCTC---GTCTCGCAGATGCACGGCTACGACATGCACGGCGGTGGC
Apis_mellifera|33486                CCTTCTTTCCATCATTTG---GTATCACAGATGCACGGTTATGATCTTCACAGTGGACCA
Linepithema_humile|6941             CCGTCTTTCCATCATTTG---GTATCTCAGATGCACGGCTACGACTTGCACGGGGGTCCG
Pogonomyrmex_barbatus|2677          CCGTCGTTCCACCACTTG---GTGTCCCAGATGCACGGTTACGACTTGCATGGGGGA---
Culex_quinquefasciatus|15641        CCCGCGTTCCAGCATCTG---GTCAATCAGATGCACGGTTACGACGTGGGCGGCGGCGGT
Bombyx_mori|3274                    CCGGCGCCGCGC------------------------------------------------
Drosophila_persimilis|16405         CCTGCATTTCAGCAGCTG---GTCAATCAGATGCATGGGTACGATCTGAATGGAATGCCA
Drosophila_yakuba|7048              CCCGCATTTCAGCAGTTG---GTCAATCAGATGCACGGCTACGACCTGAACGGGATGCCC
Drosophila_melanogaster|3349        CCCGCATTTCAGCAGTTG---GTCAATCAGATGCACGGCTACGACCTGAACGGGATGCCC
Drosophila_simulans|4567            CCCGCATTTCAACAGTTG---GTCAATCAGATGCACGGCTACGACCTGAATGGGATGCCC
Drosophila_sechellia|11762          CCCGCATTTCAGCAGTTG---GTCAATCAGATGCACGGCTACGACCTGAATGGGATGCCC
                                                                                                

Ixodes_scapularis|17839             GGCCACTGTCTCGGGGGCGTGATCCCCCTC---------------------------TCG
Caenorhabditis_elegans|1417         ------------------------------------------------------------
Danio_rerio|3280                    ------------------------------------------------------------
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        GGCATGATGGTACTGACCCTCCATCCACACAGTCATACTCCGGTAAGTTCGTTCGACCAC
Tarsius_syrichta|14472              ------------------------------------------------------------
Erinaceus_europaeus|8777            ------------------------------------------------------------
Gorilla_gorilla|31558               ------------------------------------------------------------
Gallus_gallus|22550                 ------------------------------------------------------------
Fugu_rubripes|7786                  ------------------------------------------------------------
Rhesus_macaque|32038                ------------------------------------------------------------
Otolemur_garnettii|13561            ------------------------------------------------------------
Felis_catus|42581                   ------------------------------------------------------------
Microcebus_murinus|2006             ------------------------------------------------------------
Macropus_eugenii|9432               ------------------------------------------------------------
Tupaia_belangeri|2263               ------------------------------------------------------------
Canis_familiaris|21922              ------------------------------------------------------------
Monodelphis_domestica|13648         ------------------------------------------------------------
Gasterosteus_aculeatus|19757        ------------------------------------------------------------
Callithrix_jacchus|44206            ------------------------------------------------------------
Ornithorhynchus_anatinus|25838      ------------------------------------------------------------
Danio_rerio|26298                   ------------------------------------------------------------
Anolis_carolinensis|1277            ------------------------------------------------------------
Sorex_araneus|14424                 ------------------------------------------------------------
Pteropus_vampyrus|9384              ------------------------------------------------------------
Taeniopygia_guttata|18817           ------------------------------------------------------------
Pongo_abelii|22055                  ------------------------------------------------------------
Ochotona_princeps|513               ------------------------------------------------------------
Dipodomys_ordii|15885               ------------------------------------------------------------
Procavia_capensis|12972             ------------------------------------------------------------
Equus_caballus|14099                ------------------------------------------------------------
Dasypus_novemcinctus|4895           ------------------------------------------------------------
Bos_taurus|12652                    ------------------------------------------------------------
Sus_scrofa|7945                     ------------------------------------------------------------
Oryctolagus_cuniculus|2869          ------------------------------------------------------------
Choloepus_hoffmanni|12539           ------------------------------------------------------------
Cavia_porcellus|12331               ------------------------------------------------------------
Echinops_telfairi|13551             ------------------------------------------------------------
Loxodonta_africana|24792            ------------------------------------------------------------
Mus_musculus|11820                  ------------------------------------------------------------
Pan_troglodytes|29600               ------------------------------------------------------------
Rattus_norvegicus|17976             ------------------------------------------------------------
Spermophilus_tridecemlineatus|13317 ------------------------------------------------------------
Tursiops_truncatus|5249             ------------------------------------------------------------
Ornithorhynchus_anatinus|28681      ------------------------------------------------------------
Macropus_eugenii|7357               ------------------------------------------------------------
Xenopus_tropicalis|705              ------------------------------------------------------------
Oryzias_latipes|15600               ------------------------------------------------------------
Felis_catus|40996                   ------------------------------------------------------------
Callithrix_jacchus|46809            ------------------------------------------------------------
Microcebus_murinus|9605             ------------------------------------------------------------
Danio_rerio|29046                   ------------------------------------------------------------
Oryzias_latipes|18527               ------------------------------------------------------------
Gasterosteus_aculeatus|2399         ------------------------------------------------------------
Tetraodon_nigroviridis|13830        ------------------------------------------------------------
Fugu_rubripes|30053                 ------------------------------------------------------------
Tetraodon_nigroviridis|4572         ------------------------------------------------------------
Fugu_rubripes|1098                  ------------------------------------------------------------
Gasterosteus_aculeatus|22884        ------------------------------------------------------------
Danio_rerio|20797                   ------------------------------------------------------------
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            ------------------------------------------------------------
Echinops_telfairi|972               ------------------------------------------------------------
Gorilla_gorilla|16948               ------------------------------------------------------------
Cavia_porcellus|24856               ------------------------------------------------------------
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------------------------------------
Otolemur_garnettii|2070             ------------------------------------------------------------
Ochotona_princeps|15487             ------------------------------------------------------------
Mus_musculus|44064                  ------------------------------------------------------------
Rattus_norvegicus|33962             ------------------------------------------------------------
Procavia_capensis|16748             ------------------------------------------------------------
Oryctolagus_cuniculus|21892         ------------------------------------------------------------
Equus_caballus|1290                 ------------------------------------------------------------
Homo_sapiens|29496                  ------------------------------------------------------------
Pongo_abelii|9734                   ------------------------------------------------------------
Pan_troglodytes|13247               ------------------------------------------------------------
Rhesus_macaque|34621                ------------------------------------------------------------
Bos_taurus|13136                    ------------------------------------------------------------
Spermophilus_tridecemlineatus|5969  ------------------------------------------------------------
Dasypus_novemcinctus|10026          ------------------------------------------------------------
Choloepus_hoffmanni|1405            ------------------------------------------------------------
Tursiops_truncatus|10256            ------------------------------------------------------------
Nematostella_vectensis|12483        ------------------------------------------------------------
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 ------------------------------------------------------------
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              ---------------------------------AATCCGCCTCCTCCCCACCAATCATTT
Nasonia_vitripennis|9293            GGA---------------------------------------------------CCACCG
Apis_mellifera|33486                CCACAATTACCTCCACCGGGAATGCTCGGTGGACCAATGAACGACGGT------------
Linepithema_humile|6941             CCGCCGCAATTGCCGCCTCCGGGGATGCTCGGCGGGCCGATG------------------
Pogonomyrmex_barbatus|2677          ---------------------------------------CCACCGGCGCAATTGGCACCA
Culex_quinquefasciatus|15641        GGCATGCACCAG------------------------------------------------
Bombyx_mori|3274                    ------------------------------------------------------------
Drosophila_persimilis|16405         GTGCTGCCGCCACATCCGCCACAGGGACCACACCCACCGCCGCCGGGCCAGCAA------
Drosophila_yakuba|7048              ATCCTGCCGCCGCATCCGCACTCGCATCCGGCGCAAGGACCTCCCCACCAGCACCCCCCG
Drosophila_melanogaster|3349        ATTCTGCCGCCGCATCCGCACTCGCATCCGGCGCAAGGACCTCCCCACCAGCACCCCCCG
Drosophila_simulans|4567            ATCCTGCCGCCGCATCCGCACTCGCATCCGGCGCAAGGACCTCCCCACCAGCACCCCCCG
Drosophila_sechellia|11762          ATCCTGCCGCCGCATCCGCACTCGCATCCGGCGCAAGGACCTCCCCACCAGCACCCCCCG
                                                                                                

Ixodes_scapularis|17839             GTGCCCGGGGCCTACCTGTGCCCGGACGACGGCCTGGGCTCGTCGCCTGAGACGGCCGGG
Caenorhabditis_elegans|1417         ---------------------------------------------TCTGAAGCACTGGGA
Danio_rerio|3280                    ---------------------------------------CTGTCTTTACCAACAGAAGGC
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        AACAGTGGAAATGTCCCGACCTCACAGCCTGGGCCTGGAATGGCTGCACCG---GGTGGA
Tarsius_syrichta|14472              ---------------------------------------TTT---TCAGAA---GGAGGA
Erinaceus_europaeus|8777            ---------------------------------------TTT---TCAGAA---GGAGGA
Gorilla_gorilla|31558               ---------------------------------------TTT---TCAGAA---GGAGGA
Gallus_gallus|22550                 ---------------------------------------TTT---TCAGAA---GGAGGA
Fugu_rubripes|7786                  ---------------------------------------TTC---TCGGAA---GGGGGA
Rhesus_macaque|32038                ---------------------------------------TTT---TCAGAA---GGAGGA
Otolemur_garnettii|13561            ---------------------------------------TTT---TCAGAA---GGAGGA
Felis_catus|42581                   ------------------------------------------------------------
Microcebus_murinus|2006             ------------------------------------------------------------
Macropus_eugenii|9432               ---------------------------------------TTT---TCCGAA---GGTGGG
Tupaia_belangeri|2263               ---------------------------------------TTT---TCAGAA---GGAGGA
Canis_familiaris|21922              ---------------------------------------GTCAGCTCTCAG---AGAGGA
Monodelphis_domestica|13648         ---------------------------------------TTT---TCAGAA---GGTGGG
Gasterosteus_aculeatus|19757        ---------------------------------------TTC---TCGGAA---GGAGGA
Callithrix_jacchus|44206            ---------------------------------------TTT---TCAGAA---GGAGGA
Ornithorhynchus_anatinus|25838      ---------------------------------------TTT---TCGGAA---GGAGGC
Danio_rerio|26298                   ---------------------------------------TTT---TCTGAA---GGTGGT
Anolis_carolinensis|1277            ---------------------------------------TTT---TCCGAA---GGAGGA
Sorex_araneus|14424                 ---------------------------------------TTT---TCAGAA---GGAGGA
Pteropus_vampyrus|9384              ------------------------------------------------------------
Taeniopygia_guttata|18817           ---------------------------------------TTT---TCAGAA---GGAGGA
Pongo_abelii|22055                  ---------------------------------------TTT---TCAGAA---GGAGGA
Ochotona_princeps|513               ---------------------------------------TTT---TCAGAA---GGAGGA
Dipodomys_ordii|15885               ---------------------------------------TTT---TCAGAA---GGAGGA
Procavia_capensis|12972             ---------------------------------------TTT---TCAGAA---GGAGGA
Equus_caballus|14099                ---------------------------------------TTT---TCAGAA---GGAGGA
Dasypus_novemcinctus|4895           ---------------------------------------TTT---TCAGAA---GGAGGA
Bos_taurus|12652                    ---------------------------------------TTT---TCAGAA---GGAGGA
Sus_scrofa|7945                     ---------------------------------------TTT---TCAGAA---GGAGGA
Oryctolagus_cuniculus|2869          ---------------------------------------TTT---TCAGAA---GGAGGA
Choloepus_hoffmanni|12539           ---------------------------------------TTT---TCAGAA---GGAGGA
Cavia_porcellus|12331               ---------------------------------------TTT---TCAGAA---GGAGGA
Echinops_telfairi|13551             ---------------------------------------TTT---TCAGAA---GGAGGA
Loxodonta_africana|24792            ---------------------------------------TTT---TCAGAA---GGAGGA
Mus_musculus|11820                  ---------------------------------------TTT---TCAGAA---GGAGGA
Pan_troglodytes|29600               ---------------------------------------TTT---TCAGAA---GGAGGA
Rattus_norvegicus|17976             ---------------------------------------TTT---TCAGAA---GGAGGA
Spermophilus_tridecemlineatus|13317 ---------------------------------------TTT---TCAGAA---GGAGGA
Tursiops_truncatus|5249             ---------------------------------------TTT---TCAGAA---GGAGGA
Ornithorhynchus_anatinus|28681      ---------------------------------------TTC---TCGGAG---TCTGGC
Macropus_eugenii|7357               ---------------------------------------TTC---TCTGAG---TCTGGC
Xenopus_tropicalis|705              ---------------------------------------TTT---TCGGAG---TCTGGT
Oryzias_latipes|15600               ------------------------------------------------------------
Felis_catus|40996                   ---------------------------------------TTC---TCTGAG---TCTGGC
Callithrix_jacchus|46809            ---------------------------------------CTTCCCGGTGTCTCCGCCGCC
Microcebus_murinus|9605             ---------------------------------------TTC---TCCGAG---TCCGGC
Danio_rerio|29046                   ---------------------------------------TTC---TCGGAA---TCCGGT
Oryzias_latipes|18527               ---------------------------------------TTC---TCTGAA---TCGGGC
Gasterosteus_aculeatus|2399         ---------------------------------------TTT---TCTGAA---TCGGGC
Tetraodon_nigroviridis|13830        ---------------------------------------TTC---TCGGAG---TCGGGG
Fugu_rubripes|30053                 ---------------------------------------TTC---TCTGAG---TCGGGG
Tetraodon_nigroviridis|4572         ---------------------------------------TTC---TCTGAA---TCGGGC
Fugu_rubripes|1098                  ---------------------------------------TTC---TCTGAA---TCGGGC
Gasterosteus_aculeatus|22884        ---------------------------------------TTC---TCCGAG---TCGGGC
Danio_rerio|20797                   ---------------------------------------TTT---TCCGAG---TCGGGT
Otolemur_garnettii|1567             ---------------------------------------TTT---TCAGAA---GGAGGA
Monodelphis_domestica|57            ---------------------------------------TTC---TCCGAG---TCGGGC
Echinops_telfairi|972               ---------------------------------------TTC---TCCGAG---TCCGGC
Gorilla_gorilla|16948               ---------------------------------------TTC---TCCGAG---TCCGGC
Cavia_porcellus|24856               ---------------------------------------TTC---TCTGAG---TCTGGC
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------------------------------------
Otolemur_garnettii|2070             ------------------------------------------------------------
Ochotona_princeps|15487             ---------------------------------------TTC---TCCGAG---TCCGGC
Mus_musculus|44064                  ---------------------------------------TTC---TCCGAG---TCAGGC
Rattus_norvegicus|33962             ---------------------------------------TTC---TCCGAG---TCAGGC
Procavia_capensis|16748             ---------------------------------------TTC---TCCGAG---TCCGGC
Oryctolagus_cuniculus|21892         ---------------------------------------TTC---TCCGAG---TCTGGG
Equus_caballus|1290                 ---------------------------------------TTC---TCCGAG---TCTGGC
Homo_sapiens|29496                  ---------------------------------------TTC---TCCGAG---TCCGGC
Pongo_abelii|9734                   ---------------------------------------TTC---TCCGAG---TCCGGC
Pan_troglodytes|13247               ---------------------------------------TTC---TCCGAG---TCCGGC
Rhesus_macaque|34621                ---------------------------------------TTC---TCCGAG---TCCGGC
Bos_taurus|13136                    ---------------------------------------TTC---TCTGAG---TCCGGC
Spermophilus_tridecemlineatus|5969  ---------------------------------------CAT---TCCGAC---TCTGGT
Dasypus_novemcinctus|10026          ------------------------------------------------------------
Choloepus_hoffmanni|1405            ---------------------------------------TTC---TCCGAG---TCCGGC
Tursiops_truncatus|10256            ---------------------------------------TTC---TCTGAG---TCTGGC
Nematostella_vectensis|12483        ---------------------------------------TTC---TCAGAG---CAAGCA
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 ------------------------------------------------------------
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              CCATCGACGTTAACAAATCCCACTTTTATCTCGTCCATGCACGGTTACGATATTCATGGA
Nasonia_vitripennis|9293            CAGCAGCTGCCTCCCCCGGGTATGTTATCCGGTCCGATGGGCGACGGTGGCGGTGGCGGT
Apis_mellifera|33486                ---------------------------------------------GGAGGTGGTGGAGGT
Linepithema_humile|6941             ---------------------------------------------AACGAC---GGCGGG
Pogonomyrmex_barbatus|2677          CCGCCGGGGATGCTCGGCGGACCG---------------ATGAGCGATGGGGGGGGCGGG
Culex_quinquefasciatus|15641        ---------------------------------------ATGGGACCGCAG---GGTGGC
Bombyx_mori|3274                    ------------------------------------------------------GGTCCC
Drosophila_persimilis|16405         ---------------------------------------ATGAACGGGCCGCCCGGCGGC
Drosophila_yakuba|7048              CCCCCCGGCGGACCGCACAACCACCAGAACCAGCATCCGAACCAGCAGCCC---GGAGGC
Drosophila_melanogaster|3349        CCCCCCGGCGGACCGCACAACCATCAGAACCAGCAGCCGAACCAGCAGCCC---GGAGGC
Drosophila_simulans|4567            CCCCCCGGCGGACCGCACAACCACCAGAACCAGCAGCCGAACCAGCAGCCC---GGAGGC
Drosophila_sechellia|11762          CCCCCCGGCGGACCGCACAACCACCAGAACCAGCAGCCGAACCAGCAGCCC---GGAGGC
                                                                                                

Ixodes_scapularis|17839             TCGTCCCCGGAGCCGAAGGCAGGGACGACCGCCGCCATGACCTCTGGAGGGCACCCAGTG
Caenorhabditis_elegans|1417         CCACTT---GGAGCATCCGTATTTCCTCATTTTTCACCTCAACAT---------------
Danio_rerio|3280                    CCGTGT---------TCTGCTGGAAGTGAAGTTGCGTCAGTATCA---------------
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        CCTGGTGAAGCTAACGGTAACGGTCCCGGTGTGCCGCCGCCGGGA---------------
Tarsius_syrichta|14472              CCGGGC---TCTAATTCTACTGGCAGTGAAGTAGCATCGATGTCC---------------
Erinaceus_europaeus|8777            CCTGGC---TCTAATTCCACTGGAAGTGAAGTGGCTTCGATGTCC---------------
Gorilla_gorilla|31558               CCGGGC---TCTAATTCCACTGGCAGTGAAGTAGCATCAATGTCC---------------
Gallus_gallus|22550                 CCTGGT---TCCAATTCTACCGGAAGTGAAGTGGCATCAATGTCC---------------
Fugu_rubripes|7786                  CCGGGC---TCCAACTCCACGGGCAGCGAGGTGGCGTCGATGTCG---------------
Rhesus_macaque|32038                CCGGGC---TCTAATTCCACTGGCAGTGAAGTAGCATCAATGTCC---------------
Otolemur_garnettii|13561            CCAGGC---TCTAATTCTACTGGCAGTGAAGTAGCATCGATGTCC---------------
Felis_catus|42581                   ------------------------------------------------------------
Microcebus_murinus|2006             ------------------------------------------------------------
Macropus_eugenii|9432               CCAGGT---TCGAATTCCACTGGAAGTGAAGTAGCATCAATGTCC---------------
Tupaia_belangeri|2263               CCAGGC---TCTAATTCCACTGGCAGTGAAGTAGCATCGATGTCC---------------
Canis_familiaris|21922              CCGGGC---TCTAATTCCACTGGCAGTGAAGTGGCGTCGATGTCC---------------
Monodelphis_domestica|13648         CCAGGT---TCCAATTCCACTGGAAGTGAAGTAGCATCAATGTCC---------------
Gasterosteus_aculeatus|19757        CCGGGT---TCCAACTCGACGGGCAGCGAGGTCGCCTCCATGTCG---------------
Callithrix_jacchus|44206            CCGGGC---TCTAATTCCACTGGCAGTGAAGTAGCATCAATGTCC---------------
Ornithorhynchus_anatinus|25838      CCCGGT---TCCAATTCTACCGGGAGTGAAGTAGCATCGATGTCT---------------
Danio_rerio|26298                   CCAGGC---TCAAACTCCACAGGGAGCGAGGTCGCGTCAATGTCC---------------
Anolis_carolinensis|1277            CCAGGT---TCCAATTCTACCGGAAGTGAGGTAGCATCGATGTCC---------------
Sorex_araneus|14424                 CCAGGC---TCTAATTCCACGGGCAGTGAAGTGGCGTCGATGTCC---------------
Pteropus_vampyrus|9384              ------------------------------------------------------------
Taeniopygia_guttata|18817           CCTGGT---TCCAATTCTACTGGAAGTGAAGTAGCATCAATGTCC---------------
Pongo_abelii|22055                  CCGGGC---TCTAATTCCACTGGCAGTGAAGTGGCATCAATGTCC---------------
Ochotona_princeps|513               CCAGGC---TCTAATTCCACTGGCAGTGAAGTAGCATCAATTTCC---------------
Dipodomys_ordii|15885               CCAGGC---TCTAATTCCACTGGCAGTGAAGTAGCATCCATGTCC---------------
Procavia_capensis|12972             CCTGGC---TCCAATTCCACTGGCAGTGAAGTGGCATCGATGTCC---------------
Equus_caballus|14099                CCCGGC---TCTAATTCCACTGGCAGTGAAGTGGCATCGATGTCC---------------
Dasypus_novemcinctus|4895           CCAGGC---TCTAATTCCACAGGCAGCGAAGTGGCGTCGATGTCC---------------
Bos_taurus|12652                    CCGGGC---TCTAATTCCACTGGCAGTGAAGTGGCGTCGATGTCC---------------
Sus_scrofa|7945                     CCGGGC---TCTAATTCCACTGGCAGTGAAGTGGCGTCGATGTCC---------------
Oryctolagus_cuniculus|2869          CCAGGC---TCTAATTCCACTGGCAGTGAAGTAGCATCAATGTCC---------------
Choloepus_hoffmanni|12539           CCAGGC---TCTAATTCCACTGGCAGTGAAGTGGCGTCGATGTCC---------------
Cavia_porcellus|12331               CCAGGC---TCTAATTCCACTGGCAGTGAAGTAGCATCGATGTCC---------------
Echinops_telfairi|13551             CCGGGC---TCTAATTCCACTGGCAGTGAAGTGGCATCAATGTCC---------------
Loxodonta_africana|24792            CCGGGC---TCTAATTCCACTGGCAGTGAAGTGGCGTCGATGTCC---------------
Mus_musculus|11820                  CCAGGC---TCTAATTCTACTGGCAGTGAAGTAGCATCGATGTCC---------------
Pan_troglodytes|29600               CCGGGC---TCTAATTCCACTGGCAGTGAAGTAGCATCAATGTCC---------------
Rattus_norvegicus|17976             CCAGGC---TCTAATTCCACTGGCAGTGAAGTAGCATCGATGTCC---------------
Spermophilus_tridecemlineatus|13317 CCAGGC---TCTAATTCCACTGGCAGTGAAGTAGCATCGATGTCC---------------
Tursiops_truncatus|5249             CCGGGC---TCTAATTCCACTGGCAGTGAAGTGGCGTCGATGTCC---------------
Ornithorhynchus_anatinus|28681      TCCCTG---GGGAACTCCTCCGGCAGCGACGTGACCTCCTTATCC---------------
Macropus_eugenii|7357               TCCCTG---GGGAATTCCTCGGGCAGCGACGTGACCTCCTTATCC---------------
Xenopus_tropicalis|705              TCCCTA---GGAAACTCTTCTGGCAGTGACATCGCTTCTCTGTCC---------------
Oryzias_latipes|15600               ------------------------------------------------------------
Felis_catus|40996                   TCGCTA---GGCAACTCCTCCGGCAGCGATGTGACCTCCCTGTCC---------------
Callithrix_jacchus|46809            CCAGGC------AACTCCTCCGGCAGCGACGTGACCTCCCTGTCC---------------
Microcebus_murinus|9605             TCCCTA---GGCACCTCCTCCGGCAGCGACGTGACCTCCCTGTCC---------------
Danio_rerio|29046                   TCTTTG---GGAAACTCATCGGGCAGCGACGTGACCTCTCTCTCT---------------
Oryzias_latipes|18527               TCTTTG---GGGAACTCCTCGGGCAGTGATGTGACCTCTCTGTCA---------------
Gasterosteus_aculeatus|2399         TCTCTC---GGAAACTCCTCGGGCAGCGACGTGACTTCTTTGTCC---------------
Tetraodon_nigroviridis|13830        TCTCTT---GGGAACTCTTCGGGCAGCGACGTGACTTCTCTGTCC---------------
Fugu_rubripes|30053                 TCTCTG---GGGAACTCTTCAGGCAGCGATGTGACGTCTCTGTCC---------------
Tetraodon_nigroviridis|4572         TCTTTG---GGAAATTCGTCCGCCAGCGACGTGACCTCTCTGTCG---------------
Fugu_rubripes|1098                  TCTTTG---GGGAATTCCTCCGCCAGTGATGTGACCTCTCTGTCG---------------
Gasterosteus_aculeatus|22884        TCCCTG---GGCAACTCCTCGGCCAGTGACGTGACCTCACTCTCG---------------
Danio_rerio|20797                   TCGCTG---GGTAACTCGTCTGGTAGTGATGTGACCTCTCTGTCA---------------
Otolemur_garnettii|1567             CCAGGC---TCTAATTCTACTGGCAGTGAAGTAGCATCGATGTCC---------------
Monodelphis_domestica|57            TCCCTG---GGGAACTCCTCCGGCAGCGACGTGACCTCCTTATCC---------------
Echinops_telfairi|972               TCCCTG---GGCAACTCCTCCGGCAGTGACGTGACCTCCTTGTCC---------------
Gorilla_gorilla|16948               TCCCTA---GGCAACTCCTCCGGCAGCGACGTGACCTCCCTGTCC---------------
Cavia_porcellus|24856               TCGCTG---GGCAACTCCTCCGGCAGCGATGTGACCTCCCTGTCC---------------
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------------------------------------
Otolemur_garnettii|2070             ------------------------------------------------------------
Ochotona_princeps|15487             TCCCTG---GGCAATTCCTCAGGCAGCGACGTGACCTCCCTGTCG---------------
Mus_musculus|44064                  TCCCTA---GGCAACTCTTCCGGTAGCGACGTGACCTCTCTGTCC---------------
Rattus_norvegicus|33962             TCCCTA---GGCAACTCCTCTGGTAGCGACGTGACCTCTCTGTCT---------------
Procavia_capensis|16748             TCCCTG---GGCAACTCTTCCGGCAGTGACGTGACCTCCCTGTCC---------------
Oryctolagus_cuniculus|21892         TCCCTG---GGCAACTCCTCGGGCAGCGACGTGACCTCCCTGTCC---------------
Equus_caballus|1290                 TCGCTA---GGCAACTCCTCTGGCAGCGACGTGACCTCCCTGTCC---------------
Homo_sapiens|29496                  TCCCTA---GGCAACTCCTCCGGCAGCGACGTGACCTCCCTGTCC---------------
Pongo_abelii|9734                   TCCCTA---GGCAACTCCTCCGGCAGCGACGTGACCTCCCTGTCC---------------
Pan_troglodytes|13247               TCCCTA---GGCAACTCCTCCGGCAGCGACGTGACCTCCCTGTCC---------------
Rhesus_macaque|34621                TCCCTA---GGCAACTCCTCCGGCAGCGACGTGACCTCCCTGTCC---------------
Bos_taurus|13136                    TCCCTA---GGCAACTCCTCCGGCAGCGACGTGACCTCCCTGTCC---------------
Spermophilus_tridecemlineatus|5969  TTCTTA---CGCAACTCTTCTGGTATCGACTTGTCCTTCTTTTCT---------------
Dasypus_novemcinctus|10026          ------------------------------------------------------------
Choloepus_hoffmanni|1405            TCCTTG---GGTAACTCCTCTGGCAGCGACGTGACCTCCCTGTCC---------------
Tursiops_truncatus|10256            TCCCTA---GGCAACTCCTCCGGCAGCGACGTGACCTCCCTGTCC---------------
Nematostella_vectensis|12483        CCGGGGAGTTTACCGCCCTCCTCTGATGGGATAGTATCGACGGGA---------------
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 ---------ATCAATCAGGTAAGACCCAATCTAAAAACAGCCCCA---------------
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              CCACCATCACATCACGATTTAGGACCC------CCACCAAATGAC---------------
Nasonia_vitripennis|9293            GGTGGACCTCTGCCCCCTCCGGGACCTCACCATCCTGGCGGCGGT---------------
Apis_mellifera|33486                GGTGGTTCTCTACCACCCCCTGGTCCACATCATCCCAGTGGTGGT---------------
Linepithema_humile|6941             GGTGGACCGTTACCGCCGCCGGGGCCTCATCATCCGGGTAGCGGC---------------
Pogonomyrmex_barbatus|2677          CCCTTA------CCGCCCCCGGGGCCTCATCATCCGGGTGGCGGT---------------
Culex_quinquefasciatus|15641        CAGGGC------CCTCTCATGGGTTCGCACATGGACATGAGCGGG---------------
Bombyx_mori|3274                    CCCGGGGGCGAGGACCAT---------TACGTCACGTACCTGGAG---------------
Drosophila_persimilis|16405         AGCAGCATGGACTCGGGCATCACCTCGCACCACCATCCGGATAGCACGGACTCGTATGTC
Drosophila_yakuba|7048              AGCAGCCTGGACTCCGGCATCACCTCGCACCACCATCCGGACAGCACCGACTCCTACGTC
Drosophila_melanogaster|3349        AGCAGTTTGGACTCCGGGATCACCTCGCACCACCATCCGGACAGCACCGACTCCTACGTC
Drosophila_simulans|4567            AGCAGTTTGGACTCCGGAATCACCTCACACCACCATCCGGACAGCACCGACTCCTACGTC
Drosophila_sechellia|11762          AGCAGTTTGGACTCCGGAATCACCTCACACCACCATCCGGACAGCACCGACTCCTACGTC
                                                                                                

Ixodes_scapularis|17839             TCCGTTCAGACCCATCTCCCTCTCGCCCTCCTGCCCTCACCCGCCCGCACACGCGACGTA
Caenorhabditis_elegans|1417         ------------------------GCTCCATTCACTGCAACATCACACGATATATCATCA
Danio_rerio|3280                    ------------------------GACACCGCC---------------AACAGCCTGACA
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        ------------------------GGA------CCAGAGATGCCCGTCGGAGCCAGTCCT
Tarsius_syrichta|14472              ------------------------TCTCAACTCCCAGATACACCT---AACAGCATGGTA
Erinaceus_europaeus|8777            ------------------------TCTCAGCTCCCAGATACACCC---AACAGCATGGTG
Gorilla_gorilla|31558               ------------------------TCTCAACTTCCAGATACACCT---AACAGCATGGTA
Gallus_gallus|22550                 ------------------------TCTCAGCTCCCAGATACGCCC---AACAGCATGGTA
Fugu_rubripes|7786                  ------------------------TCGCAGCTTCCAGACACGCCA---AACAGCATGGTC
Rhesus_macaque|32038                ------------------------TCTCAACTTCCAGATACACCT---AACAGCATGGTA
Otolemur_garnettii|13561            ------------------------TCTCAACTCCCAGATACACCT---AACAGCATGGTA
Felis_catus|42581                   ------------------------------------------------------------
Microcebus_murinus|2006             ------------------------------------------------------------
Macropus_eugenii|9432               ------------------------TCTCAGCTCCCAGATACACCA---AACAGCATGGTA
Tupaia_belangeri|2263               ------------------------TCTCAACTCCCAGATACACCT---AACAGCATGGTA
Canis_familiaris|21922              ------------------------TCTCAGCTCCCAGATACACCT---AACAGCATGGTA
Monodelphis_domestica|13648         ------------------------TCTCAGCTTCCAGATACACCA---AACAGCATGGTA
Gasterosteus_aculeatus|19757        ------------------------TCCCAGCTTCCAGACACGCCG---AACAGCATGGTG
Callithrix_jacchus|44206            ------------------------TCTCAACTTCCAGATACACCT---AACAGCATGGTA
Ornithorhynchus_anatinus|25838      ------------------------TCTCAGCTCCCAGACACCCCC---AACAGCATGGTA
Danio_rerio|26298                   ------------------------TCGCAACTGCCAGATACACCA---AACAGCATGGTA
Anolis_carolinensis|1277            ------------------------TCTCAACTCCCAGATACACCC---AACAGCATGGTA
Sorex_araneus|14424                 ------------------------TCTCAGCTCCCAGATACACCT---AACAGCATGGTA
Pteropus_vampyrus|9384              ------------------------------------------------------------
Taeniopygia_guttata|18817           ------------------------TCTCAGCTGCCAGATACACCC---AACAGCATGGTA
Pongo_abelii|22055                  ------------------------TCTCAACTTCCAGATACACCT---AACAGCATGGTA
Ochotona_princeps|513               ------------------------TCTCAACTCCCAGATACA------------------
Dipodomys_ordii|15885               ------------------------TCTCAGCTCCCAGACACACCA---AACAGCATGGTA
Procavia_capensis|12972             ------------------------TTTCAGCTCCCAGATACACCT---AACAGCATGGTA
Equus_caballus|14099                ------------------------TCTCAGCTCCCAGATACACCT---AACAGCATGGTA
Dasypus_novemcinctus|4895           ------------------------TCTCAGCTCCCAGATACACCT---AACAGCATGGTA
Bos_taurus|12652                    ------------------------TCTCAGCTCCCAGATACACCT---AACAGCATGGTA
Sus_scrofa|7945                     ------------------------TCTCAGCTCCCAGATACACCT---AACAGCATGGTA
Oryctolagus_cuniculus|2869          ------------------------TCTCAACTCCCAGATACACCT---AACAGCATGGTG
Choloepus_hoffmanni|12539           ------------------------TCTCAGCTCCCAGATACACCT---AACAGCATGGTA
Cavia_porcellus|12331               ------------------------TCTCAACTTCCAGACACACCC---AACAGCATGGTA
Echinops_telfairi|13551             ------------------------TCTCAGCTCCCAGATACACCT---AACAGCATGGTA
Loxodonta_africana|24792            ------------------------TCTCAGCTCCCAGATACACCT---AACAGCATGGTA
Mus_musculus|11820                  ------------------------TCGCAGCTCCCAGATACACCC---AACAGCATGGTA
Pan_troglodytes|29600               ------------------------TCTCAACTTCCAGATACACCT---AACAGCATGGTA
Rattus_norvegicus|17976             ------------------------TCTCAGCTCCCAGATACACCC---AACAGCATGGTA
Spermophilus_tridecemlineatus|13317 ------------------------TCTCAACTCCCAGATACACCT---AACAGCATGGTA
Tursiops_truncatus|5249             ------------------------TCTCAGCTCCCAGATACACCT---AACAGCATGGTA
Ornithorhynchus_anatinus|28681      ------------------------TCCCAGCTCCCGGACACCCCC---AACAGCATGGTC
Macropus_eugenii|7357               ------------------------TCGCAGCTCCCCGACACTCCG---AACAGCATGGTG
Xenopus_tropicalis|705              ------------------------TCTCAGCTTCCCGACACCCCG---AACAGCATGGTG
Oryzias_latipes|15600               ------------------------------------------------------------
Felis_catus|40996                   ------------------------TCGCAGCTCCCGGACACCCCC---AACAGCATGGTG
Callithrix_jacchus|46809            ------------------------TCGCAGCTCCCGGACACCCCC---AACAGTATGGTG
Microcebus_murinus|9605             ------------------------TCGCAGCTCCCAGACACCCCC---AACAGCATGGTG
Danio_rerio|29046                   ------------------------TCACAGTTACCGGACACACCG---AACAGTATGGTA
Oryzias_latipes|18527               ------------------------TCGCAGTTACCGGACACACCG---AACAGTATGGTG
Gasterosteus_aculeatus|2399         ------------------------TCTCAGTTACCGGACACTCCC---AACAGTATGGTA
Tetraodon_nigroviridis|13830        ------------------------TCCCAGTTACCGGACACCCCC---AACAGTATGGTC
Fugu_rubripes|30053                 ------------------------TCCCAGCTACCGGACACCCCC---AACAGTATGGTA
Tetraodon_nigroviridis|4572         ------------------------TCCCAGTTACCGGACACACCC---AACAGCATGGTC
Fugu_rubripes|1098                  ------------------------TCCCAGTTACCGGACACACCG---AACAGTATGGTC
Gasterosteus_aculeatus|22884        ------------------------TCCCAGCTACCGGACACACCG---AACAGCATGGTG
Danio_rerio|20797                   ------------------------TCGCAGTTACCCGACACCCCC---AACAGCATGGTG
Otolemur_garnettii|1567             ------------------------TCTCAACTCCCAGATACACCT---AACAGCATGGTA
Monodelphis_domestica|57            ------------------------TCCCAGCTCCCGGACACTCCG---AACAGCATGGTG
Echinops_telfairi|972               ------------------------TCGCAGCTCCCCGACACCCCT---AACAGCATGGTG
Gorilla_gorilla|16948               ------------------------TCGCAGCTCCCGGACACCCCC---AACAGTATGGTG
Cavia_porcellus|24856               ------------------------TCGCAGCTCCCGGACACCCCC---AACAGTATGGTG
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------------------------------------
Otolemur_garnettii|2070             ------------------------------------------------------------
Ochotona_princeps|15487             ------------------------TCGCAGCTCCCGGACACCCCC---AACAGTATGGTG
Mus_musculus|44064                  ------------------------TCGCAGCTCCCGGACACCCCC---AACAGTATGGTA
Rattus_norvegicus|33962             ------------------------TCGCAGCTCCCGGACACCCCC---AACAGTATGGTA
Procavia_capensis|16748             ------------------------TCGCAGCTCCCTGACACTCCC---AACAGCATGGTG
Oryctolagus_cuniculus|21892         ------------------------TCGCAGCTCCCGGACACCCCC---AACAGTATGGTG
Equus_caballus|1290                 ------------------------TCGCAGCTCCCGGACACCCCC---AACAGCATGGTG
Homo_sapiens|29496                  ------------------------TCGCAGCTCCCGGACACCCCC---AACAGTATGGTG
Pongo_abelii|9734                   ------------------------TCGCAGCTCCCGGACACCCCC---AACAGTATGGTG
Pan_troglodytes|13247               ------------------------TCGCAGCTCCCGGACACCCCC---AACAGTATGGTG
Rhesus_macaque|34621                ------------------------TCGCAGCTCCCGGACACCCCC---AACAGTATGGTG
Bos_taurus|13136                    ------------------------TCGCAGCTCCCGGACACCCCC---AACAGCATGGTG
Spermophilus_tridecemlineatus|5969  ------------------------------------------------------------
Dasypus_novemcinctus|10026          ------------------------------------------------------------
Choloepus_hoffmanni|1405            ------------------------TCGCAGCTACCGGACACCCCC---AACAGCATGGTG
Tursiops_truncatus|10256            ------------------------TCGCAGCTCCCGGACACCCCC---AACAGCATGGTG
Nematostella_vectensis|12483        ------------------------------------------------AAT---------
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 ------------------------------------------------------------
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              ------------------------GTAGGACATCCAGATTCAACA---GATTCATATGTA
Nasonia_vitripennis|9293            ---AACGGACCCGGACCAGACATGGGTCAGCATCCCGACAGCACC---GACAGTTACGTT
Apis_mellifera|33486                ------------GGTCCAGACATGGGTCAACACCCCGACAGCACA---GATAGCTATGTA
Linepithema_humile|6941             ------------GGGCCGGACATGGGCCAGCATCCCGACAGCACC---GACAGCTACGTG
Pogonomyrmex_barbatus|2677          ------------GGGCCAGACATGGGTCAACATCCTGACAGCACC---GACAGTTACGTG
Culex_quinquefasciatus|15641        ------------------------TACCACCATCCGGACAGTACG---GATTCGTACGTT
Bombyx_mori|3274                    ---------------------------------AGCGAC---------GACAGCCTCCCC
Drosophila_persimilis|16405         ACCTACCTGGAGAGCGATGACAAATCCAAACTGGCGCTGACACCGTCATCCTCGTCATCG
Drosophila_yakuba|7048              ACCTACCTGGAGAGCGATGACAAATCCAAACTGGCGCTGACCCCGTCGTCCTCTTCCTCG
Drosophila_melanogaster|3349        ACCTACCTGGAGAGCGATGACAAATCCAAGCTGGCGCTGACCCCGTCGTCCTCTTCCTCG
Drosophila_simulans|4567            ACCTACCTGGAGAGCGATGACAAATCCAAGCTGGCGCTGACCCCGTCGTCCTCTTCCTCG
Drosophila_sechellia|11762          ACCTACCTGGAGAGCGATGACAAATCCAAGCTGGCGCTGACCCCGTCGTCCTCTTCCTCG
                                                                                                

Ixodes_scapularis|17839             CCCGGTGGACAAGGGATGGGACACGAGAAAGAGTTCACCACGGCGCTTCAGCCCATAGGC
Caenorhabditis_elegans|1417         CCGGCG---------------------------------------------CCGTGTGGA
Danio_rerio|3280                    GCAAGT---------------------------------------------CCAACGGAC
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        CCTAAC---------------------------------------------CCGGTGACC
Tarsius_syrichta|14472              GCCAGT---------------------------------------------CCCATTGAG
Erinaceus_europaeus|8777            GCCAGT---------------------------------------------CCCATAGAG
Gorilla_gorilla|31558               GCCAGT---------------------------------------------CCTATTGAG
Gallus_gallus|22550                 GCCAGT---------------------------------------------CCTATTGAG
Fugu_rubripes|7786                  TCCAGC---------------------------------------------CCCATCGAA
Rhesus_macaque|32038                GCCAGT---------------------------------------------CCTATTGAG
Otolemur_garnettii|13561            GCCAGT---------------------------------------------CCTATTGAG
Felis_catus|42581                   ------------------------------------------------------------
Microcebus_murinus|2006             ------------------------------------------------------------
Macropus_eugenii|9432               GCCAGT------------------------------------------------ATTGAG
Tupaia_belangeri|2263               GCCAGT---------------------------------------------CCAATTGAG
Canis_familiaris|21922              GCCAGT---------------------------------------------CCTATTGAG
Monodelphis_domestica|13648         GCCAGT---------------------------------------------CCTATTGAG
Gasterosteus_aculeatus|19757        TCCAGC---------------------------------------------CCCATCGAG
Callithrix_jacchus|44206            GCCAGT---------------------------------------------CCTATTGAG
Ornithorhynchus_anatinus|25838      GCCAGT---------------------------------------------CCGATCGAG
Danio_rerio|26298                   GCGAGT---------------------------------------------CCTATAGAG
Anolis_carolinensis|1277            GCCAGT---------------------------------------------CCCATTGAG
Sorex_araneus|14424                 GCAAGT---------------------------------------------CCTATTGAG
Pteropus_vampyrus|9384              ------------------------------------------------------------
Taeniopygia_guttata|18817           GCCAGT---------------------------------------------CCTATTGAG
Pongo_abelii|22055                  GCCAGT---------------------------------------------CCTATTGAA
Ochotona_princeps|513               ------------------------------------------------------------
Dipodomys_ordii|15885               GCCAGT---------------------------------------------CCTATCGCA
Procavia_capensis|12972             GCCAGC---------------------------------------------CCTATTGAG
Equus_caballus|14099                GCCAGT---------------------------------------------CCTATTGAG
Dasypus_novemcinctus|4895           GCCAGT---------------------------------------------CCTATTGAG
Bos_taurus|12652                    GCCAGT---------------------------------------------CCAATTGAG
Sus_scrofa|7945                     GCCAGT---------------------------------------------CCTATTGAG
Oryctolagus_cuniculus|2869          GCCAGT---------------------------------------------CCTATTGAG
Choloepus_hoffmanni|12539           GCCAGT---------------------------------------------CCTATTGAG
Cavia_porcellus|12331               GCCAGT---------------------------------------------CCTATTGAG
Echinops_telfairi|13551             GCCAGT---------------------------------------------CCTATTGAG
Loxodonta_africana|24792            GCCAGT---------------------------------------------CCTATTGAG
Mus_musculus|11820                  GCCAGT---------------------------------------------CCTATTGAG
Pan_troglodytes|29600               GCCAGT---------------------------------------------CCTATTGAG
Rattus_norvegicus|17976             GCCAGT---------------------------------------------CCTATAGAG
Spermophilus_tridecemlineatus|13317 GCCAGT---------------------------------------------CCTATTGAG
Tursiops_truncatus|5249             GCCAGT---------------------------------------------CCAATTGAG
Ornithorhynchus_anatinus|28681      CCCAGC---------------------------------------------CCGGTGGAG
Macropus_eugenii|7357               CCCAGC---------------------------------------------CCAGTGGAG
Xenopus_tropicalis|705              CCCAGC---------------------------------------------CCTGTGGAG
Oryzias_latipes|15600               ------------------------------------------------------------
Felis_catus|40996                   CCGAGT---------------------------------------------CCTGTGGAG
Callithrix_jacchus|46809            CCGAGT---------------------------------------------CCCGTGGAG
Microcebus_murinus|9605             CCCAGT---------------------------------------------CCCGTGGAG
Danio_rerio|29046                   CCGAGC---------------------------------------------CCGGTGGAG
Oryzias_latipes|18527               CCGAGT---------------------------------------------CCCGTCGAC
Gasterosteus_aculeatus|2399         CCCAGC---------------------------------------------CCGGTGGAG
Tetraodon_nigroviridis|13830        CCAAGC---------------------------------------------CCGGTGGAG
Fugu_rubripes|30053                 CCGAGC---------------------------------------------CCGGTGGAG
Tetraodon_nigroviridis|4572         CACAGT---------------------------------------------CCCATCGAC
Fugu_rubripes|1098                  CACAGT---------------------------------------------CCCATTGAC
Gasterosteus_aculeatus|22884        CCGAGT---------------------------------------------CCCGTCGAC
Danio_rerio|20797                   CCCAGT---------------------------------------------CCCGTGGAG
Otolemur_garnettii|1567             GCCAGT---------------------------------------------CCTATTGAG
Monodelphis_domestica|57            CCCAGC---------------------------------------------CCGGTGGAG
Echinops_telfairi|972               CCAAGT---------------------------------------------CCTGTGGAG
Gorilla_gorilla|16948               CCGAGT---------------------------------------------CCCGTGGAG
Cavia_porcellus|24856               CCTAGC---------------------------------------------CCCGTGAGA
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------------------------------------
Otolemur_garnettii|2070             ------------------------------------------------------------
Ochotona_princeps|15487             CCGAGT---------------------------------------------CCGGTGGAG
Mus_musculus|44064                  CCTAGT---------------------------------------------CCGGTGGAG
Rattus_norvegicus|33962             CCTAGT---------------------------------------------CCGGTGGAG
Procavia_capensis|16748             CCAAGT---------------------------------------------CCAGTGGAG
Oryctolagus_cuniculus|21892         CCGAGT---------------------------------------------CCCGTGGAG
Equus_caballus|1290                 CCGAGT---------------------------------------------CCCGTGGAG
Homo_sapiens|29496                  CCGAGT---------------------------------------------CCCGTGGAG
Pongo_abelii|9734                   CCTAGT---------------------------------------------CCCGTGGAG
Pan_troglodytes|13247               CCGAGT---------------------------------------------CCCGTGGAG
Rhesus_macaque|34621                CCGAGT---------------------------------------------CCCGTGGAG
Bos_taurus|13136                    CCGAGT---------------------------------------------CCCGTGGAG
Spermophilus_tridecemlineatus|5969  ------------------------------------------------------------
Dasypus_novemcinctus|10026          ------------------------------------------------------------
Choloepus_hoffmanni|1405            CCGAGT---------------------------------------------CCCGTGGAG
Tursiops_truncatus|10256            CCAAGT---------------------------------------------CCCGTGGAA
Nematostella_vectensis|12483        ------------------------------------------------------------
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 ---------------------------------------------------AAGATT---
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              ACGTAC------------------------------------------------CTGGAA
Nasonia_vitripennis|9293            ACTTAC------------------------------------------------CTCGAG
Apis_mellifera|33486                ACTTAC------------------------------------------------CTCGAA
Linepithema_humile|6941             ACCTAC------------------------------------------------GTCGAG
Pogonomyrmex_barbatus|2677          ACCTAC------------------------------------------------GTCGAG
Culex_quinquefasciatus|15641        TACGCG---------------------------------------------AGCGACGAC
Bombyx_mori|3274                    CCCTCC---------------------------------------------CCC------
Drosophila_persimilis|16405         GCATCG---------------------GCTGCCACATCGATCTCCTCGCCGCCATCGTCC
Drosophila_yakuba|7048              GCCTCG---------------------GCGGGCACATCGATCTCCTCGCCGCCATCGGGT
Drosophila_melanogaster|3349        GCCTCG---------------------GCGGGCACATCGATCTCCTCGCCGCCATCGGGC
Drosophila_simulans|4567            GCCTCG---------------------GCGGGCACATCGATCTCCTCGCCGCCATCGGGC
Drosophila_sechellia|11762          GCCTCG---------------------GCGGGCACATCGATCTCCTCGCCGCCATCGGGC
                                                                                                

Ixodes_scapularis|17839             CAAGACCCCCAGAAGACCTCC---------------------------------------
Caenorhabditis_elegans|1417         GAA---------------------------------------------------------
Danio_rerio|3280                    ATCAGAGAG---------------------------------------------------
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        TGTACC------------------------------------------------------
Tarsius_syrichta|14472              GCA---------------------------------------------------------
Erinaceus_europaeus|8777            GCA---------------------------------------------------------
Gorilla_gorilla|31558               GCA---------------------------------------------------------
Gallus_gallus|22550                 GCA---------------------------------------------------------
Fugu_rubripes|7786                  GCC---------------------------------------------------------
Rhesus_macaque|32038                GCA---------------------------------------------------------
Otolemur_garnettii|13561            GCA---------------------------------------------------------
Felis_catus|42581                   ------------------------------------------------------------
Microcebus_murinus|2006             ------------------------------------------------------------
Macropus_eugenii|9432               GCA---------------------------------------------------------
Tupaia_belangeri|2263               GCA---------------------------------------------------------
Canis_familiaris|21922              GCA---------------------------------------------------------
Monodelphis_domestica|13648         GCA---------------------------------------------------------
Gasterosteus_aculeatus|19757        GCC---------------------------------------------------------
Callithrix_jacchus|44206            GCA---------------------------------------------------------
Ornithorhynchus_anatinus|25838      GCA---------------------------------------------------------
Danio_rerio|26298                   GCC---------------------------------------------------------
Anolis_carolinensis|1277            GCA---------------------------------------------------------
Sorex_araneus|14424                 GCA---------------------------------------------------------
Pteropus_vampyrus|9384              ------------------------------------------------------------
Taeniopygia_guttata|18817           GCA---------------------------------------------------------
Pongo_abelii|22055                  GCA---------------------------------------------------------
Ochotona_princeps|513               ------------------------------------------------------------
Dipodomys_ordii|15885               ------------------------------------------------------------
Procavia_capensis|12972             GCA---------------------------------------------------------
Equus_caballus|14099                GCA---------------------------------------------------------
Dasypus_novemcinctus|4895           GCA---------------------------------------------------------
Bos_taurus|12652                    GCA---------------------------------------------------------
Sus_scrofa|7945                     GCA---------------------------------------------------------
Oryctolagus_cuniculus|2869          GCA---------------------------------------------------------
Choloepus_hoffmanni|12539           GCA---------------------------------------------------------
Cavia_porcellus|12331               GCA---------------------------------------------------------
Echinops_telfairi|13551             GCA---------------------------------------------------------
Loxodonta_africana|24792            GCA---------------------------------------------------------
Mus_musculus|11820                  GCA---------------------------------------------------------
Pan_troglodytes|29600               GCA---------------------------------------------------------
Rattus_norvegicus|17976             GCA---------------------------------------------------------
Spermophilus_tridecemlineatus|13317 GCA---------------------------------------------------------
Tursiops_truncatus|5249             GCA---------------------------------------------------------
Ornithorhynchus_anatinus|28681      ACG---------------------------------------------------------
Macropus_eugenii|7357               ACG---------------------------------------------------------
Xenopus_tropicalis|705              ACG---------------------------------------------------------
Oryzias_latipes|15600               ------------------------------------------------------------
Felis_catus|40996                   ACG---------------------------------------------------------
Callithrix_jacchus|46809            ACCGGCTTCTCCCGGCCTCTAGCGGGGAAATTATTCGACGGAGGACCGAGTGTGCCCTTT
Microcebus_murinus|9605             ACG---------------------------------------------------------
Danio_rerio|29046                   ACG---------------------------------------------------------
Oryzias_latipes|18527               ACG---------------------------------------------------------
Gasterosteus_aculeatus|2399         ACG---------------------------------------------------------
Tetraodon_nigroviridis|13830        ACG---------------------------------------------------------
Fugu_rubripes|30053                 ACG---------------------------------------------------------
Tetraodon_nigroviridis|4572         ACG---------------------------------------------------------
Fugu_rubripes|1098                  ACG---------------------------------------------------------
Gasterosteus_aculeatus|22884        ACCCATTTTAGCTCACCGTCTTGCGCA---------------------------------
Danio_rerio|20797                   ACG---------------------------------------------------------
Otolemur_garnettii|1567             GCA---------------------------------------------------------
Monodelphis_domestica|57            ACG---------------------------------------------------------
Echinops_telfairi|972               ACG---------------------------------------------------------
Gorilla_gorilla|16948               ACG---------------------------------------------------------
Cavia_porcellus|24856               CGT---------------------------------------------------------
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------------------------------------
Otolemur_garnettii|2070             ------------------------------------------------------------
Ochotona_princeps|15487             ACG---------------------------------------------------------
Mus_musculus|44064                  ACG---------------------------------------------------------
Rattus_norvegicus|33962             ACG---------------------------------------------------------
Procavia_capensis|16748             ACG---------------------------------------------------------
Oryctolagus_cuniculus|21892         ACG---------------------------------------------------------
Equus_caballus|1290                 ACG---------------------------------------------------------
Homo_sapiens|29496                  ACG---------------------------------------------------------
Pongo_abelii|9734                   ACG---------------------------------------------------------
Pan_troglodytes|13247               ACG---------------------------------------------------------
Rhesus_macaque|34621                ACG---------------------------------------------------------
Bos_taurus|13136                    ACG---------------------------------------------------------
Spermophilus_tridecemlineatus|5969  ------------------------------------------------------------
Dasypus_novemcinctus|10026          ------------------------------------------------------------
Choloepus_hoffmanni|1405            ACG---------------------------------------------------------
Tursiops_truncatus|10256            ACG---------------------------------------------------------
Nematostella_vectensis|12483        ------------------------------------------------------------
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 ------------------------------------------------------------
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              AGTGATGATGATCACGACGGTTCGAGTCCT------------------------------
Nasonia_vitripennis|9293            AGCGATAGCGACTCGCTCCACCACGACACCGGCAGCCCA---------------------
Apis_mellifera|33486                AGTGACAGTGACTCTCTTCATCATGATACAGGAAGTCCA---------------------
Linepithema_humile|6941             AGTGACAGTGACTCGTTTCACCACGACACGGGAAGTCCA---------------------
Pogonomyrmex_barbatus|2677          AGTGACAGTGATTCGTTTCATCACGATACGGGAAGTCCA---------------------
Culex_quinquefasciatus|15641        AGCATGCAGGGCAGCCCG------------------------------------------
Bombyx_mori|3274                    ------------------------------------------------------------
Drosophila_persimilis|16405         ACGTCGGCGGCCACTGGCGGCGTCGGCGGCGTCGGCGTCGGCATCGGTGGCGGTGGCAGT
Drosophila_yakuba|7048              GTCGGAGCTGGGGGTGGCGGTGCCGTGGGCGGTGGTTCAGGTGTCCTGGGCTTGGGCGTG
Drosophila_melanogaster|3349        GTCGGAGCAGGGGGTGGCGGTGCCGTGGGCGGTGGTTCAGGTGTCCTGGGCTTGGGCGTG
Drosophila_simulans|4567            GTCGGAGCAGGGGGTGGCGGTGCCGTGGGCGGTGGTTCAGGTGTCCTGGGCTTGGGCGTG
Drosophila_sechellia|11762          GTCGGAGCAGGGGGTGGCAGTGCCGTGGGCGGTGGTTCAGGTGTCCTGGGCTTGGGCGTG
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         ------------------------------------------------------------
Danio_rerio|3280                    ------------------------------------------------------------
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        ------------------------------------------------------------
Tarsius_syrichta|14472              ------------------------------------------------------------
Erinaceus_europaeus|8777            ------------------------------------------------------------
Gorilla_gorilla|31558               ------------------------------------------------------------
Gallus_gallus|22550                 ------------------------------------------------------------
Fugu_rubripes|7786                  ------------------------------------------------------------
Rhesus_macaque|32038                ------------------------------------------------------------
Otolemur_garnettii|13561            ------------------------------------------------------------
Felis_catus|42581                   ------------------------------------------------------------
Microcebus_murinus|2006             ------------------------------------------------------------
Macropus_eugenii|9432               ------------------------------------------------------------
Tupaia_belangeri|2263               ------------------------------------------------------------
Canis_familiaris|21922              ------------------------------------------------------------
Monodelphis_domestica|13648         ------------------------------------------------------------
Gasterosteus_aculeatus|19757        ------------------------------------------------------------
Callithrix_jacchus|44206            ------------------------------------------------------------
Ornithorhynchus_anatinus|25838      ------------------------------------------------------------
Danio_rerio|26298                   ------------------------------------------------------------
Anolis_carolinensis|1277            ------------------------------------------------------------
Sorex_araneus|14424                 ------------------------------------------------------------
Pteropus_vampyrus|9384              ------------------------------------------------------------
Taeniopygia_guttata|18817           ------------------------------------------------------------
Pongo_abelii|22055                  ------------------------------------------------------------
Ochotona_princeps|513               ------------------------------------------------------------
Dipodomys_ordii|15885               ------------------------------------------------------------
Procavia_capensis|12972             ------------------------------------------------------------
Equus_caballus|14099                ------------------------------------------------------------
Dasypus_novemcinctus|4895           ------------------------------------------------------------
Bos_taurus|12652                    ------------------------------------------------------------
Sus_scrofa|7945                     ------------------------------------------------------------
Oryctolagus_cuniculus|2869          ------------------------------------------------------------
Choloepus_hoffmanni|12539           ------------------------------------------------------------
Cavia_porcellus|12331               ------------------------------------------------------------
Echinops_telfairi|13551             ------------------------------------------------------------
Loxodonta_africana|24792            ------------------------------------------------------------
Mus_musculus|11820                  ------------------------------------------------------------
Pan_troglodytes|29600               ------------------------------------------------------------
Rattus_norvegicus|17976             ------------------------------------------------------------
Spermophilus_tridecemlineatus|13317 ------------------------------------------------------------
Tursiops_truncatus|5249             ------------------------------------------------------------
Ornithorhynchus_anatinus|28681      ------------------------------------------------------------
Macropus_eugenii|7357               ------------------------------------------------------------
Xenopus_tropicalis|705              ------------------------------------------------------------
Oryzias_latipes|15600               ------------------------------------------------------------
Felis_catus|40996                   ------------------------------------------------------------
Callithrix_jacchus|46809            CCCGGAAGGCAGGGGACGCCCCTTCCACATTACCCCGGGGGGCACCTGAGCATTATCTGC
Microcebus_murinus|9605             ------------------------------------------------------------
Danio_rerio|29046                   ------------------------------------------------------------
Oryzias_latipes|18527               ------------------------------------------------------------
Gasterosteus_aculeatus|2399         ------------------------------------------------------------
Tetraodon_nigroviridis|13830        ------------------------------------------------------------
Fugu_rubripes|30053                 ------------------------------------------------------------
Tetraodon_nigroviridis|4572         ------------------------------------------------------------
Fugu_rubripes|1098                  ------------------------------------------------------------
Gasterosteus_aculeatus|22884        ------------------------------------------------------------
Danio_rerio|20797                   ------------------------------------------------------------
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            ------------------------------------------------------------
Echinops_telfairi|972               ------------------------------------------------------------
Gorilla_gorilla|16948               ------------------------------------------------------------
Cavia_porcellus|24856               ------------------------------------------------------------
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------------------------------------
Otolemur_garnettii|2070             ------------------------------------------------------------
Ochotona_princeps|15487             ------------------------------------------------------------
Mus_musculus|44064                  ------------------------------------------------------------
Rattus_norvegicus|33962             ------------------------------------------------------------
Procavia_capensis|16748             ------------------------------------------------------------
Oryctolagus_cuniculus|21892         ------------------------------------------------------------
Equus_caballus|1290                 ------------------------------------------------------------
Homo_sapiens|29496                  ------------------------------------------------------------
Pongo_abelii|9734                   ------------------------------------------------------------
Pan_troglodytes|13247               ------------------------------------------------------------
Rhesus_macaque|34621                ------------------------------------------------------------
Bos_taurus|13136                    ------------------------------------------------------------
Spermophilus_tridecemlineatus|5969  ------------------------------------------------------------
Dasypus_novemcinctus|10026          ------------------------------------------------------------
Choloepus_hoffmanni|1405            ------------------------------------------------------------
Tursiops_truncatus|10256            ------------------------------------------------------------
Nematostella_vectensis|12483        ------------------------------------------------------------
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 ------------------------------------------------------------
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              ------------------------------------------------------------
Nasonia_vitripennis|9293            ------------------------------------------------------------
Apis_mellifera|33486                ------------------------------------------------------------
Linepithema_humile|6941             ------------------------------------------------------------
Pogonomyrmex_barbatus|2677          ------------------------------------------------------------
Culex_quinquefasciatus|15641        ------------------------------------------------------------
Bombyx_mori|3274                    ------------------------------------------------------------
Drosophila_persimilis|16405         GGAGTTGTGGGTGTTGTTGGCGTAGGAGTCGGCATGGGCGTGGGCATGGGCATGGGCATG
Drosophila_yakuba|7048              GGCGTGGGCGTAGGCGTGGTGGCCAATCAGTCGGCCACCGAGCAGCTCATGCAAATGCTC
Drosophila_melanogaster|3349        GTGGCCAATCAGTCGGCCACCGAGCAGCTCATGCAAATGCTCCAGAAGGTAACGGGCTCG
Drosophila_simulans|4567            GTGGCCAATCAGTCGGCCACCGAGCAGCTCATGCAAATGCTCCAGAAGGTAACGGGCTCG
Drosophila_sechellia|11762          GTGGCCAATCAGTCGGCCACCGAGCAGCTCATGCAAATGCTCCAGAAGGTAACGGGCTCG
                                                                                                

Ixodes_scapularis|17839             ------------------------------------------------------------
Caenorhabditis_elegans|1417         ------------------------------------------------------------
Danio_rerio|3280                    ------------------------------------------------------------
Xenopus_tropicalis|17501            ------------------------------------------------------------
Branchiostoma_floridae|41009        ------------------------------------------------------------
Tarsius_syrichta|14472              ------------------------------------------------------------
Erinaceus_europaeus|8777            ------------------------------------------------------------
Gorilla_gorilla|31558               ------------------------------------------------------------
Gallus_gallus|22550                 ------------------------------------------------------------
Fugu_rubripes|7786                  ------------------------------------------------------------
Rhesus_macaque|32038                ------------------------------------------------------------
Otolemur_garnettii|13561            ------------------------------------------------------------
Felis_catus|42581                   ------------------------------------------------------------
Microcebus_murinus|2006             ------------------------------------------------------------
Macropus_eugenii|9432               ------------------------------------------------------------
Tupaia_belangeri|2263               ------------------------------------------------------------
Canis_familiaris|21922              ------------------------------------------------------------
Monodelphis_domestica|13648         ------------------------------------------------------------
Gasterosteus_aculeatus|19757        ------------------------------------------------------------
Callithrix_jacchus|44206            ------------------------------------------------------------
Ornithorhynchus_anatinus|25838      ------------------------------------------------------------
Danio_rerio|26298                   ------------------------------------------------------------
Anolis_carolinensis|1277            ------------------------------------------------------------
Sorex_araneus|14424                 ------------------------------------------------------------
Pteropus_vampyrus|9384              ------------------------------------------------------------
Taeniopygia_guttata|18817           ------------------------------------------------------------
Pongo_abelii|22055                  ------------------------------------------------------------
Ochotona_princeps|513               ------------------------------------------------------------
Dipodomys_ordii|15885               ------------------------------------------------------------
Procavia_capensis|12972             ------------------------------------------------------------
Equus_caballus|14099                ------------------------------------------------------------
Dasypus_novemcinctus|4895           ------------------------------------------------------------
Bos_taurus|12652                    ------------------------------------------------------------
Sus_scrofa|7945                     ------------------------------------------------------------
Oryctolagus_cuniculus|2869          ------------------------------------------------------------
Choloepus_hoffmanni|12539           ------------------------------------------------------------
Cavia_porcellus|12331               ------------------------------------------------------------
Echinops_telfairi|13551             ------------------------------------------------------------
Loxodonta_africana|24792            ------------------------------------------------------------
Mus_musculus|11820                  ------------------------------------------------------------
Pan_troglodytes|29600               ------------------------------------------------------------
Rattus_norvegicus|17976             ------------------------------------------------------------
Spermophilus_tridecemlineatus|13317 ------------------------------------------------------------
Tursiops_truncatus|5249             ------------------------------------------------------------
Ornithorhynchus_anatinus|28681      ------------------------------------------------------------
Macropus_eugenii|7357               ------------------------------------------------------------
Xenopus_tropicalis|705              ------------------------------------------------------------
Oryzias_latipes|15600               ------------------------------------------------------------
Felis_catus|40996                   ------------------------------------------------------------
Callithrix_jacchus|46809            GTTTGG------------------------------------------------------
Microcebus_murinus|9605             ------------------------------------------------------------
Danio_rerio|29046                   ------------------------------------------------------------
Oryzias_latipes|18527               ------------------------------------------------------------
Gasterosteus_aculeatus|2399         ------------------------------------------------------------
Tetraodon_nigroviridis|13830        ------------------------------------------------------------
Fugu_rubripes|30053                 ------------------------------------------------------------
Tetraodon_nigroviridis|4572         ------------------------------------------------------------
Fugu_rubripes|1098                  ------------------------------------------------------------
Gasterosteus_aculeatus|22884        ------------------------------------------------------------
Danio_rerio|20797                   ------------------------------------------------------------
Otolemur_garnettii|1567             ------------------------------------------------------------
Monodelphis_domestica|57            ------------------------------------------------------------
Echinops_telfairi|972               ------------------------------------------------------------
Gorilla_gorilla|16948               ------------------------------------------------------------
Cavia_porcellus|24856               ------------------------------------------------------------
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------------------------------------
Otolemur_garnettii|2070             ------------------------------------------------------------
Ochotona_princeps|15487             ------------------------------------------------------------
Mus_musculus|44064                  ------------------------------------------------------------
Rattus_norvegicus|33962             ------------------------------------------------------------
Procavia_capensis|16748             ------------------------------------------------------------
Oryctolagus_cuniculus|21892         ------------------------------------------------------------
Equus_caballus|1290                 ------------------------------------------------------------
Homo_sapiens|29496                  ------------------------------------------------------------
Pongo_abelii|9734                   ------------------------------------------------------------
Pan_troglodytes|13247               ------------------------------------------------------------
Rhesus_macaque|34621                ------------------------------------------------------------
Bos_taurus|13136                    ------------------------------------------------------------
Spermophilus_tridecemlineatus|5969  ------------------------------------------------------------
Dasypus_novemcinctus|10026          ------------------------------------------------------------
Choloepus_hoffmanni|1405            ------------------------------------------------------------
Tursiops_truncatus|10256            ------------------------------------------------------------
Nematostella_vectensis|12483        ------------------------------------------------------------
Pogonomyrmex_barbatus|2673          ------------------------------------------------------------
Daphnia_pulex|19417                 ------------------------------------------------------------
Ixodes_scapularis|17836             ------------------------------------------------------------
Pediculus_humanus|2973              ------------------------------------------------------------
Nasonia_vitripennis|9293            ------------------------------------------------------------
Apis_mellifera|33486                ------------------------------------------------------------
Linepithema_humile|6941             ------------------------------------------------------------
Pogonomyrmex_barbatus|2677          ------------------------------------------------------------
Culex_quinquefasciatus|15641        ------------------------------------------------------------
Bombyx_mori|3274                    ------------------------------------------------------------
Drosophila_persimilis|16405         GGCATGGGCGGGGTCGGTGTTGGTGGTGCCGCCAATCAGTCGGCCACCGAGCAGCTTATG
Drosophila_yakuba|7048              CAGAAGGTAACAGGCTCGGCTTCCCCCGCCTCACATGCGGTTCTC---------------
Drosophila_melanogaster|3349        GCTTCCCCGGCCTCACATGCGGTTCTC---------------------------------
Drosophila_simulans|4567            GCTTCCCCGGCCTCACATGCGGTTCTC---------------------------------
Drosophila_sechellia|11762          GCTTCCCCGGCCTCACATGCGGTTCTC---------------------------------
                                                                                                

Ixodes_scapularis|17839             ---------------------------------------------------------TGA
Caenorhabditis_elegans|1417         ---------------------------------------------------------TAG
Danio_rerio|3280                    ---------------------------------------------------------TGA
Xenopus_tropicalis|17501            ---------------------------------------------------------TAG
Branchiostoma_floridae|41009        ---------------------------------------------------------TAA
Tarsius_syrichta|14472              ---------------------------------------------------------TGA
Erinaceus_europaeus|8777            ---------------------------------------------------------TGA
Gorilla_gorilla|31558               ---------------------------------------------------------TGA
Gallus_gallus|22550                 ---------------------------------------------------------TGA
Fugu_rubripes|7786                  ---------------------------------------------------------TGA
Rhesus_macaque|32038                ---------------------------------------------------------TGA
Otolemur_garnettii|13561            ---------------------------------------------------------TGA
Felis_catus|42581                   ------------------------------------------------------------
Microcebus_murinus|2006             ------------------------------------------------------------
Macropus_eugenii|9432               ---------------------------------------------------------TGA
Tupaia_belangeri|2263               ---------------------------------------------------------TGA
Canis_familiaris|21922              ---------------------------------------------------------TGA
Monodelphis_domestica|13648         ---------------------------------------------------------TGA
Gasterosteus_aculeatus|19757        ---------------------------------------------------------TAG
Callithrix_jacchus|44206            ---------------------------------------------------------TGA
Ornithorhynchus_anatinus|25838      ---------------------------------------------------------TGA
Danio_rerio|26298                   ---------------------------------------------------------TAG
Anolis_carolinensis|1277            ---------------------------------------------------------TGA
Sorex_araneus|14424                 ---------------------------------------------------------TGA
Pteropus_vampyrus|9384              ------------------------------------------------------------
Taeniopygia_guttata|18817           ---------------------------------------------------------TGA
Pongo_abelii|22055                  ---------------------------------------------------------TGA
Ochotona_princeps|513               ------------------------------------------------------------
Dipodomys_ordii|15885               ---------------------------------------------------------TGA
Procavia_capensis|12972             ---------------------------------------------------------TGA
Equus_caballus|14099                ---------------------------------------------------------TGA
Dasypus_novemcinctus|4895           ---------------------------------------------------------TGA
Bos_taurus|12652                    ---------------------------------------------------------TGA
Sus_scrofa|7945                     ---------------------------------------------------------TGA
Oryctolagus_cuniculus|2869          ---------------------------------------------------------TGA
Choloepus_hoffmanni|12539           ---------------------------------------------------------TGA
Cavia_porcellus|12331               ---------------------------------------------------------TGA
Echinops_telfairi|13551             ---------------------------------------------------------TGA
Loxodonta_africana|24792            ---------------------------------------------------------TGA
Mus_musculus|11820                  ---------------------------------------------------------TGA
Pan_troglodytes|29600               ---------------------------------------------------------TGA
Rattus_norvegicus|17976             ---------------------------------------------------------TGA
Spermophilus_tridecemlineatus|13317 ---------------------------------------------------------TGA
Tursiops_truncatus|5249             ---------------------------------------------------------TGA
Ornithorhynchus_anatinus|28681      ---------------------------------------------------------TGA
Macropus_eugenii|7357               ---------------------------------------------------------TGA
Xenopus_tropicalis|705              ---------------------------------------------------------TGA
Oryzias_latipes|15600               ------------------------------------------------------------
Felis_catus|40996                   ---------------------------------------------------------TGA
Callithrix_jacchus|46809            ------------------------------------------------------------
Microcebus_murinus|9605             ---------------------------------------------------------TGA
Danio_rerio|29046                   ---------------------------------------------------------TGA
Oryzias_latipes|18527               ---------------------------------------------------------TGA
Gasterosteus_aculeatus|2399         ---------------------------------------------------------TGA
Tetraodon_nigroviridis|13830        ---------------------------------------------------------TGA
Fugu_rubripes|30053                 ---------------------------------------------------------TGA
Tetraodon_nigroviridis|4572         ---------------------------------------------------------TGA
Fugu_rubripes|1098                  ---------------------------------------------------------TGA
Gasterosteus_aculeatus|22884        ------------------------------------------------------------
Danio_rerio|20797                   ---------------------------------------------------------TGA
Otolemur_garnettii|1567             ---------------------------------------------------------TGA
Monodelphis_domestica|57            ---------------------------------------------------------TGA
Echinops_telfairi|972               ---------------------------------------------------------TGA
Gorilla_gorilla|16948               ---------------------------------------------------------TGA
Cavia_porcellus|24856               ------------------------------------------------------------
Pteropus_vampyrus|10382             ------------------------------------------------------------
Tupaia_belangeri|12837              ------------------------------------------------------------
Otolemur_garnettii|2070             ------------------------------------------------------------
Ochotona_princeps|15487             ---------------------------------------------------------TGA
Mus_musculus|44064                  ---------------------------------------------------------TGA
Rattus_norvegicus|33962             ---------------------------------------------------------TGA
Procavia_capensis|16748             ---------------------------------------------------------TGA
Oryctolagus_cuniculus|21892         ------------------------------------------------------------
Equus_caballus|1290                 ---------------------------------------------------------TGA
Homo_sapiens|29496                  ---------------------------------------------------------TGA
Pongo_abelii|9734                   ---------------------------------------------------------TGA
Pan_troglodytes|13247               ---------------------------------------------------------TGA
Rhesus_macaque|34621                ---------------------------------------------------------TGA
Bos_taurus|13136                    ---------------------------------------------------------TGA
Spermophilus_tridecemlineatus|5969  ------------------------------------------------------------
Dasypus_novemcinctus|10026          ------------------------------------------------------------
Choloepus_hoffmanni|1405            ---------------------------------------------------------TGA
Tursiops_truncatus|10256            ---------------------------------------------------------TGA
Nematostella_vectensis|12483        ---------------------------------------------------------TAA
Pogonomyrmex_barbatus|2673          ---------------------------------------------------------TAA
Daphnia_pulex|19417                 ---------------------------------------------------------TGA
Ixodes_scapularis|17836             ---------------------------------------------------------TGA
Pediculus_humanus|2973              ---------------------------------------------------------TAA
Nasonia_vitripennis|9293            ------------------------------------------------------------
Apis_mellifera|33486                ---------------------------------------------------------TAG
Linepithema_humile|6941             ---------------------------------------------------------TAG
Pogonomyrmex_barbatus|2677          ---------------------------------------------------------TAG
Culex_quinquefasciatus|15641        ---------------------------------------------------------TGA
Bombyx_mori|3274                    ---------------------------------------------------------TAG
Drosophila_persimilis|16405         CAAATGCTCCAAAAAGTGACTGGCTCCGGCGGTGCCCCGGCATCCCATGCGGTGCTTTGA
Drosophila_yakuba|7048              ---------------------------------------------------------TAA
Drosophila_melanogaster|3349        ---------------------------------------------------------TAA
Drosophila_simulans|4567            ---------------------------------------------------------TAA
Drosophila_sechellia|11762          ---------------------------------------------------------TAA
                                                                                                

multiple sequence alignment in CLUSTALW format


Ixodes_scapularis|17837             ------------------------------------------------------------
Caenorhabditis_elegans|84           --------------------------------MNICMRNGYEQFSLTSPGTSDLEIGGSF
Danio_rerio|2328                    --------------------------------------------------MLLSDMG---
Xenopus_tropicalis|22256            ----------------------------------------------------MGDMG---
Branchiostoma_floridae|19376        -------------------------------------------MNHSPPIESAAMPG---
Tarsius_syrichta|13267              ----------------------------------------------------MGDMG---
Erinaceus_europaeus|7209            ----------------------------------------------------MGDMG---
Gorilla_gorilla|24369               ----------------------------------------------------MGDMG---
Gallus_gallus|9266                  ----------------------------------------------------MGDMG---
Fugu_rubripes|35307                 ---------------------------------------AVTVDLTSPYCEDMGDMG---
Rhesus_macaque|24217                IRKRGARAAPSPPPPQRLRSTNSAGLNWTPRSARALRSRAAALSALATPGATISHLA---
Otolemur_garnettii|11673            ----------------------------------------------------MGDMG---
Felis_catus|8482                    ----------------------------------------------------MGDMG---
Microcebus_murinus|1702             ----------------------------------------------------MGDMG---
Macropus_eugenii|8588               ----------------------------------------------------MGDMG---
Tupaia_belangeri|1972               ------------------------------------------------------------
Canis_familiaris|22072              IRKRGARAAPSPPPPQRVCSASSAGLSWTPRPARARRSRAAAPRALAAPRATVSHLA---
Monodelphis_domestica|441           --------------------------------SARAPHSPAAFLTLATPVTNISHLA---
Gasterosteus_aculeatus|4909         ----------------------------------------------------MGDMG---
Callithrix_jacchus|35497            ----------------------------------------------------MGDMG---
Ornithorhynchus_anatinus|17528      ----------------------------------------------------AGTLQ---
Danio_rerio|19468                   ----------------------------------------------------MGDMG---
Anolis_carolinensis|4238            ----------------------------------------------------MGDMG---
Sorex_araneus|12834                 ----------------------------------------------------MGDMG---
Pteropus_vampyrus|8843              ----------------------------------------------------MGDMG---
Taeniopygia_guttata|4223            ----------------------------------------------------MGDMG---
Pongo_abelii|15144                  ----------------------------------------------------MGDMG---
Ochotona_princeps|436               ----------------------------------------------------MGDMG---
Dipodomys_ordii|14931               ----------------------------------------------------MGDMG---
Procavia_capensis|12134             ----------------------------------------------------MGDMG---
Equus_caballus|1718                 ----------------------------------------------------MGDMG---
Dasypus_novemcinctus|4325           ----------------------------------------------------MGDMG---
Bos_taurus|4813                     ------------------------------------------SLWTLLPVTDMGDMG---
Sus_scrofa|17831                    ------------------------------------------SLWTLLPVTDMGDMG---
Oryctolagus_cuniculus|10385         ------------------------------------------SLWTLLPLTDMGDMG---
Choloepus_hoffmanni|11074           ----------------------------------------------------MGDMG---
Cavia_porcellus|9667                ----------------------------------------------------MGDMG---
Echinops_telfairi|10689             ----------------------------------------------------MGDMG---
Loxodonta_africana|9521             ----------------------------------------------------MGDMG---
Mus_musculus|52277                  ----------------------------------------------------MGDMG---
Pan_troglodytes|12240               ----------------------------------------------------MGDMG---
Rattus_norvegicus|24527             ----------------------------------------------------MGDMG---
Spermophilus_tridecemlineatus|11941 ----------------------------------------------------MGDMG---
Tursiops_truncatus|4947             ----------------------------------------------------MGDMG---
Ornithorhynchus_anatinus|2623       -----------------------------------------------CSFPLVEKPG---
Macropus_eugenii|6705               -------------------------------------------VDIIFNYPFLGAMG---
Xenopus_tropicalis|24488            ------------------------------------------MVDPILPCPLSAAMG---
Oryzias_latipes|14606               ------------------------------------------MVDIIFSSSFLDDMG---
Felis_catus|6793                    ------------------------------------------MVDIIFHYPFLGAMG---
Callithrix_jacchus|37997            -------------------------------------------------------MG---
Microcebus_murinus|8143             ------------------------------------------MVDIIFHCPFLGAMG---
Danio_rerio|11764                   ------------------------------------------MVDIIFSSSFLDDMG---
Oryzias_latipes|9233                ------------------------------------------MVDILLNTSFLDDMG---
Gasterosteus_aculeatus|21208        ------------------------------------------MVDIIFSSSFLGDMG---
Tetraodon_nigroviridis|3623         ------------------------------------------MVDIIFSSSFLGDMG---
Fugu_rubripes|13758                 ------------------------------------------MVDIIFSSSFLGDMG---
Tetraodon_nigroviridis|8806         ------------------------------------------MLDILLNTSFLDDMG---
Fugu_rubripes|21838                 ------------------------------------------MLDILLNTSFLDDMG---
Gasterosteus_aculeatus|13403        ------------------------------------------------------------
Danio_rerio|21693                   ------------------------------------------MVDILPHPSFLGDMG---
Otolemur_garnettii|1341             ------------------------------------------------------------
Monodelphis_domestica|591           ------------------------------------------MVDIIFNYPFLGAMG---
Echinops_telfairi|766               ------------------------------------------MVDIIFSYPFLGAMG---
Gorilla_gorilla|13585               ------------------------------------------MVDIIFHYPFLGAMG---
Cavia_porcellus|19710               ------------------------------------------MVDLLLQCPFPGAMG---
Pteropus_vampyrus|9781              ------------------------------------------MVDVIFHYPFLGAMG---
Tupaia_belangeri|11132              ------------------------------------------MVDIIFHYPFLGAMG---
Otolemur_garnettii|1777             ------------------------------------------MVDIIFHYPFLGAMG---
Ochotona_princeps|13499             ------------------------------------------MVDILFHYPFLGAMG---
Mus_musculus|12459                  ------------------------------------------MVDIIFHYPFLGAMG---
Rattus_norvegicus|21885             ------------------------------------------MVDIIFHYPFLGAMG---
Procavia_capensis|15670             ------------------------------------------MVDIIFHYPFLGAMG---
Oryctolagus_cuniculus|10154         ------------------------------------------MVDIIFPYPFLGAMG---
Equus_caballus|7556                 ------------------------------------------MVDIIFHYPFLGAMG---
Homo_sapiens|23012                  ------------------------------------------MVDIIFHYPFLGAMG---
Pongo_abelii|7917                   ------------------------------------------MVDIIFHYPFLGAMG---
Pan_troglodytes|17006               ------------------------------------------MVDIIFHYPFLGAMG---
Rhesus_macaque|29107                ------------------------------------------MVDIIFHYPFLGAMG---
Bos_taurus|9391                     ------------------------------------------MVDIIFHYPFLGTMG---
Spermophilus_tridecemlineatus|5344  ------------------------------------------------------------
Dasypus_novemcinctus|8862           ------------------------------------------------------------
Choloepus_hoffmanni|1246            ------------------------------------------------------------
Tursiops_truncatus|9697             ------------------------------------------MVDIIFHYPFLGTMG---
Nematostella_vectensis|14408        -------------------------------------------------MPICCSFS---
Pogonomyrmex_barbatus|5516          ------------------------------------MKVLYYEYTNCEANLFSNFDK---
Daphnia_pulex|16039                 ------------------------------------------------------------
Ixodes_scapularis|17834             --------------------------------------------MLVCGSASSDKHG---
Pediculus_humanus|2908              ------------------------------------------------------------
Nasonia_vitripennis|7892            ----------------------MQRPAAAGGGPGPIGLQGPPRSIKISPVKIQDEPG---
Apis_mellifera|2463                 ----------------------------------------------------MDGSS---
Linepithema_humile|6918             --------------------------------------------------MTNGQCC---
Pogonomyrmex_barbatus|5514          ---------------------------------------------------MLADSG---
Culex_quinquefasciatus|10734        --------------------------------------------MAVLQSHKLGEHN---
Bombyx_mori|13872                   ------------------------------------------------------------
Drosophila_persimilis|8604          --------------------------------MVMAEIGGHLAHQLPLHNHNHNQTGLQP
Drosophila_yakuba|3316              --------------------------------MVMAEIGGHLAHQLPLHNHNHNQTGLQP
Drosophila_melanogaster|3130        --------------------------------MVMAEIGGHLAHQLPLHNHNHNQTGLQP
Drosophila_simulans|11447           --------------------------------MVMAEIGGHLAHQLPLHNHNHNQTGLQP
Drosophila_sechellia|6924           --------------------------------MVMAEIGGHLAHQLPLHNHNHNQTGLQP
                                                                                                

Ixodes_scapularis|17837             ------------------------------------------------------------
Caenorhabditis_elegans|84           WKDEPDTKYLCLDSP--------------------------------VEQRQHQPPMAVC
Danio_rerio|2328                    ------------EQQ--------------------------------N--RTKL--SSFC
Xenopus_tropicalis|22256            ------------DPP--------------------------------K--KKRL--ISLC
Branchiostoma_floridae|19376        ------------DPP--------------------------------K--KNRR--NAMC
Tarsius_syrichta|13267              ------------DPP--------------------------------K--KKRL--ISLC
Erinaceus_europaeus|7209            ------------DPP--------------------------------K--KKRL--ISLC
Gorilla_gorilla|24369               ------------DPP--------------------------------K--KKRL--ISLC
Gallus_gallus|9266                  ------------DPP--------------------------------K--SGGI--PSLC
Fugu_rubripes|35307                 ------------DPP--------------------------------K--KKRL--VSLC
Rhesus_macaque|24217                ------------TAPASSLWAVHQLYNHHFTVDITPSYRYGRHGRSTKNSEKRL--ISLC
Otolemur_garnettii|11673            ------------DPP--------------------------------K--KKRL--ISLC
Felis_catus|8482                    ------------DPP--------------------------------K--KKRL--ISLC
Microcebus_murinus|1702             ------------DPP--------------------------------K--KKRL--ISLC
Macropus_eugenii|8588               ------------DPP--------------------------------K--KKRL--ISLC
Tupaia_belangeri|1972               ---------------------------------------------------KRL--ISLC
Canis_familiaris|22072              ------------TAPASSLWAGHQLYNHHFTVDITPSYRYGRHGRSTKNSEKRL--ISLC
Monodelphis_domestica|441           ------------TAPTSLWSFSQLYNHHFTVDITPSYRYGRHGRSTKN--EKRL--ISLC
Gasterosteus_aculeatus|4909         ------------DPP--------------------------------K--KKRL--ISLC
Callithrix_jacchus|35497            ------------DPP--------------------------------K--KKRL--ISLC
Ornithorhynchus_anatinus|17528      ------------LPP--------------------------------K--KKRL--ISLC
Danio_rerio|19468                   ------------DPP--------------------------------K--KKRL--ISLC
Anolis_carolinensis|4238            ------------DPP--------------------------------K--KKRL--ISLC
Sorex_araneus|12834                 ------------DPP--------------------------------K--KKRL--ISLC
Pteropus_vampyrus|8843              ------------DPP--------------------------------K--KKRL--ISLC
Taeniopygia_guttata|4223            ------------DPP--------------------------------K--KKRL--ISLC
Pongo_abelii|15144                  ------------DPP--------------------------------K--KKRL--ISLC
Ochotona_princeps|436               ------------DPP--------------------------------K--KKRL--ISLC
Dipodomys_ordii|14931               ------------DPP--------------------------------K--KKRL--ISLC
Procavia_capensis|12134             ------------DPP--------------------------------K--KKRL--ISLC
Equus_caballus|1718                 ------------DPP--------------------------------K--KKRL--ISLC
Dasypus_novemcinctus|4325           ------------DPP--------------------------------K--KKRL--ISLC
Bos_taurus|4813                     ------------DPP--------------------------------K--KKRL--ISLC
Sus_scrofa|17831                    ------------DPP--------------------------------K--KKRL--ISLC
Oryctolagus_cuniculus|10385         ------------DPP--------------------------------K--KKRL--ISLC
Choloepus_hoffmanni|11074           ------------DPP--------------------------------K--KKRL--ISLC
Cavia_porcellus|9667                ------------DPP--------------------------------K--KKRL--ISLC
Echinops_telfairi|10689             ------------DPP--------------------------------K--KKRL--ISLC
Loxodonta_africana|9521             ------------DPP--------------------------------K--KKRL--ISLC
Mus_musculus|52277                  ------------DPP--------------------------------K--KKRL--ISLC
Pan_troglodytes|12240               ------------DPP--------------------------------K--KKRL--ISLC
Rattus_norvegicus|24527             ------------DPP--------------------------------K--KKRL--ISLC
Spermophilus_tridecemlineatus|11941 ------------DPP--------------------------------K--KKRL--ISLC
Tursiops_truncatus|4947             ------------DPP--------------------------------K--KKRL--ISLC
Ornithorhynchus_anatinus|2623       --------------------------------------------------------IAMC
Macropus_eugenii|6705               ------------DHS--------------------------------K--KKPG--IAMC
Xenopus_tropicalis|24488            ------------EHP--------------------------------K--KKAG--LAVC
Oryzias_latipes|14606               ------------DHS-----------------------------------KSKY--AALC
Felis_catus|6793                    ------------DHS--------------------------------K--XXXX--XXXX
Callithrix_jacchus|37997            ------------DHS--------------------------------K--KKPG--TAMC
Microcebus_murinus|8143             ------------DHP--------------------------------K--XXXX--XXXX
Danio_rerio|11764                   ------------DHS--------------------------------K--KKSG--LAMC
Oryzias_latipes|9233                ------------DHS--------------------------------K--KKSG--IAMC
Gasterosteus_aculeatus|21208     &nbs