Orthologs Set ID: EOG4006CP


Orthology Database
OrthoDB4
Gene Symbol(s)
KATNBL1

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Anolis carolinensis 7200 474, 593, 644, 743, 833, 963
Bos taurus 1631
Bos taurus 17954 120
Branchiostoma floridae 3507 114, 167, 288, 474, 593, 644, 743, 869, 963
Callithrix jacchus 29036 120, 164, 474, 593, 644, 743, 833, 963
Callithrix jacchus 54031
Canis familiaris 18013 120, 164, 474, 593, 644, 743, 833, 963
Cavia porcellus 1585 120, 164, 474, 593, 644, 743, 833, 963
Danio rerio 15372 120, 164, 474, 593, 644, 743, 848, 963
Dasypus novemcinctus 9698 120, 164, 474, 593, 644, 743, 833, 963
Dipodomys ordii 11129 164, 474, 593, 644, 743, 833, 963
Echinops telfairi 1678 120, 164, 474, 593, 644, 743, 833, 963, 987
Equus caballus 1807 120, 164, 474, 593, 644, 743, 833, 963
Erinaceus europaeus 16291 16, 26, 39, 45, 77, 120, 164, 474, 593, 644, 743, 833, 963
Felis catus 45365 120, 164, 474, 593, 644, 743, 833
Fugu rubripes 20508 120, 164, 474, 593, 644, 743, 848
Gallus gallus 16983 120, 164, 474, 593, 644, 743, 833, 963
Gasterosteus aculeatus 26685 120, 164, 474, 593, 644, 743, 848, 963
Gorilla gorilla 8946 120, 164, 191, 302, 474, 593, 644, 743, 833, 963
Homo sapiens 28254 120, 164, 474, 593, 644, 743, 833, 963
Loxodonta africana 23740 120, 164, 474, 593, 644, 743, 833, 963
Macropus eugenii 15656 593, 644, 743, 833, 963
Microcebus murinus 4135 120, 164, 198, 474, 593, 644, 743, 833, 963
Monodelphis domestica 1955 120, 164, 474, 593, 644, 743, 833, 963
Mus musculus 23490 120, 164, 474, 593, 644, 743, 833, 963
Myotis lucifugus 1555 120, 164, 474, 593, 644, 743, 833, 963
Nematostella vectensis 25799 213, 287, 360, 412, 558, 593, 644, 743, 963
Ochotona princeps 7101 474, 593, 644, 743, 833, 963
Ornithorhynchus anatinus 3721 120, 164, 568, 593, 644
Oryzias latipes 13051 120, 164, 474
Oryzias latipes 14750 120, 164
Otolemur garnettii 16259 164, 474, 593, 623, 639, 644, 743, 833, 963, 969, 981
Pan troglodytes 12541 120, 164, 474, 593, 644, 743, 833, 963
Pongo abelii 9204 120, 164, 474, 593, 644, 743, 833, 963
Procavia capensis 6460 4, 33, 48, 120, 164, 474, 593, 644, 743, 833, 834
Pteropus vampyrus 3026 120, 164, 474, 593, 644, 743, 833, 963
Rattus norvegicus 22786 120, 164, 474, 593, 644, 743, 833, 963
Rhesus macaque 33786 120, 164, 474, 593, 644, 743, 833, 963
Sorex araneus 8036 30, 120, 164, 474, 593, 644, 743, 833, 963
Spermophilus tridecemlineatus 3816 120, 164, 474, 593, 644, 743, 833
Sus scrofa 18482 120, 164, 474, 593, 644, 743, 833, 963
Taeniopygia guttata 12184 120, 164, 474, 593, 644, 743, 833, 963
Tarsius syrichta 689 120, 164, 321, 354, 367, 462, 474, 593, 644, 743, 833, 963
Tetraodon nigroviridis 5251 120, 164, 474, 593, 644, 743, 848, 963
Tupaia belangeri 1610 474, 593, 644, 743, 833, 963
Tursiops truncatus 7340 120, 164, 474, 528, 593, 644, 743, 833, 963
Vicugna pacos 11325 120, 164, 474, 593, 644, 743, 833, 963
Xenopus tropicalis 11883 120, 164, 474, 593, 644, 743, 833, 963

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 7200 ENSACAT00000015370 100562330 ENSACAG00000015339 katnbl1 anoCar1
Bos taurus 1631 ENSBTAT00000008409 540295 ENSBTAG00000006413 KATNBL1 bosTau4
Bos taurus 17954 ENSBTAT00000053789 ENSBTAG00000040066 Q17QA6_BOVIN bosTau4
Branchiostoma floridae 3507 estExt_fgenesh2_pg.C_1320051 braFlo1
Callithrix jacchus 29036 ENSCJAT00000041511 100405394 ENSCJAG00000021110 KATNBL1 calJac3
Callithrix jacchus 54031 ENSCJAT00000044301 ENSCJAG00000023316 calJac3
Canis familiaris 18013 ENSCAFT00000012735 607369 ENSCAFG00000007971 KATNBL1 canFam2
Cavia porcellus 1585 ENSCPOT00000011257 100729475 ENSCPOG00000011153 KATNBL1 cavPor3
Danio rerio 15372 ENSDART00000062350, NM_001006019 325430 ENSDARG00000042522 katnbl1 danRer6
Dasypus novemcinctus 9698 ENSDNOT00000016278 101436814 ENSDNOG00000016279 KATNBL1 dasNov2
Dipodomys ordii 11129 ENSDORT00000013172 ENSDORG00000013172 Katnbl1 dipOrd1
Echinops telfairi 1678 ENSETET00000001641 ENSETEG00000001640 KATNBL1 TENREC
Equus caballus 1807 ENSECAT00000025209 100057956 ENSECAG00000023450 KATNBL1 equCab2
Erinaceus europaeus 16291 ENSEEUT00000014676 ENSEEUG00000014674 KATNBL1 eriEur1
Felis catus 45365 ENSFCAT00000018433 101097734 ENSFCAG00000018289 KATNBL1 felCat3
Fugu rubripes 20508 ENSTRUT00000046539 101062036 ENSTRUG00000018118 katnbl1 fr2
Gallus gallus 16983 ENSGALT00000015687, NM_001031198 423287 ENSGALG00000009633 KATNBL1 galGal3
Gasterosteus aculeatus 26685 ENSGACT00000010497 ENSGACG00000007898 katnbl1 gasAcu1
Gorilla gorilla 8946 ENSGGOT00000029942 101142481 ENSGGOG00000014230 KATNBL1 gorGor3
Homo sapiens 28254 ENST00000256544, NM_024713 79768 ENSG00000134152 KATNBL1 hg19,GRCh37
Loxodonta africana 23740 ENSLAFT00000011765 100655676 ENSLAFG00000011765 KATNBL1 loxAfr3
Macropus eugenii 15656 ENSMEUT00000015657 ENSMEUG00000015610 KATNBL1 Meug_1.0
Microcebus murinus 4135 ENSMICT00000003856 ENSMICG00000003855 KATNBL1 micMur1
Monodelphis domestica 1955 ENSMODT00000002069 100026680 ENSMODG00000001657 KATNBL1 monDom5
Mus musculus 23490 ENSMUST00000028552 72425 ENSMUSG00000027132 Katnbl1 mm9
Myotis lucifugus 1555 ENSMLUT00000001526 102431872 ENSMLUG00000001532 myoLuc1
Nematostella vectensis 25799 estExt_fgenesh1_pg.C_1060011 Nemve1
Ochotona princeps 7101 ENSOPRT00000010366 ENSOPRG00000010379 KATNBL1 OchPri2.0
Ornithorhynchus anatinus 3721 ENSOANT00000002644 ENSOANG00000001650 KATNBL1 ornAna1
Oryzias latipes 13051 ENSORLT00000021104 ENSORLG00000016868 KATNBL1 (1 of 2) oryLat2
Oryzias latipes 14750 ENSORLT00000022328 ENSORLG00000017841 katnbl1 oryLat2
Otolemur garnettii 16259 ENSOGAT00000015638 100941143 ENSOGAG00000015633 KATNBL1 otoGar1
Pan troglodytes 12541 ENSPTRT00000012690 467645 ENSPTRG00000006877 KATNBL1 panTro2
Pongo abelii 9204 ENSPPYT00000007445 100437216 ENSPPYG00000006309 KATNBL1 ponAbe2
Procavia capensis 6460 ENSPCAT00000011326 ENSPCAG00000011336 KATNBL1 proCap1
Pteropus vampyrus 3026 ENSPVAT00000003823 ENSPVAG00000003822 KATNBL1 pteVam1
Rattus norvegicus 22786 ENSRNOT00000007688 691543 ENSRNOG00000005814 Katnbl1 rn4
Rhesus macaque 33786 ENSMMUT00000000012 695784 ENSMMUG00000000013 KATNBL1 rheMac2
Sorex araneus 8036 ENSSART00000007891 101543386 ENSSARG00000007891 KATNBL1 sorAra1
Spermophilus tridecemlineatus 3816 ENSSTOT00000003816 101974883 ENSSTOG00000003813 Katnbl1 speTri1
Sus scrofa 18482 ENSSSCT00000002500 100154146 ENSSSCG00000002245 C7H15orf29 susScr2
Taeniopygia guttata 12184 ENSTGUT00000012130 100221941 ENSTGUG00000011641 KATNBL1 taeGut1
Tarsius syrichta 689 ENSTSYT00000011071 ENSTSYG00000011059 KATNBL1 tarSyr1
Tetraodon nigroviridis 5251 ENSTNIT00000015381 ENSTNIG00000012211 katnbl1 tetNig2
Tupaia belangeri 1610 ENSTBET00000001611 ENSTBEG00000001614 KATNBL1 tupBel1
Tursiops truncatus 7340 ENSTTRT00000007234 101317301 ENSTTRG00000007235 KATNBL1 turTru1
Vicugna pacos 11325 ENSVPAT00000007170 102533396 ENSVPAG00000007170 KATNBL1 vicPac1
Xenopus tropicalis 11883 ENSXETT00000024471 780003 ENSXETG00000011204 katnbl1 xenTro2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 14843 ENSACAP00000015066 100562330 ENSACAG00000015339 katnbl1 anoCar1
Bos taurus 7790 ENSBTAP00000048916 ENSBTAG00000040066 Q17QA6_BOVIN bosTau4
Bos taurus 15902 ENSBTAP00000008409 540295 ENSBTAG00000006413 KATNBL1 bosTau4
Branchiostoma floridae 19685 estExt_fgenesh2_pg.C_1320051 braFlo1
Callithrix jacchus 21039 ENSCJAP00000039292 100405394 ENSCJAG00000021110 KATNBL1 calJac3
Callithrix jacchus 44982 ENSCJAP00000041822 ENSCJAG00000023316 calJac3
Canis familiaris 5036 ENSCAFP00000011794 607369 ENSCAFG00000007971 KATNBL1 canFam2
Cavia porcellus 1226 ENSCPOP00000010028 100729475 ENSCPOG00000011153 KATNBL1 cavPor3
Danio rerio 13312 ENSDARP00000062349 325430 ENSDARG00000042522 katnbl1 danRer6
Dasypus novemcinctus 8567 ENSDNOP00000012620 101436814 ENSDNOG00000016279 KATNBL1 dasNov2
Dipodomys ordii 10456 ENSDORP00000012385 ENSDORG00000013172 Katnbl1 dipOrd1
Echinops telfairi 1321 ENSETEP00000001324 ENSETEG00000001640 KATNBL1 TENREC
Equus caballus 20890 ENSECAP00000020968 100057956 ENSECAG00000023450 KATNBL1 equCab2
Erinaceus europaeus 13392 ENSEEUP00000013391 ENSEEUG00000014674 KATNBL1 eriEur1
Felis catus 11429 ENSFCAP00000015880 101097734 ENSFCAG00000018289 KATNBL1 felCat3
Fugu rubripes 46381 ENSTRUP00000046381 101062036 ENSTRUG00000018118 katnbl1 fr2
Gallus gallus 13081 ENSGALP00000015671 423287 ENSGALG00000009633 KATNBL1 galGal3
Gasterosteus aculeatus 10060 ENSGACP00000010475 ENSGACG00000007898 katnbl1 gasAcu1
Gorilla gorilla 7692 ENSGGOP00000021721 101142481 ENSGGOG00000014230 KATNBL1 gorGor3
Homo sapiens 56957 ENSP00000256544 79768 ENSG00000134152 KATNBL1 hg19,GRCh37
Loxodonta africana 792 ENSLAFP00000009832 100655676 ENSLAFG00000011765 KATNBL1 loxAfr3
Macropus eugenii 14257 ENSMEUP00000014256 ENSMEUG00000015610 KATNBL1 Meug_1.0
Microcebus murinus 3515 ENSMICP00000003517 ENSMICG00000003855 KATNBL1 micMur1
Monodelphis domestica 15477 ENSMODP00000002026 100026680 ENSMODG00000001657 KATNBL1 monDom5
Mus musculus 6626 ENSMUSP00000028552 72425 ENSMUSG00000027132 Katnbl1 mm9
Myotis lucifugus 1405 ENSMLUP00000001401 102431872 ENSMLUG00000001532 myoLuc1
Nematostella vectensis 25874 estExt_fgenesh1_pg.C_1060011 Nemve1
Ochotona princeps 6183 ENSOPRP00000009470 ENSOPRG00000010379 KATNBL1 OchPri2.0
Ornithorhynchus anatinus 1922 ENSOANP00000002643 ENSOANG00000001650 KATNBL1 ornAna1
Oryzias latipes 21518 ENSORLP00000022327 ENSORLG00000017841 katnbl1 oryLat2
Oryzias latipes 20261 ENSORLP00000021103 ENSORLG00000016868 KATNBL1 (1 of 2) oryLat2
Otolemur garnettii 14002 ENSOGAP00000014004 100941143 ENSOGAG00000015633 KATNBL1 otoGar1
Pan troglodytes 2459 ENSPTRP00000011749 467645 ENSPTRG00000006877 KATNBL1 panTro2
Pongo abelii 8124 ENSPPYP00000007149 100437216 ENSPPYG00000006309 KATNBL1 ponAbe2
Procavia capensis 6063 ENSPCAP00000010576 ENSPCAG00000011336 KATNBL1 proCap1
Pteropus vampyrus 2855 ENSPVAP00000003617 ENSPVAG00000003822 KATNBL1 pteVam1
Rattus norvegicus 14529 ENSRNOP00000007688 691543 ENSRNOG00000005814 Katnbl1 rn4
Rhesus macaque 27299 ENSMMUP00000000009 695784 ENSMMUG00000000013 KATNBL1 rheMac2
Sorex araneus 7141 ENSSARP00000007143 101543386 ENSSARG00000007891 KATNBL1 sorAra1
Spermophilus tridecemlineatus 3420 ENSSTOP00000003420 101974883 ENSSTOG00000003813 Katnbl1 speTri1
Sus scrofa 2435 ENSSSCP00000002438 100154146 ENSSSCG00000002245 C7H15orf29 susScr2
Taeniopygia guttata 15474 ENSTGUP00000011999 100221941 ENSTGUG00000011641 KATNBL1 taeGut1
Tarsius syrichta 635 ENSTSYP00000010155 ENSTSYG00000011059 KATNBL1 tarSyr1
Tetraodon nigroviridis 2478 ENSTNIP00000015177 ENSTNIG00000012211 katnbl1 tetNig2
Tupaia belangeri 1401 ENSTBEP00000001397 ENSTBEG00000001614 KATNBL1 tupBel1
Tursiops truncatus 6924 ENSTTRP00000006846 101317301 ENSTTRG00000007235 KATNBL1 turTru1
Vicugna pacos 10527 ENSVPAP00000006673 102533396 ENSVPAG00000007170 KATNBL1 vicPac1
Xenopus tropicalis 20033 ENSXETP00000024471 780003 ENSXETG00000011204 katnbl1 xenTro2

multiple sequence alignment in CLUSTALW format


Oryzias_latipes|13051              ATGGATTCTGACAGTGAAGAGAGAAACAGTCATGGTTTG---------------GATCAT
Xenopus_tropicalis|11883           ATGGCATCAGGAGCCCACCTTACTAAGAAACGGGAC------------CTAGATGAAAGT
Ornithorhynchus_anatinus|3721      ATGGCATCTGAACCTCATCATGACTGGAAACGGAACCCTCTGCAGGAC------------
Anolis_carolinensis|7200           ------------------------------------------------------------
Gallus_gallus|16983                ATGGCATCTGAGGCTCACAATGCTAAAAAACAGAAAGTATTGCAT---ATTGAAGGTCGT
Taeniopygia_guttata|12184          ATGGCATCTGAAGCTCACAATGCTAAAAAACAGAAAGTATTGCTT---ATTGAAGGTCAT
Macropus_eugenii|15656             ------------------------------------------------------------
Erinaceus_europaeus|16291          ATGGCATCTGATACCCACGATGATGAAAAACGGAACTTTACTAAT------GAGGATCAG
Ochotona_princeps|7101             ------------------------------------------------------------
Callithrix_jacchus|54031           ATGGCATCGGAAACCCACAATGTTAAAAAACGGAACTTTCGTAATAAGATTGAGGATCAT
Felis_catus|45365                  ATGGCAACTGAGGCCCACAATGTTAAAAAACGAACCTTTTGTAATAATATTGAGGATCAT
Tarsius_syrichta|689               ATGGCATCTGAAACCCACAATGTTAAAAAACGAAACTTTTGTAATAATATTGAGGATCAT
Monodelphis_domestica|1955         ------------GCTCACAATGATAGAAAACGGAACCTTTTGTAT---ATTGAGGGCCAT
Tursiops_truncatus|7340            ATGGCATCTGAAACCCACAATGTTAAAAAACGCAACTTTTGTAATAATATTGAAGATCAT
Spermophilus_tridecemlineatus|3816 ATGGCATCTGAAACCCACAATGTTAAAAAACGAAACTTTTCTAATAATATTGAGGATCAT
Microcebus_murinus|4135            ATGGCATCTGAAACCCACAATGTTAAAAAACGGAACTTTTGTGATAATATTGAGGATCAT
Mus_musculus|23490                 ATGGCATTTGATACTCACCATGTTAAAAAACGGAACTTCTCTAATAGT------------
Rattus_norvegicus|22786            ATGGCATTTGATACTCACCATGTTAAAAAACGGAACTTCTCTAATAGT------------
Bos_taurus|17954                   ATGGCATCTGAAACCCACAATGTTAAAAAACGCAACTTTTGTAATCATACTGAGGATCAT
Dipodomys_ordii|11129              ------------------------------------------------------------
Otolemur_garnettii|16259           ------------------------------------------------------------
Bos_taurus|1631                    ATGGCATCTGAAACCCACAATGTTAAAAAACGCAACTTTTGTAATCATACTGAGGATCAT
Echinops_telfairi|1678             ATGGCATCTGAAACCCACAACGTTAAAAAACGGAACCTTTGTAATAATACTGAGGATCAT
Procavia_capensis|6460             ATGGCATCTAAAACCCACAATGTTAAAAAAAGG---TTTTGTAATAAAATTGAGGATCAT
Sorex_araneus|8036                 ATGGCATCTGAAACCCACAATGTTAAAAAACGAAACTTTTGTTATGATATTGAGGATCAT
Dasypus_novemcinctus|9698          ATGGCATCTGAAACCCACAATGTTAAAAAACGTAACTTTTGTAATAATATTGAGGATCAT
Loxodonta_africana|23740           ATGGCATCTGAAACCCACAATGTTAAAAAGCGGAACTTTTGTAATAATATTGAGGATCAT
Cavia_porcellus|1585               ATGGCATCTGAAAACCACAATGTTAAAAAACGGAACTTTTGTAATAATATTGAGGATCAT
Vicugna_pacos|11325                ATGGCATCTGAAACCCACAATGTTAAAAAACGGAACTTTTGTGATAATATTGAGGATCAT
Myotis_lucifugus|1555              ATGGCATCTGAAACCCACAATGTTAAAAAACGGAACTTTTATAATAATATTGAGGATCAT
Pteropus_vampyrus|3026             ATGGCATCTGAAACCCACAATGTTAAAAAACGAAACTTTTGTAATAATATTGAGGATCAT
Equus_caballus|1807                ATGGCATCTGAAACCCACAATGTTAAAAAGCGGAACTTTTGTAATAATATTGAGGATCAT
Callithrix_jacchus|29036           ATGGCATCGGAAACCCACAATGTTAAAAAGCGGAACTTTTATAATAAGATTGAGGATCAT
Rhesus_macaque|33786               ATGGCATCGGAAACCCACAATGTTAAAAAACGGAACTTTTGTAATAAGATTGAGGATCAT
Gorilla_gorilla|8946               ATGGCATCGGAAACCCACAATGTTAAAAAACGGAACTTTTGTAATAAGATTGAGGATCAT
Homo_sapiens|28254                 ATGGCATCAGAAACCCACAATGTTAAAAAACGGAACTTTTGTAATAAGATTGAGGATCAT
Pan_troglodytes|12541              ATGGCATCAGAAACCCACAATGTTAAAAAACGGAACTTTTGTAATAAGATTGAGGATCAT
Pongo_abelii|9204                  ATGGCATTGGAAACCCACAATGTTAAAAAACGGAACTTTTGTAATAAAATTGAGGATCAT
Canis_familiaris|18013             ATGGCATCTGAAGCCCACAATGTTAAAAAACGAACCTTTTGTAATAATATTGAGGATCAC
Sus_scrofa|18482                   ATGGCCTCTGAAACCCACAATGTTAAAAAATGCAACTCTTGTAATAATATTGAGGATCAT
Tupaia_belangeri|1610              ------------------------------------------------------------
Oryzias_latipes|14750              ATGGCCGCTGGTGAGCTGCGGGGACAGAGTCACCACATCACACCC---------------
Danio_rerio|15372                  ATGGCCACTGGAAGTCATGTTGGAAGTAATGCAGAAGTCCACAGGCTCAAGCAGGCTCAG
Gasterosteus_aculeatus|26685       ------------------------------------------------------------
Tetraodon_nigroviridis|5251        ------------------------------------------------------------
Fugu_rubripes|20508                ------------------------------------------------------------
Branchiostoma_floridae|3507        ATGGCAGCAGTTCCCGGACATGGTGGACGCATCCAGTGGGATTTTGTAAAGAGGAAGTAT
Nematostella_vectensis|25799       ------------ATGGCAGCATTGAAGAAGCGAAGCGTTGAAGAAAATGTCGGTCACTTT
                                                                                               

Oryzias_latipes|13051              CCT---GTCAGTTGGCACAAACCACAGGACAAAGGCAGTTTTGGAACAACAACCAAACAG
Xenopus_tropicalis|11883           TCTTCCAATGATTTCCCAAGGAAAAGGATCTCTCCTTCAGCAAAGCAGAATATGAAGGAG
Ornithorhynchus_anatinus|3721      ------GACCATCTCCTTAGAAAAAGGGCCTCGCGATTCCCTCGCAAGATCATGAAGGAG
Anolis_carolinensis|7200           ------------------------------------------------------------
Gallus_gallus|16983                CCT---GTTGATCTCCCCAGAAAAGCAATCTCTTCTTCCACTAAAAAGATCATGAAGGAG
Taeniopygia_guttata|12184          CCC---ATTGATCTCCCCAGAAAAAGAATCTCCTCTTCCACTAAAAAGATCATGAAGGAG
Macropus_eugenii|15656             ------------------------------------------------------------
Erinaceus_europaeus|16291          TTC---ATTGATCTTCCTCGAAAAAAAATCTCTAATTTCACTAATAAGAACATGAAGGAG
Ochotona_princeps|7101             ------------------------------------------------------------
Callithrix_jacchus|54031           TTC---ATTGATCTTACTAGAAAAAAGATCTGTGATTTCACTAATAAGAACATGAAGGAG
Felis_catus|45365                  TCC---ACTGATCTTCCTAGAAAAAGGATCTCTAATTTTACTAATAAGAACATGAAGGAG
Tarsius_syrichta|689               TCC---ATTGATCTTCCTAGGAAAAAGATCTCTAATTTCACTAAAAAGAACATGAAGGAG
Monodelphis_domestica|1955         TCC---ATTGATCTTCCTAGAAAAAGGATCTCTCATTTCACTAATAAGAACATGAAGGAG
Tursiops_truncatus|7340            TTC---ATTGATGTTCCTAGAAAAAGGGTCTCTAATTTCACTAATAAGAACATGAAGGAG
Spermophilus_tridecemlineatus|3816 TCC---ATTGATCTTCCTAGAAAAAAGATCTCTAATTTCACTAATAAGAACATGAAGGAG
Microcebus_murinus|4135            TCT---ACTGATCTTCCTAGAAAAAGGATCTCTAATTTCACTAATAAGAACATGAAGGAG
Mus_musculus|23490                 ------ATTGATCTTCCTAGAAAGAGGATCTCTAACTTCACCAGTAAGAACATGAAGGAG
Rattus_norvegicus|22786            ------ATTGATCTTCCTAGAAAGAGGATCTCTAATTTTACCAGTAAGAACATGAAGGAG
Bos_taurus|17954                   TCC---ATTGATCTTCCTAGAAAAAGGATCTCTAATTTCACTAATAAGAACATGAAGGAG
Dipodomys_ordii|11129              ------------------------------------------------------------
Otolemur_garnettii|16259           ------------------------------------------------------------
Bos_taurus|1631                    TCC---ATTGATCTTCCTAGAAAAAGGATCTCTAATTTCACTAATAAGAACATGAAGGAG
Echinops_telfairi|1678             TCCAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Procavia_capensis|6460             TCC---CTTGATCTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Sorex_araneus|8036                 TCC---ATTGATCTTCCTAGAAAAAGGATCTCTAATTTCACTAGTAAGAACATGAAGGAG
Dasypus_novemcinctus|9698          TCC---GTTGATCTTCCTAGAAAAAGGATCTCTAATTTCACTATTAAGAACATGAAGGAG
Loxodonta_africana|23740           TTC---CTTGATCTTCCTAGAAAGAGGAACTCTAATTTCACTAAGAAGAACATGAAGGAG
Cavia_porcellus|1585               TCC---ATTGATCTTCCCAGAAAAAGGATTTCTAATTTCACTAATAAGAACATGAAGGAG
Vicugna_pacos|11325                TCT---ACTGATCTTCCTAGAAAAAGGATCTCTAATTTCACTAATAAGAACATGAAGGAG
Myotis_lucifugus|1555              TCC---ATTGATCGTCCTAGAAAAAGGATCTCTAATTTCACTAATAAGAACATGAAGGAG
Pteropus_vampyrus|3026             CCC---ATTGATCTTCCTAGAAAAAGGATCTCTAATTTCACTAATAAGAACATGAAGGAG
Equus_caballus|1807                TAC---ATTGATCTTCCTAGAAAAAGGATCTCTAAATTCACTAATAAGAACATGAAGGAG
Callithrix_jacchus|29036           TTC---ATTGATCTTCCTAGAAAAAAGATCTCTAATTTCACTAATAAGAACATGAAGGAG
Rhesus_macaque|33786               TTC---ATTGATCTTCCTAGAAAAAAGATCTCTAATTTCACTAATAAGAACATGAAGGAG
Gorilla_gorilla|8946               TTC---ATTGATCTTCCTAGAAAAAAGATCTCTAATTTCACTAATAAGAACATGAAGGAG
Homo_sapiens|28254                 TTC---ATTGATCTTCCTAGAAAAAAGATCTCTAATTTCACTAATAAGAACATGAAGGAG
Pan_troglodytes|12541              TTC---ATTGATCTTCCTAGAAAAAAGATCTCTAATTTCACTAATAAGAACATGAAGGAG
Pongo_abelii|9204                  TTC---ATTGATCTTCCTAGAAAAAAGATCTCTAATTTCACTAATAAGAACATGAAGGAG
Canis_familiaris|18013             TCC---ACTGATCTTCCTAGAAAAAGGATCTCTAATTTTACTAATAAGAACATGAAGGAG
Sus_scrofa|18482                   TCC---ATTGATCTTCCTAGAAAAAGGATCTCTAATTTCACTAATAAGAACATGAAGGAG
Tupaia_belangeri|1610              ------------------------------------------------------------
Oryzias_latipes|14750              ------GATGGCTTCCAACGCCTCTGCACGCGCCTCTCTACTGACCACATCATGAAGCAG
Danio_rerio|15372                  CCC---CATGACCTTCTCAAACGTATGCTTTGTTCTGGAGATGAGAAGAACATGAGGGAG
Gasterosteus_aculeatus|26685       ---------------------------------------------------ATGAAGGAG
Tetraodon_nigroviridis|5251        ------------------------------------------------AACATGAAGCAG
Fugu_rubripes|20508                ------------------------------------------------AACATGAAGCAG
Branchiostoma_floridae|3507        GTTTGGGTCAATGAAAATGAGCCGAAGCCGAAGGAAGGACACGAACAGCCGAAGAAAAAG
Nematostella_vectensis|25799       TAC---TACGATTGGGCGCAAGCGAAGTACAAA---------------------------
                                                                                               

Oryzias_latipes|13051              agtaaaagtgacagcaatgaagagttc------tacaaaaagAGGTATCCAATTAGTCGC
Xenopus_tropicalis|11883           GGAAATAATAAGTCACAAGAAGAGTTGGTTTCTGACAGAAACAGAACGCAGATCGAGCAG
Ornithorhynchus_anatinus|3721      GGTAAG---AGAGCTCCAAAACAGCTGGCTTCTTACACACACAGA---CCCGCCGGTCGA
Anolis_carolinensis|7200           ------------------------------------------------ACAGTTGGACAA
Gallus_gallus|16983                GATAAG---AAAGCTCCAAAACAGCTGGCTTCATACACAAACAGAATAACAGTTGGAAAA
Taeniopygia_guttata|12184          gGTAAG---AAATCTCCAAAACAGCTGGCTTCATACACTAACAGAGTAACGGTTGGAAAA
Macropus_eugenii|15656             ------------------------------------------------------------
Erinaceus_europaeus|16291          NNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNN
Ochotona_princeps|7101             ------------------------------------------------ACAGTTGGACAA
Callithrix_jacchus|54031           GTTAAG---AAATCCCCAAAACAGTTGGCTGCTTACATAAATAGA---ACAGTTGGACAA
Felis_catus|45365                  NNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNN
Tarsius_syrichta|689               NNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNA---ACAGTTGGACAA
Monodelphis_domestica|1955         GGTAAG---AAATCTCCAAAACAGTTGGCTGCTTATACAAATAGA---ACAGTTGGATAC
Tursiops_truncatus|7340            GTTAAG---AAATCTCCAAAACAGTTGGCTGCTTACATAACTAGA---ACAGTTGGACAA
Spermophilus_tridecemlineatus|3816 GTTAAG---AAATCTCCAAAACAGTTGGCTGCTTATATAAATAGN---NNNNNNNNNNNN
Microcebus_murinus|4135            GTTAAG---AAATCTCCAAAACAGTTGGCTGCTTACAAAAATAGA---ACAGTTGGACAA
Mus_musculus|23490                 GTTAAG---AGATCTCCAAAACAGTTGGCTGCTTACATAAGTAGA---ACAGTTGCACAG
Rattus_norvegicus|22786            GTTAAG---ATATCTCCAAAACAGTTGGCTGCGTACATAAGTAGA---ACAGTTGGACAA
Bos_taurus|17954                   GAGGAA------------------------------------------------------
Dipodomys_ordii|11129              GTTAAG---AAATCTCCAAAACAGTTGGCTGCTTACATAAATAGA---ACAGTGGGAAAA
Otolemur_garnettii|16259           GTTAAG---AAATCTCCAAAACAGTTGGCTGCTTACATAAATAGA---ACAGTTGGACAA
Bos_taurus|1631                    GTA---------------------------------------------------------
Echinops_telfairi|1678             GTTAAG---AAATCTCCAAAACAGTTGGCTGCTTACATAAATAGA---ACAGTTGGACTA
Procavia_capensis|6460             GTTAAG---AAATCTCCAAAACAGTTGGCTGCTTACATAAATAGA---ACAGTTGGACAA
Sorex_araneus|8036                 GTTAAG---AAATCTCCAAAACAGTTGGCTGCTTACATAAATAGA---ACAGTTGGACAA
Dasypus_novemcinctus|9698          GTTAAG---AAATCTCGCAAACAGTTGGCTGCTTATATTAATCGA---ACAGTTGGACAA
Loxodonta_africana|23740           GTTAAG---AAATCTCCAAAACAGTTGGCTGCTTACAAAAATAGA---ACAGTTGGACAA
Cavia_porcellus|1585               GTTAAG---AGATCTCCAAAACAGTTGGCTGCTTACATAAACAGA---ACAGTTGGACAA
Vicugna_pacos|11325                NNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNA---ACAGTTGGACAA
Myotis_lucifugus|1555              GTTAAG---AAATCTCCAAAACAGTTGGCTGCTTACATAAATAGA---ACAGTTGGACAC
Pteropus_vampyrus|3026             GTTAAG---AAATCTCCAAAACAGTTGGCTGCTTACATAAATAGA---ACAGTTGGACAA
Equus_caballus|1807                GTTAAG---AAATCTCCAAAACAGTTGGCTGCTTATATAAATAGA---ACAGTTGGACAA
Callithrix_jacchus|29036           GTTAAG---AAATCTCCAAAACAGTTGGCTGCTTACATAAATAGA---ACAGTTGGACAA
Rhesus_macaque|33786               GTTAAG---AAATCTCCAAAACAGTTGGCTGCTTATATAAATAGA---ACAGTTGGACAA
Gorilla_gorilla|8946               ---------------------CAGTTGGCTGCTTACATAAATAGA---ACAGTTGGACAA
Homo_sapiens|28254                 GTTAAG---AAATCTCCAAAACAGTTGGCTGCTTACATAAATAGA---ACAGTTGGACAA
Pan_troglodytes|12541              GTTAAG---AAATCTCCAAAACAGTTGGCTGCTTACATAAATAGA---ACAGTTGGACAA
Pongo_abelii|9204                  GTTAAG---AAATCTCCAAAACAGTTGGCTGCTTACATAAATAGA---ACAGTTGGACAA
Canis_familiaris|18013             ATTAAG---AAATCTCCAAAACAGTTGGCTGCTTACAAAAATAGA---ACAGTTGGACAA
Sus_scrofa|18482                   GTTAAG---AAATCTCCAAAACAGTTGGCTGCTTACATAACTAGA---ACAGTTGGTCAA
Tupaia_belangeri|1610              ------------------------------------------------ACAGTTGGACAA
Oryzias_latipes|14750              GTGGAA---GTATGTCATCAGGAAGATTTA---GATAAGGACAGGTTTCAGGTGCATCAC
Danio_rerio|15372                  GTGGAT------TATTTACTGAAGGACGAAACTGATCAAGAGAGATTTCCAGTGGGCCGT
Gasterosteus_aculeatus|26685       GTGGAT---ATTATAAATAAGGAAGAATTA---GATAAAGAAAGATTTCAAGTCCACTAC
Tetraodon_nigroviridis|5251        GTGGAT---ATTATAAATAAGGAAGAATTA---GATAAAGAAAGGTTTCAGGTCCATTAC
Fugu_rubripes|20508                GTGGAT---ATTATAAATAAGGAAGAATTA---GATAAAGAAAGGTTTCAAGTCCATTAC
Branchiostoma_floridae|3507        GTAACGCCTTATGGAGAGGATCAAGTGCAAGCCATGCTGAAAAGGAGGGCAATGAACCTT
Nematostella_vectensis|25799       ---------TGGACCGCCGAGGATGTAAAGAAGAACCAGAACAAT---AAAGTAAATCTC
                                                                                               

Oryzias_latipes|13051              TCCGGCAACAACCCAGGCAGAGTA---AAGAGA------GTAGTGTCATGTAAGCGGAAA
Xenopus_tropicalis|11883           TCTTTACACTCCAACGAAAACCAT---TTCAAA------GTGGTGTATTGCAAGAGGAAA
Ornithorhynchus_anatinus|3721      GCCGTGAGGAGCCCAAACAAAGCG---CCCAAA------GCGGGGAGCCACAGGAGAGGT
Anolis_carolinensis|7200           ACTGTGATCAGCCCTCATCCTCTG---TTCAAA------GTAGTATATTGCAGAAGAAAA
Gallus_gallus|16983                ACGGTGACCAGTCCCCTGTCTCTC---TTCAAA------GCAGTACATTGCAAAAGAAAA
Taeniopygia_guttata|12184          ACAGTGACCAGTCCCCTCTCTCTC---TTCAAA------GTGGTATATTGTAAAAGGAAA
Macropus_eugenii|15656             ------------------------------------------------------------
Erinaceus_europaeus|16291          NNNNNNNNNNNNNNNNNNNNNNNN---NNNNNN------NNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|7101             GCTGTGAAAAACCCAGACAAACTA---CGTAAG------GTGATCTATCGCAGAAAGAAA
Callithrix_jacchus|54031           ACTGTGAAAAGACCAGATAAACTG---TGTAAA------GTGATCTATCCCAGAAAG---
Felis_catus|45365                  NNNNNNNNNNNNNNNNNNNNNNNN---NNNNNN------NNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|689               GCTGTGAAAAGCCCGGATAAACTA---CGGAAG------GTGATCTATCTCAGAAAGAAA
Monodelphis_domestica|1955         ACTGTGAAAAGTCCAGACAAACTG---CACAAA------GAAGTATATTACAGAAAGAAA
Tursiops_truncatus|7340            GCTGTGAAAAGCCCAGATAAACTA---CGTAAG------GTGATCTATCACAGAAAGAAA
Spermophilus_tridecemlineatus|3816 NNNNNNNNNNNNNNNNNNNNNNNN---NNNNNN------NNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|4135            GCTGTGAAAAGCCCGGAT---CTG---CATAAG------GTGATCTATCACAGAAAGAAG
Mus_musculus|23490                 GCAGTGAAAAGCCCAGAAAAACTG---CGCAAG------GTGCTCTACCACAGAAAGTTA
Rattus_norvegicus|22786            GCAGTGAAAAGCCCAGATAAGCTG---CGCAAG------GTACTCTACCACAGAAAGTTA
Bos_taurus|17954                   ------------------------------------------------------------
Dipodomys_ordii|11129              GCTGTGAAAAGCCCAGATAAACTA---CGTAAG------GTGATCTATCACAGAAAGAAA
Otolemur_garnettii|16259           GCTGTGAAAAATCCAGATAAACTG---CATAAG------GTGATTTATCACAGAAAGAAA
Bos_taurus|1631                    ------------------------------------------------------------
Echinops_telfairi|1678             GCTGTGAAGAGCCCAGATAAACTA---CGTAAG------GCGATCTATTTCAGAAAGAAA
Procavia_capensis|6460             GCTGTGAAGACCCCAGATAAACTA---CGTAAG------GTGATCTATTGCAGGAAGAAA
Sorex_araneus|8036                 GCTGTGAAAAGTCCGGATAAACTA---CTTAAG------GTGATCTATCGCAGGAAGAAA
Dasypus_novemcinctus|9698          GCTGTGAAAAGTACAGATAAACTG---TATAAG------GTGATCTATCGCAGAAAGAAA
Loxodonta_africana|23740           ACTGTGAAGACCCCAGATAAACTA---CGTAAG------GTGATCTATTGCAGAAAGAAA
Cavia_porcellus|1585               GCTGTGAAAAGCCCAGGTATACTA---CACAAA------GTGATCAATCGCAGAAAGAAA
Vicugna_pacos|11325                GCTGTGAAAAGCCCAGATAAACTA---CGTAAG------GTGATCTATCGCAGAAAGAAA
Myotis_lucifugus|1555              GCTGTTAAAAGCCCAGATAAACTA---CGTAAG------GTGATCTACCACAGAAAGAAA
Pteropus_vampyrus|3026             GCTGTGAAAAGCCCGGATAAACTA---CGTAAG------GTGATCTATCACAGAAAGAAA
Equus_caballus|1807                GCTGTGAAAAGCCCAGATAAACTA---CGTAAG------GTGATCTATCATAGAAAGAAA
Callithrix_jacchus|29036           ACTGTTAAAAGCCCAGATAAACTT---CGTAAA------GTGATATATCGCAGAAAGAAA
Rhesus_macaque|33786               ACTTTGAAAAGCCCAGATAAACTT---CGTAAA------GTGATCTATCGCAGAAAGAAA
Gorilla_gorilla|8946               ACTGTGAAAAGCCCAGATAAACTT---CGTAAA------GTGATCTATCGCAGAAAGAAA
Homo_sapiens|28254                 ACTGTGAAAAGCCCAGATAAACTT---CGTAAA------GTGATCTATCGCAGAAAGAAA
Pan_troglodytes|12541              ACTGTGAAAAGCCCAGATAAACTT---CGTAAA------GTGATCTATCGCAGAAAGAAA
Pongo_abelii|9204                  ACTGTGAAAAGCCCAGATAAACTT---CGTAAA------GTGATCTATCGCAGAAAGAAA
Canis_familiaris|18013             GCTGTGAAAAGCCCAGATAAACTA---CGCAAG------GTGATCTATCGCAGAAAGAAA
Sus_scrofa|18482                   GCTGTGAAAAGCCCAGATAAACTA---CGTAAG------GTGATCTATCGCAGAAAGAAA
Tupaia_belangeri|1610              GCTGTGAGAAGCCCAGATAAACTA---CGTAAG------GTGATCTATCACAGAAAGAAA
Oryzias_latipes|14750              AGAGTTCAGAATCCAGGCAAAGCG---AAGCGG------CCATCGTCCTACAAGAGGAGG
Danio_rerio|15372                  TGTGTGCACAAATACAGCAAAACG---AAGAGAGAGGGTGTTGGCAAGAAGAAAACTCGT
Gasterosteus_aculeatus|26685       GGAGTACAGAGCCCCGCCAAGACA---AAGCGA------TTGTCATCTTGCAAGAGGAAG
Tetraodon_nigroviridis|5251        AGCGTCCACAGCCCAGGCAAAGCC---AAGCGA------GCATCGTCGGTCAAGAGGAAG
Fugu_rubripes|20508                AGAGTCCCCAGCCCAGCCAAAGCCAAGAAGCGA------GTGTCATCGGTCAAGAGGAAG
Branchiostoma_floridae|3507        CAACTTCAAGGGAGACAAAATCAGGTGAAACAGCCACCGGTATTCCAAATGCCTGGGAAG
Nematostella_vectensis|25799       AATGATCATTTTCCCAATGAGAAC---GCTAAG------GTCCAAGCAAAGAAGAATTTT
                                                                                               

Oryzias_latipes|13051              ACTCATCATCTAACG------------------GTGGTCAGAAGGAAGCAGCACGCATCT
Xenopus_tropicalis|11883           GCTCACTATCAAACC---------CTGAGTCCCACATACAAAAAAAAGCAGCTCCCAAAG
Ornithorhynchus_anatinus|3721      CGTCGCCAC---TTT---------CCGAGCCCCCGTTCTAGAAAAGCGGCGTCGCCCGGG
Anolis_carolinensis|7200           GTTCACTACTATTCT---------CCGAAGCCTTCTTTCAGAAAGAAACCACTTTCTAAA
Gallus_gallus|16983                GTCCATTGTTACACT---------GCAAAGCCTTGTTATAAGAGGAAACAGTTCCCTAAA
Taeniopygia_guttata|12184          GTTCATTGTTATACT---------CCAAAGCCTTGTTACAGAAAGAAACTGAGCCCTAAA
Macropus_eugenii|15656             ------------------------------------------------------------
Erinaceus_europaeus|16291          NNNNNNNNNNNNNNN---------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|7101             GTTCATCATCCCTTT---------CCAGATCCTTGTTACAGAAAAAAACAGTCCCCTAGC
Callithrix_jacchus|54031           ---------------------------------------------------GTCCCTGGA
Felis_catus|45365                  NNNNNNNNNNNNNNN---------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|689               GTTCATCATTCCTTT---------CCAAATCCTTGTTACAGAAAAAAACAGTCCCCTAGA
Monodelphis_domestica|1955         GTACATCATTATTTT---------CCAAATCCTTGTTATAGAAGAAAACACTTTCCTAGA
Tursiops_truncatus|7340            GTTCATCATCCTTTT---------CAAAATCCTTGCTACAGAAAAAAGCAGTCCCCCAAC
Spermophilus_tridecemlineatus|3816 NNNNNNNNNNNNNNN---------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|4135            GTTCATCATCTCTTT---------CCAAATCCTTGTTACAGAAAAAAACAGTCCCCTCGA
Mus_musculus|23490                 GTTCGTCGTTCCTTC---------CCAAATCCTTGTTACAAAACTAAGCAGTCCCCAAAA
Rattus_norvegicus|22786            GTTCGTCATTCATTC---------CCAAATCCTTGTTACAAAACTAAGCAGTCCCCTAGA
Bos_taurus|17954                   ------------------------------------------------------------
Dipodomys_ordii|11129              GTTTATCATCCCTTC---------CCAAATCCTTGTTACAGAAGAAGACAGTCCCTTCCA
Otolemur_garnettii|16259           GTTCGTCATTCCTTT---------CCAAGTCCTTGTTACAGAAAAAAACAGTCCCCTCAA
Bos_taurus|1631                    ------------------------------------------------------------
Echinops_telfairi|1678             GTTCATCGTCCTCTC---------CCCAGTCCTTGTTACAGAAAGAAGCAGGCCCCTAGA
Procavia_capensis|6460             GTTCAGCGTCCTTTT---------CCAAATCCTTGTTACAGAAAGAAACAGTCCCCTAAA
Sorex_araneus|8036                 ATTCATCATCCTTTT---------CCACATCCTTGTGACAGGAAAAAACAGTCCCCCAAA
Dasypus_novemcinctus|9698          GTTCATCATCCTTCT---------CCAAATCCTTATTACAGAAGAAAACAGTCCCCAAGA
Loxodonta_africana|23740           GTTCAGCGTCCGTTT---------CCAAATCCTTGTTACAGGAAAAAACAGTCCCCTAAA
Cavia_porcellus|1585               GTTCATCATCCCTTT---------CCAAATCCTTGTTACAGAAAAAAAGAGTCCCCTAGA
Vicugna_pacos|11325                ATTCATCATCCTTTT---------CCAAATCCTTGTTACAGAAAAAAACAGTCCCCTACA
Myotis_lucifugus|1555              GTTCATTATCCTTTT---------CCAAATTCTTGTTTTAAAAAGAAACAGTCCCCTAGA
Pteropus_vampyrus|3026             GTTCATCATCCTTTT---------TCAAATCCTTGTTACAAAAAAAAACAGTCCCCTAGA
Equus_caballus|1807                GTTCATCATTCTTCT---------CCAAATACTTGTTACAGAAAAAAACAGTCCCCTAGA
Callithrix_jacchus|29036           GTTCATCATCCCTTT---------CCAAGTCCTTGTTACAGAAAAAAACAGTCCCCTGGA
Rhesus_macaque|33786               GTTCATCATCCCTTT---------CCAAATCCTTGTTACAGAAAAAAACAGTCCCCTGGA
Gorilla_gorilla|8946               GTTCATCATCCCTTT---------CCAAATCCTTGTTACAGAAAAAAACAGTCCCCTGGA
Homo_sapiens|28254                 GTTCATCATCCCTTT---------CCAAATCCTTGTTACAGAAAAAAACAGTCCCCTGGA
Pan_troglodytes|12541              GTTCATCATCCCTTT---------CCAAATCCTTGTTACAGAAAAAAACAGTCCCCTGGA
Pongo_abelii|9204                  GTTCATCATCCCTTT---------CCAAATCCTTGTTACAGAAAAAAACAGTCCCCTGGA
Canis_familiaris|18013             GTGCATCATCCTTTT---------CCAAATCCTTGTTACAGAAAAAAACAGTCCCCTAGA
Sus_scrofa|18482                   GTTCATCATCCTTTT---------CCAAACCCTTGTTACAGAAGAAAACAGTCCCCTAGA
Tupaia_belangeri|1610              GTTCATCATTCCTTT---------CCAAATCCTTGTTACAGAAAAAAACAGTCCCCTAGA
Oryzias_latipes|14750              AGCTGCGCACCGGTGGAGGCGGGCGTGAAGCTGCAGCGCCGCTCGTCCGATGCCGGCCGG
Danio_rerio|15372                  CTCTCTGGGGTGGGA---------CCAAGAGCATGT------CGGAAATTGCCCACCACA
Gasterosteus_aculeatus|26685       GGTGGTCCATTGGTGGAGGTGGGCTTAAAGCTGCACCGCAGAACATCCGATGTAGGCCGT
Tetraodon_nigroviridis|5251        GGTTGCCCCGTGGTGGAGGTGGGCTCCAAGCTGCACCGCAGGACCTCCAATGCAGACCGC
Fugu_rubripes|20508                GGTTGTCCAGTGGTGGAGGGGGGCTCGAAGCTGCACCGCCAGGCATCCGATGTAGGCCGT
Branchiostoma_floridae|3507        AAAGGTTGCAAAAAG---------CCGACCCCATCAAAAAGGAAGAAGAGCAAGTCTCCA
Nematostella_vectensis|25799       GTTTGTGCACCTGTA---------GCCGAAGAAATTCTTTCAAAAGGGTTTAAAGAAGAT
                                                                                               

Oryzias_latipes|13051              GAGAGGACCTTTGAAGCAGCAAAC------AAGGAGAACAACATGGCAGTTTTGCAGGAC
Xenopus_tropicalis|11883           GCTTGGGGCTGTGACATGGCAAAT------AAAGAAAATGAGTTAGCA---GCAGGGAAC
Ornithorhynchus_anatinus|3721      GGCGGGTCCCTTGTCATGGCCAAC------AAGGAGAACGAGCTGGCCTGCGCGGGGCCC
Anolis_carolinensis|7200           GTCAAGAGCCGTGACATGGCAAAT------AAGGAAAATGAACTGGCATGTGCAGGTAAT
Gallus_gallus|16983                TCAAGGGGCTGTAACATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCAGGGAAT
Taeniopygia_guttata|12184          TCTAGGGGCCGTGACAtggcaaat------aaagaaaatgaactgGCTTGTGCAGGGAAT
Macropus_eugenii|15656             ------------------------------------------------------------
Erinaceus_europaeus|16291          NNNNNNNNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|7101             AGTGGGGGCTGTGACATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCAGGCCAC
Callithrix_jacchus|54031           AGTGGGGGCTGTAACATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCAGGCCAC
Felis_catus|45365                  NNNNNNNNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|689               AGTGGGGGCTGGGACATGGCA---------AAAAAAAATGAACTGGCTTGTGCA---CAC
Monodelphis_domestica|1955         AGCAGGGGCTGTGACATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCAGGCCAC
Tursiops_truncatus|7340            AGCGGGGGCTGTGACATGGCAAAT------AAAGAGAATGAGCTGGCTTGTGCAGGCCGC
Spermophilus_tridecemlineatus|3816 NNNNNNNNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|4135            AGTGGGGGCTGTGACATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCAGGCCAC
Mus_musculus|23490                 AGTGGGGGCTGTGACATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCAGGCCAT
Rattus_norvegicus|22786            AGTGGGGGCTGTGACATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCAGGCCAT
Bos_taurus|17954                   ------------------------------------------------------------
Dipodomys_ordii|11129              AGTGGGGGCTGTGACATGGCAAAT------AAAGAAAATGAACTGGCTTGTACAGGCCAT
Otolemur_garnettii|16259           AGTGGGGGCTGTGACATGGCAAAT------AAGGAAAATGAACTGGCTTGTGCAGGCCAC
Bos_taurus|1631                    ------------------------------------------------------------
Echinops_telfairi|1678             AGTGGGGGCTGTGTCATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCAGGCCAC
Procavia_capensis|6460             AGTGGGGGCTGTGTCATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCGGGCCAC
Sorex_araneus|8036                 AGTGGGGACTGTGACATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCAGGCCAC
Dasypus_novemcinctus|9698          AGTGGGGGCTGTGACATGGCAAAT------AAAGAAAATGAAGTGGCTTGTGCCAGCCAC
Loxodonta_africana|23740           AGTGGGGGCTGTGTCATGGCAAAT------AAAGAAAACGAATTGGCTTGTGCAGGCCAC
Cavia_porcellus|1585               AGTGGGGGCTGTGACATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCAGGCCAC
Vicugna_pacos|11325                AGTGGGGGCTGTGACATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCAGGCCAC
Myotis_lucifugus|1555              AGTGGGGGCTGTGACATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCAGGCCAC
Pteropus_vampyrus|3026             AGTGGGGGCTGTGACATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCTGGCCAC
Equus_caballus|1807                AGTGGGGGCTGTGACATGGCAAAT------AAAGAAAACGAACTGGCTTGTGCAGGCCAC
Callithrix_jacchus|29036           AGTGGGGGCTGTGACATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCAGGCCAC
Rhesus_macaque|33786               AGTGGGGGCTGTGACATGGCAAAT------AAAGAAAACGAACTGGCTTGTGCAAGCCAC
Gorilla_gorilla|8946               AGTCGGGGCTGTGACATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCAGGCCAC
Homo_sapiens|28254                 AGTGGGGGCTGTGACATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCAGGCCAC
Pan_troglodytes|12541              AGTGGGGGCTGTGACATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCAGGCCAC
Pongo_abelii|9204                  AGTGGGGGCTGTGACATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCAGGCCAC
Canis_familiaris|18013             AGTGGGGGCTGTGACATGGCAAAT------AAAGAAAATGAACTAGCTTGTGCAGGCCAC
Sus_scrofa|18482                   AGTGGGGGCTGTGACATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCAGGCCAC
Tupaia_belangeri|1610              AGTGGGGGCTGTGACATGGCAAAT------AAAGAAAATGAACTGGCTTGTGCAGGCCAC
Oryzias_latipes|14750              TATCGTGAGCCCGGCATGGCcaacagagaaaaagagaatgAGCTGACCTGC---------
Danio_rerio|15372                  AGCAGGACATCTGACATGGCAAAC------AAAGAAAACGAACTGACCTGCGTTGATGAA
Gasterosteus_aculeatus|26685       GTCCCTAAACCTGGCATGGCCAAC------AAAGAAAATGAGCTGACGTGCACCGATGAT
Tetraodon_nigroviridis|5251        GCCCATGACTGCGGCATGGCCAAC------AAAGAGAACGAGCTGACCTGCTCCGATGAC
Fugu_rubripes|20508                GCCCATGACTGCAGCATGGCCAAC------AAAGAGAACGAGCTGACGTGCTCCGATGAC
Branchiostoma_floridae|3507        TCTCCTCCAAGAGCAGTAGTG---------AAACAGCCCCGTGTGGAGGCCATGGACTGG
Nematostella_vectensis|25799       GATCCAAAGAAACCACTTCAAAAT------AGAGATATCAACCAACCAATAAGCGACGAG
                                                                                               

Oryzias_latipes|13051              GCGCAGCAAGAAATGTTTCACTGGGACTCATTAGAGCACTCGCAAAACATCAATAATAAC
Xenopus_tropicalis|11883           CTGCACGATAAGCTTCAGAAT---GACCGCCGCAGCTTCGCTCTTAACTCCAGTGACTCT
Ornithorhynchus_anatinus|3721      CTGGCCGACAAGCTGCGCCAG---GACGGCCGGGCCCCGGGCCTCGGCCCCAGCGACTCG
Anolis_carolinensis|7200           CTGCCAGCAAAACTGCCTGCT---GATGGGCGCACATTCTTGCTGaactccagtgattct
Gallus_gallus|16983                CTGCCAGCAAAACTG---AAT---GACAGTCGTACACACTTGCTGAATTCTAGTGACTCT
Taeniopygia_guttata|12184          CTGCCAGCAAAACTT---CAC---TGCAGTCGGACACACTTGCTGAATTCTAGTGACTCT
Macropus_eugenii|15656             ------------------------------------------------------------
Erinaceus_europaeus|16291          NNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|7101             CTGCCCGAAAAGTTACGTCAT---GATAGTCGAACATATTTGATTAATTCCAGCGACTCT
Callithrix_jacchus|54031           CGGGCTGAAAAACTACACCAG---GATAGTCGAACATACTTAGTTAACTCCAGTGATTCC
Felis_catus|45365                  NNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|689               TTGCCCGAAAAATTACGCCAT---GATAGTCGAACATACTTGCTTAACTCCAGTGATTCT
Monodelphis_domestica|1955         CTGCCTGAAAAATTACGCCAT---GACGGTCGGACATTTTTACTTAATGCCAGTGATTCT
Tursiops_truncatus|7340            CTCCCTGAGCAAGTGCGGCAG---GGTAGTCGACCATATCTGGTTAGCCCCAGTGATTCT
Spermophilus_tridecemlineatus|3816 NNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|4135            TTGCCTGAAAAATTACGCCAT---GATAGTCGAACATATTTGATTAACTCCAGTGATTCT
Mus_musculus|23490                 CTACCTGAAAATTTACGCCAC---GACAGTCGGACATTTGTCATTAATACCAGTGATTCT
Rattus_norvegicus|22786            CTACCTGAAAATTTACACCAT---GACAGTCGGACATTTGTCATTAACACCAGTGATTCT
Bos_taurus|17954                   ------------------------------------------------------------
Dipodomys_ordii|11129              CTGCCTGAAAAGCTACACCAT---GATAGTCGAACGTACTTGGTTAACTCCAGTGAAGCT
Otolemur_garnettii|16259           TTGCCTGAAAAATTGCACCAT---GATAGTCGAACATATTTGATTAACTCCAGTGATTCT
Bos_taurus|1631                    ------------------------------------------------------------
Echinops_telfairi|1678             CTACCTGACAAATTACGCCAT---GATAGTCGAACATATTTGATTAACTCCAGTGATTCT
Procavia_capensis|6460             CTACCTGAAAAATTACACCAT---GATAGTCGAACATATTTGATTAACTTAAGTGATTCT
Sorex_araneus|8036                 CTGCCTGAAAAATTACGCCCC---GATTGTCGAACATATTTGGTTAATGCCAGTGATTCT
Dasypus_novemcinctus|9698          CTACCTGAAAAATTACGCCAT---GATAGTCGAACATATTTGGTTAACTCCAGTGATTCT
Loxodonta_africana|23740           CTACCTGAAAAATTACACCAT---GATAGTCGAACATACTTGATTAACTTCAGTGATGCT
Cavia_porcellus|1585               CTCCCTGAAAAATTACACCAT---GATAGTCGAACATATGTGGTTAACTCTAGTGACTCT
Vicugna_pacos|11325                CTCCCTGAGAAACTACGCCAT---GATACTCGAACATATTTAGTTAACTCCAGTGATTCT
Myotis_lucifugus|1555              CCGCCTGAAAAATTACACCAT---GGTAGTCGAACATATTTGCTTAACTCCAGTGATTCT
Pteropus_vampyrus|3026             CTGCCTGAAAAATTATACCAT---GATAGTAGAACATATTTGCTTAACTCCAGAGATTCT
Equus_caballus|1807                CTGCCTGAAAAATTACGCCAT---GATAGCCGAACATATTTGGTTAACTCCAGTGATTCT
Callithrix_jacchus|29036           CTGCCTGAAAAATTACACCAT---GATAGTCGAACATATTTGATTAACTCCAGTGATTCT
Rhesus_macaque|33786               CTGCCTGAAAAATTACACCAT---GATAGTCGAACGTATTTGGTTAACTCCAGTGATTCT
Gorilla_gorilla|8946               CTGCCTGAAAAATTACACCAT---GATAGTCGAACATATTTGGTTAACTCCAGTGATTCT
Homo_sapiens|28254                 CTGCCTGAAAAATTACACCAT---GATAGTCGAACATATTTGGTTAACTCCAGTGATTCT
Pan_troglodytes|12541              CTGCCTGAAAAATTACACCAT---GATAGTCGAACATATTTGGTTAACTCCAGTGATTCT
Pongo_abelii|9204                  CTGCCTGAAAAATTACACCAT---GATAGTCGAACATATTTGGTTAACTCCAGTGATTCT
Canis_familiaris|18013             CTGCCTGAAAAATTACGCCAC---GATAGTCGAACATATTTGGTTAACTCCAGTGATGCT
Sus_scrofa|18482                   CTCCCTGAAAAATTACGCCAT---GATAGTCGAACATATTCGGTTAACTCCAGTGATTCT
Tupaia_belangeri|1610              CTGCCCGAAAAATTACACCAT---GATAGTCGAACATATTTAGTTAACTCCAGTGATTCT
Oryzias_latipes|14750              ------------------------CCCGATGGTGGCCAAGGCCTTCGTTGCTATGACAAC
Danio_rerio|15372                  GTGCAGGCTTTTCTTTACAGT---GACAACTGTGGGTTCCCAGTGAACTCCACAGACGCA
Gasterosteus_aculeatus|26685       GTACGTCGCACGCACTACAAT---GACAACCGCGGGCTCCCTGTGAACTCTGCAGAGGCC
Tetraodon_nigroviridis|5251        CTACCGAGG------------------AACGGCGGGCTCCCCGTGAACTCTGGAGAGGCC
Fugu_rubripes|20508                ACGCGCAGG------------------AACTGCGGTCTGCCCGTGAACCCTGGAGACGCC
Branchiostoma_floridae|3507        GAACCAGTCTTATCACCTTCAGCAGAGGACAGGGAGAACAGGCCTGTGGCTGCTAATGTC
Nematostella_vectensis|25799       GCTCCTCAAAAGCCAATCAAGATCAGTCAAAGAGATTCTAGTAATCAGAATGATCCTGCA
                                                                                               

Oryzias_latipes|13051              CACAAGACTAGTCTAACTGGTTCTGAGCACACAGGCTACAGTTTATTCACTGAGCTGTCG
Xenopus_tropicalis|11883           AGCTCTTCCCATACTGAAGGACCTTCAAACAAGTACAGTAGTTTCTTTGCAGAGGTTTCT
Ornithorhynchus_anatinus|3721      AGCGTGGCCCAGACCGAGAGCCCCTCGTCCAAATATAGCAGCTTTTTCTCTGAGGTG---
Anolis_carolinensis|7200           ggtcgtGCTCAAGCAGAGAGCCCTTCATCAAAATACAGTGGAtttttttCAGAGGTTTCT
Gallus_gallus|16983                GGTTCATCTCAAACAGAAGGCCCCTCTTCCAAATATAGTGCATTTTTTTCAGAGGTTTCT
Taeniopygia_guttata|12184          GGCTCGTCTCAAACAGAAGGCCCCTCGTCCAAATACAGCgcatttttttcagagGTTTCT
Macropus_eugenii|15656             ------------------------------------------------------GTTTCT
Erinaceus_europaeus|16291          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTTCT
Ochotona_princeps|7101             GGTTCTTCACAGACAGAAAGCCCATCATCAAAATATAGTGGGTTCTTTTCTGAGGTTTCT
Callithrix_jacchus|54031           GGTTCTTCACCAAGAGAAAGCCTATCATTAAAACACAGTAGGTTTTTTCCTGAGGTTTCT
Felis_catus|45365                  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|689               GGTTCTTCTCAGACAGAAAGCCCATCATCAAAATATAGTGGGTTTTTTTCTGAGGTTTCT
Monodelphis_domestica|1955         AGTTCTTCACAAACAGAAAGCCCATCTTCAAAATATAGTGGGTTTTTTACTGAGGTTTCT
Tursiops_truncatus|7340            GGTTCTTCACAGACAGAAAGCCCATCATCAAAATATAGTGGGTTTTTTTCTGAGNNNNNN
Spermophilus_tridecemlineatus|3816 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|4135            AGTTCTTCACAAACAGAAAGTCCATCATCAAAATATAGTGGGTTTTTTTCTGAGNNNNNN
Mus_musculus|23490                 GGGTCTTCACAGACAGAAAGCCCATCATCAAAATATAGTGGTTTCTTTTCTGAAGTTTCT
Rattus_norvegicus|22786            GGGTCTTCACAGACAGAAAACCCATCATCAAAATATAGTGGTTTCTTTTCTGAGGTTTCT
Bos_taurus|17954                   ------------------------------------------------------------
Dipodomys_ordii|11129              GGTTCTTCACAAACAGAAAGCCCAGCATCAAAATTTAGTGGGTTTTTTTCTGAGGTTTCT
Otolemur_garnettii|16259           AGTTCTTCACAAACAGAAAGTCCATCATCAAAATACAGTGGGTTTTTTTCTGAGGTTTCT
Bos_taurus|1631                    ------------------------------------------------------------
Echinops_telfairi|1678             GGGGCTTCACAGACAGAAGGCCCATCATCAAAATATAGTGGCTTTTTTTCTGAGGTTTCT
Procavia_capensis|6460             GGTTCTTCACAGACAGAAAACCCATCATCAAAATATAGTGGCTTTTTTTCTGAGGTGTCT
Sorex_araneus|8036                 GGTTCTTCACAGACAGAAAACCCATCATCGAAATATAGTACTTTTTTTTCTGAGGTTTCT
Dasypus_novemcinctus|9698          GGTTCTTCACAGACAGAAAGCCCATCATCAAAATATAGTGGGTTTTTTTCTGAGGTTTCT
Loxodonta_africana|23740           GGTTCTTCACAGACAGAAAGCCCATCATCAAAATATAGTGGTTTTTTTTCTGAGGTTTCT
Cavia_porcellus|1585               AGTTCTTCACAGACAGAAAGCCCGTCATCAAAATATAGTGGTTTTTTCTCTGAGGTTTCT
Vicugna_pacos|11325                GGTTCTTCACAGACAGAAAGCCCATCATCAAAATATAGTAGTTTTTTTTCTGAGGTTTCT
Myotis_lucifugus|1555              GGTTCTTCACAGACAGAAAGCGCATCATCAAAATACAGTGGGTTTTTTTCTGAGGTTTCT
Pteropus_vampyrus|3026             GGTTCTTCACAGACAGAAAGCCCATCATCAAAATATAGTGGGTTTTTTTCTGAGGTTTCT
Equus_caballus|1807                AGTTCTTCACAGACAGAAAGCCCATCATCAAAATATGGTGGGTTTTTTTCTGAGGTTTCT
Callithrix_jacchus|29036           GGTTCTTCACAGACAGAGAGCCCATCATCAAAATATAGTGGGTTTTTTTCTGAGGTTTCT
Rhesus_macaque|33786               GGTTCTTCACAGACAGAAAGCCCATCATCAAAATATAGTGGGTTTTTTTCTGAGGTTTCT
Gorilla_gorilla|8946               GGTTCTTCACAGACAGAAAGCCCATCATCAAAATATAGTGGGTTTTTTTCTGAGGTTTCT
Homo_sapiens|28254                 GGTTCTTCACAGACAGAAAGCCCATCATCAAAATATAGTGGGTTTTTTTCTGAGGTTTCT
Pan_troglodytes|12541              GGTTCTTCACAGACAGAAAGCCCATCATCAAAATATAGTGGGTTTTTTTCTGAGGTTTCT
Pongo_abelii|9204                  GGTTCTTCACAGACAGAAAGCCCATCATCAAAATATAGTGGGTTTTTTTCCGAGGTTTCT
Canis_familiaris|18013             GGTTCTTCACAGACAGAAAGCCCATCATCAAAATATAGTGGTTTTTTTTCTGAGGTTTCT
Sus_scrofa|18482                   AGTTCGTCACAGACAGAAAGCCCATCATCAAAATATAGTGGGTTTTTTTCTGAGGTTTCT
Tupaia_belangeri|1610              GGTTCTTCACAGACAGAAAGCCCATCATCAAAATATAGTGGTTTTTTTTCTGAGGTTTCT
Oryzias_latipes|14750              GGCGAGCCGTGGGTGAACGCTCCTACCTCCAGAATGGCGGGCGCCAGCTCCAAGTGCAGT
Danio_rerio|15372                  ---------AAAATGGCAGGAGCTGGCTCCAAATACAGCGATTATTTTACTGAGTTATCA
Gasterosteus_aculeatus|26685       ------TCCAAGATGGCAGGGGCCGGCTCCAAGTACAAAGACTTC---ACCGAGCTCTCA
Tetraodon_nigroviridis|5251        ------TCCAAAATGGCAGGGGCCACTTCCAAGTGCAGCGACTTC---ACTGAGCTGTCC
Fugu_rubripes|20508                ------CCCAAGATGGCGGGGGCCAGCTCCAAATACAGCGACTTC---ACCGAGTTGTCG
Branchiostoma_floridae|3507        AGGAAGTCAAAGGATTCAGGAGCTGCTGCAGAGGAGGAGGATGCACTCTTGCAGTTGAGT
Nematostella_vectensis|25799       AGAAAGTCCAGTGCACAAGGGAGCTCTGATACCGACGAGACA------AATGAGATTAGG
                                                                                               

Oryzias_latipes|13051              AAGGATCATAAAACTATGGTGGATGTTCTGTTTGGAAGACATTTAAGGTTAAAGGTGGCT
Xenopus_tropicalis|11883           AAAGACCATGAGACAATGGAGCAAGTCCTATTTAGCAGGAATCTCAGGCTAAACGTAGCT
Ornithorhynchus_anatinus|3721      ------------------------------------AGGCCTCCCCGGGCACCGCCCCTC
Anolis_carolinensis|7200           GAAGATCATGAAACAATGGCACAAGTTCTCTTCAGTAGAAATCTTCGACTGAATGTAGCT
Gallus_gallus|16983                CAGGACCATGAAACTATGGCTCAAGTTCTTTTCAGCAGGAATCTGAGGCTGAATGTTGCT
Taeniopygia_guttata|12184          CAGGACCATGAAACTATGGCTCAAGTTCTTTTCAGCAGGAATCTGAGACTGAACGTAGCT
Macropus_eugenii|15656             CAGGACCACGAGACAATGGCACAAGTCCTTTTCAGTAGAAATCTGAGGTTGAATGTAGCT
Erinaceus_europaeus|16291          CAGGACCATGAAACAATGACACAAGTTTTGTTCAGCAGAAATTTGAGACTAAATGTAGCT
Ochotona_princeps|7101             CAGGACCATGAAACAATGGCCCAAGTTTTATTCAGCAGGAATTTGAGATTGAATGTAGCT
Callithrix_jacchus|54031           CAGGACCATGAAACAATGGCCCAAGTTTTGTTCAGCAGGAATTTGAGATTGAATGTAGCT
Felis_catus|45365                  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|689               CAGGACCATGGAACAATGGCCCAAGTTTTGTTCAGCAGGAATTTGAGACTGAACGTAGCT
Monodelphis_domestica|1955         CAGGATCATGAGACAATGGCACAAGTCCTTTTCAGTAGAAATCTGAGGTTGAATGTAGCT
Tursiops_truncatus|7340            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTCAGCAGGAATTTGAGA---AATGTAGCT
Spermophilus_tridecemlineatus|3816 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|4135            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|23490                 CAGGACCATGAGACAATGGCCCAGGTTCTATTCAGCAGGAATTTGAGATTGAATGTAGCT
Rattus_norvegicus|22786            CAGGACCATGAGACAATGGCCCAAGTTCTATTCAGCAGGAATTTGAGATTGAATGTAGCT
Bos_taurus|17954                   ------------------------------------------------------------
Dipodomys_ordii|11129              CAGGATCATGAAACAATGGCTCAAGTTTTATTCAGCAGGAATTTGAGGTTGAATGTAGCT
Otolemur_garnettii|16259           CAGGACCATGAAACAATGGCTCAAGTTTTGTTCAGCAGGAATTTGAGATTGAATGTAGCT
Bos_taurus|1631                    ------------------------------------------------------------
Echinops_telfairi|1678             CAGGACCATGAAACAATGGCGCAAGTTTTGTTCAGCAGAAACTTGAGGTTGAATGTAGCT
Procavia_capensis|6460             CAGGACCATGAAACAATGGCACAGGTTTTGTTCAGCAGGAATTTGAGACTGAATGTAGCT
Sorex_araneus|8036                 CAGGACCATGAAACAATGGCACAAGTTTTATTCAGCAGGAATCTGAGATTGAATGTAGCT
Dasypus_novemcinctus|9698          CAGGACCATGAAACAATGGCACAGGTTTTGTTCAGCAGGAATTTGAGACTGAATGTAGCT
Loxodonta_africana|23740           CAGGACCATGAAACAATGGCACAAGTTTTGTTCAGCAGGAATTTGCGGTTGAATGTAGCT
Cavia_porcellus|1585               CAGGACCATGAAACAATGGCCCAAGTTTTGTTCAGCAGGAATTTGAGATTGAATGTAGCT
Vicugna_pacos|11325                CAGGACCATGAAACAATGGCACAAGTTTTGTTCAGCAGGAATTTGAGATTGAATGTAGCT
Myotis_lucifugus|1555              CAGGATCATGAAACAATGGCACAAGTTTTGTTCAGCAGGAATTTGAGATTGAATGTAGCT
Pteropus_vampyrus|3026             CAGGACCATGAAACAATGGCACAAGTTTTATTCAGCAGGAATTTGAGATTGAATGTAGCT
Equus_caballus|1807                CAGGACCATGAAACAATGGCACAAGTTTTGTTCAGTAGGAATTTGAGATTGAATGTAGCT
Callithrix_jacchus|29036           CAGGACCATGAAACAATGGCCCAAGTTTTGTTCAGCAGGAATTTGAGACTGAATGTAGCT
Rhesus_macaque|33786               CAGGACCATGAAACAATGGCCCAAGTTTTGTTCAGCAGGAATATGAGATTGAATGTAGCT
Gorilla_gorilla|8946               CAGGACCATGAAACAATGGCCCAAGTTTTGTTCAGCAGGAATATGAGATTGAATGTAGCT
Homo_sapiens|28254                 CAGGACCATGAAACAATGGCCCAAGTTTTGTTCAGCAGGAATATGAGATTGAATGTAGCT
Pan_troglodytes|12541              CAGGACCATGAAACAATGGCCCAAGTTTTGTTCAGCAGGAATATGAGATTGAATGTAGCT
Pongo_abelii|9204                  CAGGACCATGAAACAATGGCCCAAGTTTTGTTCAGCAGGAATATGAGATTGAATGTAGCT
Canis_familiaris|18013             CAGGATCATGAAACAATGGCACAGGTTTTGTTCAGCAGGAATTTGAGATTGAATGTAGCT
Sus_scrofa|18482                   CAGGACCATGAAACAATGGCCCAAGTTTTGTTCAGCAGGAATTTGAGATTGAATGTAGCT
Tupaia_belangeri|1610              CAGGACCATGAAACAATGGCCCAAGTTTTGTTCAGCAGGAATTTGAGATTGAACGTAGCT
Oryzias_latipes|14750              GACTTCACTGAG------------------------------------------------
Danio_rerio|15372                  AAGGACCATGAAGCAATGAGTCATGTGCTCTTCGGAAGGAATCTCAGACTGAATGTTGCT
Gasterosteus_aculeatus|26685       AAGGACCACGAAGCCATGACTCGCGTCCTGTTCGGGAGGAACCTGCGACTAAAAGTGGCC
Tetraodon_nigroviridis|5251        AAGGACCACGAAGCCATGACTCACATCCTTTTTGGAAGAAATCTCCGATTAAAAGTAGCA
Fugu_rubripes|20508                AAGGACCACGAAGCGATGACTCACATCCTTTTTGGAAGGAACCTCCGATTAAAAGTGGCA
Branchiostoma_floridae|3507        TCAGGCCATCCCACCATGACTAAGGTCTTGTCCGGCAGGCTACTCTGGCTCCAAGCAGCT
Nematostella_vectensis|25799       AAGGGTCACTTAGCTATGACAACAGTGTTATCATCTCGACTTCTGAAGCTTCGTGCAGCA
                                                                                               

Oryzias_latipes|13051              TTCACACTCTGGCAG---AGAAATGCTGAAGAGctgttgacattctttctgaagttt---
Xenopus_tropicalis|11883           CTTACCTTCTGGAGGAAGCGCAGCATAAATGAGCTTGTTGCATATCTAGTCAGAATGCAA
Ornithorhynchus_anatinus|3721      GCCCATTTCCCTCCTCCCCCGGGGGCGGGTGAGCTGGTAGCCTACTTGGTGAGGATCGAG
Anolis_carolinensis|7200           TTGACCTTCTGGAGAAGAAGAAGTATAAGCGAGCTTATAGCCTATTTAGTGAGGATACAA
Gallus_gallus|16983                TTAACCTTTTGGAGAAGGAGAAGTATAAGTGAACTGGTAGCCTACCTATTGAGGATACAA
Taeniopygia_guttata|12184          TTAACCTTTTGGAGAAGGAGAAGTATAAGTGAACTGGTAGCCTACTTAGTGAGGATACAG
Macropus_eugenii|15656             TTAACTTTTTGGAGAAAACGAAGTATAAGTGAACTGGTAGCCTATTTAGTGAGGATAGAA
Erinaceus_europaeus|16291          TTAACTTTCTGGAGAAAGAGAAGTATAAGTGAACTCGTAGCTTACTTGGTGAGGATAGAA
Ochotona_princeps|7101             TTAACTTTTTGGAGGAAGCGAAGTATAAGTGAACTTGTAGCCTATTTGGTGAGGATAGAA
Callithrix_jacchus|54031           TTAACTTTCTGGAGAAAGAGAAGTATAAGTGGACTTGCAGATTATTTGTTGAGGATAGAA
Felis_catus|45365                  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATAGAA
Tarsius_syrichta|689               TTAACTTTCTGGAGAAAGAGAAGTATAAGTGAACTTGTAGCTTATTTGGTGAGNNNNNNN
Monodelphis_domestica|1955         TTAACTTTTTGGAGAAAACGAAGTATAAGTGAACTGGTAGCCTATTTGGTGAGGATAGAA
Tursiops_truncatus|7340            TTAACTTTCTGGAGAAAGAGAAGTATAAGTGAACTTGTAGCTTATTTGGTGAGGATAGAA
Spermophilus_tridecemlineatus|3816 TTTACTTTCTGGAGAAAGAGAAGTATAAGTGAACTTGTAGCTTATTTGGTGAGGATAGAA
Microcebus_murinus|4135            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|23490                 TTGACTTTCTGGAGAAAGAGAAGTATAAGTGAACTTGTAGCTTATTTAGTGAGGATAGAA
Rattus_norvegicus|22786            TTGACTTTCTGGAGAAAGAGAAGTGTTAGTGAACTTGTAGCTTATTTAGTGAGGATAGAA
Bos_taurus|17954                   ------------------------------------------------------------
Dipodomys_ordii|11129              TTAACGTTCTGGAGAAAGAGAAGTATAAGTGAACTTGTAGCATACTTAGTGAGGATAGAA
Otolemur_garnettii|16259           TTAACATTCTGGAAAAAGAGAAGTATAAGTGAACTTGTAGCTTATTTGGTGAGGATAGAA
Bos_taurus|1631                    ------------------------------------------------------------
Echinops_telfairi|1678             TTAACCTTCTGGAGAAAGAGAAGTATAAGTGAACTTGTAGCCTATTTGGTGAGGATAGAA
Procavia_capensis|6460             TTAACTTTCTGGAGGAAGAGAAGTATAAGTGAACTTGTAGCCTATTTGGTGAGGATAGAA
Sorex_araneus|8036                 TTAACTTTCTGGAGAAAGAGAAGTATAAGTGAACTAGTAGCTTATTTGGTGAGGATAGAA
Dasypus_novemcinctus|9698          TTAACTTTCTGGAGGAAGAGAAATATAAGTGAACTTGTAGCCTATTTGGTGAGGATAGAA
Loxodonta_africana|23740           TTAACTTTCTGGAGGAAGAGAAGTATAAGTGAACTTGTAGCCTATTTGGTGAGGATAGAA
Cavia_porcellus|1585               TTAACTTTCTGGAGAAAGAGAAGTATAAGTGAACTTGTAGCTTATTTGGTGAGAATAGAA
Vicugna_pacos|11325                TTAACTTTCTGGAGAAAGAGAAGTATAAGTGAACTTGTAGCTTATTTGGTGAGGATAGAA
Myotis_lucifugus|1555              TTAACTTTCTGGAAAAAGAGAAGTATAAGTGAACTTGTAGCTTATTTGGTGAGGATAGAA
Pteropus_vampyrus|3026             TTAACTTTCTGGAAAAAGAGAAGTATAAGTGAACTTGTAGCTTATTTGGTGAGGATAGAA
Equus_caballus|1807                TTAACTTTCTGGAGAAAGAGAAGTATAAGTGAACTTGTAGCTTATTTGGTAAGGATAGAA
Callithrix_jacchus|29036           TTAACTTTCTGGAGAAAGAGAAGTATAAGTGAACTTGTAGCTTATTTATTGAGGATAGAA
Rhesus_macaque|33786               TTAACTTTCTGGAGAAAGAGAAGTATAAGTGAACTTGTAGCTTATTTGTTGAGGATAGAA
Gorilla_gorilla|8946               TTGACTTTCTGGAGAAAGAGAAGTATAAGTGAACTTGTAGCTTATTTGTTGAGGATAGAA
Homo_sapiens|28254                 TTAACTTTCTGGAGAAAGAGAAGTATAAGTGAACTTGTAGCTTATTTGTTGAGGATAGAA
Pan_troglodytes|12541              TTAACTTTCTGGAGAAAGAGAAGTATAAGTGAACTTGTAGCTTATTTGTTGAGGATAGAA
Pongo_abelii|9204                  TTAACTTTCTGGAGAAAGAGAAGTATAAGTGAACTTGTAGCTTATTTGTTGAGGATAGAA
Canis_familiaris|18013             TTAACATTCTGGAGAAAGAGAAGTATAAGTGAACTTGTAGCTTATTTGGTGAGGATAGAA
Sus_scrofa|18482                   TTAACTTTTTGGAGAAAGAGAAGTATAAGTGAACTTGTAGCTTATTTGGTGAGGATAGAA
Tupaia_belangeri|1610              TTAACTTTCTGGAGAAAGAGAAGTATAAGTGAACTTGTAGCTTATTTGGTGAGGATAGAT
Oryzias_latipes|14750              ------------------------------------------------------------
Danio_rerio|15372                  TTGACTCTTTGGCGG---AAAAATGCAAGCGAACTAGTGGCATACTTAAACAGAATACAA
Gasterosteus_aculeatus|26685       CAAACATTGTGGCGA---AAAAATGCCAGTGAATTAGTGGCCTACCTAATAAGAATTGAA
Tetraodon_nigroviridis|5251        CAAACGCTGTGGCGA---AGAAGCGCCAGTGAACTGGTGGCCTACCTGATCAGAATTCAG
Fugu_rubripes|20508                CAAACGCTATGGCGA---AGAAACGCCAGTGAACTGGTGGCCTACCTGATCAGGATCCAG
Branchiostoma_floridae|3507        CTGACCTTCTGGAAA---CAGAGCCCAACTGCCCTCGTCTCCTACATTCTGAGAATAAAC
Nematostella_vectensis|25799       GAAACTCTATGGCATAAGGACACATCCAATGGTTTTGTGGAGTATATATTAAGGTTAAAA
                                                                                               

Oryzias_latipes|13051              ------------------------------------------------------------
Xenopus_tropicalis|11883           GACTTAGGGGTGCTCGTAGATTGTCTACCGGTCCTTACAAACAGTCTGCAAGAA------
Ornithorhynchus_anatinus|3721      GACCTCGGCGTGGTGGTGGACTGTCTCCCCGTGCTCACCAGCAGTCTGCAGGAA------
Anolis_carolinensis|7200           GATCTAGGTGTGATGGTAGACTGCCTTCCTGTTCTGACCAGCAGTTTACAGGAA------
Gallus_gallus|16983                GATCTCGGAGTTGTAGTAGACTGCCTTCCTGTGCTTACAAACAGTTTACAGGAA------
Taeniopygia_guttata|12184          GATCTTGGAGTAGTAGTAGACTGCCTTCCTGTGCTTACGAACAGtttacaggaa------
Macropus_eugenii|15656             GACCTTGGAGTGGTGGTAGATTGCCTTCCTGTGCTCACCAGCAGTTTACAGGAA------
Erinaceus_europaeus|16291          GACCTTGGTGTCGTGGTGGATTGCCTTCCGGTGCTCACCAATAGTTTACAGGAA------
Ochotona_princeps|7101             GATCTGGGAGTTGTAGTAGATTGCCTTCCTGTGCTCACCAATAGTTTACAGGAA------
Callithrix_jacchus|54031           GATCTTGGCGTTGTAGTAGAGTGCCTTCCTGTGCACACCAATAGTTTACAGGAA------
Felis_catus|45365                  GATCTTGGAGTTGTCGTGGATTGCCTTCCTGTGCTCACCAATAGTTTACAGGAG------
Tarsius_syrichta|689               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------
Monodelphis_domestica|1955         GATCTTGGAGTGGTAGTAGATTGCCTTCCTGTGCTCACTAGCAGTTTACAGGAA------
Tursiops_truncatus|7340            GACCTTGGAGTTGTGGTGGATTGCCTTCCTGTGCTCACCAATAGTTTACAGGAG------
Spermophilus_tridecemlineatus|3816 GATCTTGGAGTTGTGGTAGATTGCCTGCCTGTACTCACTAATAGTTTACAGGAA------
Microcebus_murinus|4135            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------
Mus_musculus|23490                 GACCTTGGAGTTGTGGTAGATTGCCTTCCTGTTCTAACCAATAGTTTACAGGAA------
Rattus_norvegicus|22786            GACCTTGGAGTTGTGGTAGATTGCCTTCCTGTTCTAACCAATAGTTTACAGGAA------
Bos_taurus|17954                   ------------------------------------------------------------
Dipodomys_ordii|11129              GATCTTGGAGTTGTGGTCGATTGCCTCCCTGTACTCACCAACAGTTTGCAGGAA------
Otolemur_garnettii|16259           GATCTTGGAGTTGTGGTAGATTGCTTCCCTGTGCTCACT---AGTTTACAGGAA------
Bos_taurus|1631                    ------------------------------------------------------------
Echinops_telfairi|1678             GATCTTGGGGTTGTGGTGGACTGCCTTCCTGTGCTCACCAATAGTTTGCAGGAA------
Procavia_capensis|6460             GATCTTGGAGTGGTGGTGGACTGCCTTCCCGTGCTCACAAACAGTTTACAGGAA------
Sorex_araneus|8036                 GACCTTGGTGTTGTGGTAGATTGCCTTCCTGTGCTTACCAATAGTTTACAGGAA------
Dasypus_novemcinctus|9698          GATCTTGGAGTTGTGGTAGATTGCCTTCCTGTGCTCACTAATAGTTTACAGGAA------
Loxodonta_africana|23740           GATCTTGGAGTTGTGGTAGATTGCCTTCCTGTGCTCACCAATAGTTTACAGGAG------
Cavia_porcellus|1585               GACCTTGGAGTTGTGGTAGATTGCCTTCCTGTGCTCACCAATAGTTTACAGGAA------
Vicugna_pacos|11325                GACCTTGGAGTTGTGGTGGATTGCCTTCCTGTGCTCACCAATAGTTTACAGGAA------
Myotis_lucifugus|1555              GACCTTGGAGTGGTGGTAGATTGCCTTCCTGTGCTTACCAATAGTTTACAGGAA------
Pteropus_vampyrus|3026             GATCTTGGAGTGGTGGTGGATTGCCTTCCTGTGCTCACCAATAGTTTACAAGAA------
Equus_caballus|1807                GACCTTGGAGTCGTGGTGGATTGCCTTCCTGTTCTCACCAATAGTTTACAGGAA------
Callithrix_jacchus|29036           GATCTTGGCGTTGTGGTAGATTGCCTTCCTGTGCTCACCAATAGTTTACAGGAA------
Rhesus_macaque|33786               GATCTTGGCGTTGTGGTAGATTGCCTTCCTGTGCTCACCAATTGTTTACAGGAA------
Gorilla_gorilla|8946               GATCTTGGCGTTGTGGTAGATTGCCTTCCTGTGCTCACCAATTGTTTACAGGAA------
Homo_sapiens|28254                 GATCTTGGCGTTGTGGTAGATTGCCTTCCTGTGCTCACCAATTGTTTACAGGAA------
Pan_troglodytes|12541              GATCTTGGCGTTGTGGTAGATTGCCTTCCTGTGCTCACCAATTGTTTACAGGAA------
Pongo_abelii|9204                  GATCTTGGCGTTGTGGTAGATTGCCTTCCTGTGCTCACCAATTGTTTACAGGAA------
Canis_familiaris|18013             GACCTTGGAGTTGTTGTGGATTGCCTTCCTGTGCTCACCAATAGTTTACAGGAA------
Sus_scrofa|18482                   GACCTTGGAGTTGTGGTGGATTGCCTTCCTGTGCTCACCAATAGTTTACAGGAA------
Tupaia_belangeri|1610              GATCTCGGAGTTGTGGTAGATTGTCTTCCTGTGCTGACCAATAGTTTACAGGAA------
Oryzias_latipes|14750              ------------------------------------------------------------
Danio_rerio|15372                  GACACGGGGGTGCTTGTTGACTGTTTGCCTGTACTTACTAAAAGTCTTCAGGGA------
Gasterosteus_aculeatus|26685       GACACAGGGGTGCTGCTTGACTGCTTACCCGTCTTAACAAATAACCTGCAAACC------
Tetraodon_nigroviridis|5251        GACCCCGGGGTCCTGCTGGACTGCCTGCCTGTCCTAACAAACGACCTTCAGGGC------
Fugu_rubripes|20508                GACACCGGGGTGCTGCTCGACTGCTTACCCGTCTTAACGAACGACCTTCAAAAC------
Branchiostoma_floridae|3507        AATGATGCCCTCTTAGCTGATGTCATCCCAATCCTCATCAAGAGCATCAAGGATGGGAAT
Nematostella_vectensis|25799       GATGACTCTGTTCTGGTTGACGTCATGCCACTTTTGACAAGCAGGGTCAAAGAGAATGCC
                                                                                               

Oryzias_latipes|13051              ------------------------------------------------------------
Xenopus_tropicalis|11883           ---GACAAAGCTTCCATTTCAGTTGGCTGCTGTGTCGACCTTTTACCACTAGTCAAATCC
Ornithorhynchus_anatinus|3721      ---GAGAAACAAGCCGTCTCCCTGGGCTGCTGTGTGGATCTGTTACCTCTGGTGAAATCG
Anolis_carolinensis|7200           ---GAAAAACCATATATTTCTGTTGGCTGCTGTGTAGACCTTCTACCATTAGTAAAATTA
Gallus_gallus|16983                ---GAAAAACCATATATTTCAGTTGGCTGCTGTGTAGATCTTTTGCCTTTAGTGAAATCA
Taeniopygia_guttata|12184          ---gaaaaaccaTATGTTTCAGTTGGCTGCTGTGTAGATCTTTTGCCTTTAGTGAAATCT
Macropus_eugenii|15656             ---GAAAAGCAGTATATTTCACTTGGCTGCTGTGTAGATCTGTTACCTCTAGTAAAATCA
Erinaceus_europaeus|16291          ---GAAAAGCAATACATCTCACTTGGCTGCTGTGTAGACTTGTTGCCTCTAGTAAAGTCT
Ochotona_princeps|7101             ---GAAAAACACTATATCTCACTTGGCTGCTGTGTGGATTTGTTGCCCCTAGTAAAGTCA
Callithrix_jacchus|54031           ---GAAAAACAATATATCTCACTTTGCTACTGTGTAGACTTGTTGGCTCTAGTAAAGTCA
Felis_catus|45365                  ---GAAAAACAGTACATCTCACTTGGCTGCTGTGTAGATTTGTTGCCTCTAGTCAAGTCC
Tarsius_syrichta|689               ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Monodelphis_domestica|1955         ---GAAAAGCAGTACATTTCACTAGGCTGCTGTGTAGATCTGTTGCCTCTAGTAAAATCA
Tursiops_truncatus|7340            ---GAAAAACAATACATCTCACTTGGCTGCTGTGTAGACTTGTTGCCTCTAGTAAAGTCA
Spermophilus_tridecemlineatus|3816 ---GAAAAACAATATATCTCACTTGGCTGCTGTGTAGACTTATTGCCTCTTGTAAAGTCA
Microcebus_murinus|4135            ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|23490                 ---GAAAAGCAGTATATCTCACTTGGCTGCTGTGTAGACTTACTTCCTCTGGTAAAGTCT
Rattus_norvegicus|22786            ---GAAAAGCAATGTATCTCTCTTGGCTGCTGTGTAGACTTATTTCCTCTAGTAAAGTCT
Bos_taurus|17954                   ------------------------------------------------------------
Dipodomys_ordii|11129              ---GAAAAGCAGTACGTCTCACTTGGCTGCTGTGTGGACTTGTTGCCTCTAGTAAAGTCA
Otolemur_garnettii|16259           ---GAAAAACAATATATCTCCCTTGGTTGCTGTGTAGATTTGTTGCCTCTAGTAAAGTCA
Bos_taurus|1631                    ------------------------------------------------------------
Echinops_telfairi|1678             ---GAAAAACAATACATCTCACTTGGCTGCTGTGTAGACTTGTTACCTCTAGTAAAGTCA
Procavia_capensis|6460             ---GAAAAACAGTACATCTCACTTGGTTGCTGTGTAGACTTGTTGCCTCTAGTAAAGTCA
Sorex_araneus|8036                 ---GAAAAACAATACATCTCACTGGGCTGCTGTGTAGATTTGTTGCCTCTAGTAAAGTCA
Dasypus_novemcinctus|9698          ---GGAAAACAATACATCTCACTTGGCTGCTGCGTAGACTTGTTGCCTCTAGTCAAATCA
Loxodonta_africana|23740           ---GAAAAACAATACATCTCACTTGGCTGCTGTGTAGACTTGTTGCCTCTAGTAAAGTCA
Cavia_porcellus|1585               ---GAAAAACAGTATATCTCACTTGGCTGCTGTGTAGATTTATTGCCTCTAGTAAAGTCG
Vicugna_pacos|11325                ---GAAAAACAATACATCTCACTTGGCTGCTGTGTAGACTTGTTGCCTCTGGTAAAATCA
Myotis_lucifugus|1555              ---GAAAAACAATACATCTCACTCGGCTGCTGTGTAGACTTGTTGCCCCTTGTAAAGTCA
Pteropus_vampyrus|3026             ---GAAAAACAATACATCTCACTCGGCTGCTGTGTAGACTTGTTGCCTCTAGTAAAATCA
Equus_caballus|1807                ---GAAAAACAATACATCTCACTTGGCTGCTGTGTGGACTTGTTGCCTCTAGTAAAGTCA
Callithrix_jacchus|29036           ---GAAAAACAATGTATCTCACTTGGCTGCTGTGTAGACTTGTTGCCTCTAGTAAAGTCA
Rhesus_macaque|33786               ---GAAAAACAATATATCTCACTTGGCTGCTGTGTAGACTTGTTGCCTCTAGTAAAGTCA
Gorilla_gorilla|8946               ---GAAAAACAATATATCTCACTTGGCTGCTGTGTTGACTTGTTGCCTCTAGTAAAGTCA
Homo_sapiens|28254                 ---GAAAAACAATATATCTCACTTGGCTGCTGTGTTGACTTGTTGCCTCTAGTAAAGTCA
Pan_troglodytes|12541              ---GAAAAACAATATATCTCACTTGGCTGCTGTGTTGACTTGTTGCCTCTAGTAAAGTCA
Pongo_abelii|9204                  ---GAAAAACAATATATCTCACTTGGCTGCTGTGTAGACTTGTTGCCTCTAGTAAAGTCA
Canis_familiaris|18013             ---GAAAAACAATACATCTCACTTGGCTGCTGTGTAGATTTGTTGCCTCTAGTAAAGTCC
Sus_scrofa|18482                   ---GAAAAACAATATATCTCACTTGGCTGCTGTGTAGACTTGTTGCCTCTAGTAAAGTCA
Tupaia_belangeri|1610              ---GAAAAACAGTATATCTCACTTGGCTGCTGTGTAGACTTGTTGCCTCTAGTAAAGTCA
Oryzias_latipes|14750              ------------------------------------------------------------
Danio_rerio|15372                  ---GAACAGCCATGCATTTCACTGGGCTGTTGTGTTGATCTTTTTCCACAAGTGAAAATG
Gasterosteus_aculeatus|26685       ---GAAGCACCATGTTTGTCACTTGGCTGCTGCGTTGACCTCGTGCCCCTTGTGAAAGCA
Tetraodon_nigroviridis|5251        ---GAGTCCCCGTGTTTGTCACTGGGCTGCTGCGTGGACCTCATGCCCCAGGTCAAAGTC
Fugu_rubripes|20508                ---GAGGCACCGTGTTTGTCTCTGGGCTGCTGCGTTGACCTCATGCCCCAACTCAAAGTG
Branchiostoma_floridae|3507        GCCATTGGGAAACCCATATCGATGGGGGCATGTCTGGAGCTGCTACCAGCTCTACAGAAG
Nematostella_vectensis|25799       CCTGAGGAACACAGTTTATCAATGGGAGCATGTTTAGAGATGTTACCTGCTTTAGAAAGA
                                                                                               

Oryzias_latipes|13051              ------------------------------------------------------------
Xenopus_tropicalis|11883           CTGCTTAAAAGTAAATTTGAAGAATATGTGATAGTTGGTCTTAACTGGCTCCAGGCAGTT
Ornithorhynchus_anatinus|3721      TTGCTTAGGAGCAAATTTGAAGAG------------------------------------
Anolis_carolinensis|7200           ATGCTTAAAAGCAAATTTGAAGAATATGTCATCGTTGGTTTAAATTGGCTCCAGGCTGTA
Gallus_gallus|16983                CTACTTAAAAGCAAATATGAAGAATATGTGATAGTTGGTCTAAACTGGCTTCAAGCTGTA
Taeniopygia_guttata|12184          CTGCTTAAAAGCAAATACGAAGAGTATGTGATAGTGGGTTTAAACTGGCTTCAGGCTGTC
Macropus_eugenii|15656             CTACTTAAAAGCAAATTTGAAGAATATGTGATAGTTGGTTTGAACTGGATTCAAGCAGTC
Erinaceus_europaeus|16291          CTACTTAAAAGCAGATTTGAAGAGTATATAATAGTTGGTTTAAACTGGCTTCAAGCAGTC
Ochotona_princeps|7101             TTACTTAAAAGCAGATTCGAAGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Callithrix_jacchus|54031           CTACTTAAAAGCACATTTGAAGAATATGTCATAGTTGGTTTAAACTGGCTTCCAGCAGTC
Felis_catus|45365                  TTACTTAAAAGCAAATTCGAAGAATATATAATAGTTGGTTTAAACTGGCTTCAAGCAGTC
Tarsius_syrichta|689               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Monodelphis_domestica|1955         CTACTTAAAAGTAAATTTGAAGAATATGTGATAGTTGGTTTGAACTGGCTTCAAGCAGTC
Tursiops_truncatus|7340            CTACTTAAAAGCAAATTTGAAGAATATATAATAGTTGGTTTAAACTGGCTTCAAGCAGTC
Spermophilus_tridecemlineatus|3816 TTACTTAAAAGCAAATTTGAAGAATATGTGATAGTTGGTTTAAACTGGCTTCAAGCTGTA
Microcebus_murinus|4135            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|23490                 TTACTTCAAAGCAGATTTGAAGAATATGTAATTGTTGGTTTAAACTGGCTTCAAGCAGTA
Rattus_norvegicus|22786            TTACTTCAAAGCAGATTTGAAGAATATGTAATTGTTGGCTTAAACTGGCTTCAAGCAGTA
Bos_taurus|17954                   ------------------------------------------------------------
Dipodomys_ordii|11129              TTACTTAAAAGCAAATTTGAAGAGTATGTAATAGTTGGTCTAAACTGGCTTCAAGCAGTA
Otolemur_garnettii|16259           CTGCTTAAAAGCAAATTTGAAGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Bos_taurus|1631                    ------------------------------------------------------------
Echinops_telfairi|1678             CTACTTAAGAGCAAATTTGAAGAGTATGTAATAGTTGGTTTAAACTGGCTTCAAGCAGTT
Procavia_capensis|6460             CTACTTAATAGCAAATTTGAAGAGTATGTAGTGGTTGGTTTAAACTGGCTTCAAGCAGTC
Sorex_araneus|8036                 CTACTTAAAAGCAGATTTGAAGAATATATAATAGTTGGTTTAAACTGGCTCCAGGCAGTT
Dasypus_novemcinctus|9698          CTACTTAAAAGCAAATTTGAAGAATATGTAATAGTTGGTTTAAACTGGCTTCAAGCAGTC
Loxodonta_africana|23740           CTACTTAAAAGCAAATTTGAAGAGTATGTAATAGTTGGCTTAAACTGGCTTCAAGCAGTC
Cavia_porcellus|1585               TTACTTAAAAGCAAATTTGAAGAATATGTAATAGTTGGTTTAAATTGGCTTCAAGCAGTA
Vicugna_pacos|11325                CTACTTAAAAGCAGATTTGAAGAATATATAATAGTTGGTTTAAACTGGCTTCAAGCAGTC
Myotis_lucifugus|1555              CTACTTAAAAGCAAATTTGAAGAATATATAATAGTTGGTTTAAACTGGCTTCAAGCAGTC
Pteropus_vampyrus|3026             CTGCTTAAAAGCAAATTTGAAGAATATATAATAGTTGGTTTAAACTGGCTTCAAGCAGTC
Equus_caballus|1807                CTACTTAAAAGCAAATTTGAAGAGTACATAATAGTTGGTTTAAACTGGCTTCAAGCAGTC
Callithrix_jacchus|29036           CTACTTAAAAGCAAATTTGAAGAATATGTTATAGTTGGTTTAAACTGGCTTCAAGCAGTC
Rhesus_macaque|33786               CTACTTAAAAGCAAATTTGAAGAATATGTTATAGTTGGTTTAAACTGGCTTCAAGCAGTC
Gorilla_gorilla|8946               CTACTTAAAAGCAAATTTGAAGAATATGTTATAGTTGGTTTAAACTGGCTTCAAGCAGTC
Homo_sapiens|28254                 CTACTTAAAAGCAAATTTGAAGAATATGTTATAGTTGGTTTAAACTGGCTTCAAGCAGTC
Pan_troglodytes|12541              CTACTTAAAAGCAAATTTGAAGAATATGTTATAGTTGGTTTAAACTGGCTTCAAGCAGTC
Pongo_abelii|9204                  CTACTTAAAAGCAAATTTGAAGAATATGTTATAGTTGGTTTAAACTGGCTTCAAGCAGTC
Canis_familiaris|18013             CTACTTAAGAGCAGATTTGAAGAATATATAATAGTTGGCTTAAACTGGCTTCAAGCAGTC
Sus_scrofa|18482                   CTACTTAAGAGCAAATTTGAAGAATACGTAATAGTTGGTTTAAACTGGCTTCAAGCAGTC
Tupaia_belangeri|1610              CTACTTAAAAGCAAATTTGAAGAATATGTAATAGTTGGTCTAAATTGGCTTCAAGCAGTC
Oryzias_latipes|14750              ------------------------------------------------------------
Danio_rerio|15372                  ATTCTTAACACTAAATATGAAGAACACCTCATCGTAGCTTTACACTGGGTTCAATCTATC
Gasterosteus_aculeatus|26685       ATTCTCGCCAGTCAATATGAAGAGAACATTATGGTTGGTTTACACTGGGTTCAATCCGTC
Tetraodon_nigroviridis|5251        ATCATCGCCGGCAAATACGAAGAACATATAAAGGTGGGTTTACACTGGGTTCAGTCCGTC
Fugu_rubripes|20508                ATCGTCGCCAGCAAATACGAAGAACACATAAAGGTGGTTCTACACTGGGTTCAGTCCGTC
Branchiostoma_floridae|3507        ATGCTTACAAGCAAGTATGAAGACTACATCTCTGGGAGTCTGGACTTGATCCGCACCATC
Nematostella_vectensis|25799       CTACTGGCATCAAAATATGAAGATTACATTGTAGCTGCTCTCAACATGATGCGAGAGATG
                                                                                               

Oryzias_latipes|13051              ------------------------------------------------------------
Xenopus_tropicalis|11883           GTAAAGAGATGGTGGACTCAGTTATCTGTAAATTCTGAGAATGCATCAGATGAA------
Ornithorhynchus_anatinus|3721      ------------------------------------------------------------
Anolis_carolinensis|7200           ATTAAGAGATGGTGGTCAGACCTCTCTGCCAATACTGAAAAGATAGAGGATGGa------
Gallus_gallus|16983                ATTAAAAGATGGTGGTCAGAACTATCTGCGCATAAAGAGAGGGCAGAGGATGGA------
Taeniopygia_guttata|12184          ATTAAAAGATGGTGGTCAGAACTATCTGCACatacagaaaaaacagaagatgga------
Macropus_eugenii|15656             ATAAAAAGATGGTGGTCAGAACTATCTGCTAATACAGAAATTGTAAAAGATGGN------
Erinaceus_europaeus|16291          ATAAAAAGGTGGTGGTCAGAACTGTCATCCAAAACAGAAATAATAAATGATGGT------
Ochotona_princeps|7101             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNA------
Callithrix_jacchus|54031           ACTAAAAGGTGGTGGTCAGGACTATCATCCAAAACAGAAATTATAAATGATGGA------
Felis_catus|45365                  ATAAAAAGGTGGTGGTCAGAACTATCATCCAAAACAGAAATTATAAATGATGGA------
Tarsius_syrichta|689               NNNNNNNNNNGGTGGTCAGAACTGTCATCCAAACCAGAAATTATAAATGATGGA------
Monodelphis_domestica|1955         ATAAAAAGATGGTGGTCAGAACTGTCTGCTAACACAGAAATTGCAAAGGATGGA------
Tursiops_truncatus|7340            ATAAAAAGGTGGTGGTCAGAACTATCATCCAAAACAGAAATTATAAATGATGGA------
Spermophilus_tridecemlineatus|3816 ATAAAAAGGTGGTGGTCAGAACTATCATCCAAAACAGAAATTATAAGTGATGGA------
Microcebus_murinus|4135            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNA------
Mus_musculus|23490                 ATAAAAAGGTGGTGGTCAGAACTCTCATCTACGTCAGAAATTATAAGTGATGGA------
Rattus_norvegicus|22786            ATAAAAAGGTGGTGGTCAGAACTCTCATCTAAATCAGAAATTATAAGTGATGGA------
Bos_taurus|17954                   ------------------------------------------------------------
Dipodomys_ordii|11129              ATAAAAAGGTGGTGGTCAGAACTGTCATCCAAAACAGACGTTATAAATGATGGA------
Otolemur_garnettii|16259           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------
Bos_taurus|1631                    ------------------------------------------------------------
Echinops_telfairi|1678             ATAAAAAGATGGTGGTCAGAATTATCATCCAAAACAGAAATTAAAAATGATGGA------
Procavia_capensis|6460             ATCAAAAGATGGTGGTCAGAATTATCATCCAAAACAGAAACTGTAAATGATGGN------
Sorex_araneus|8036                 ATAAAAAGATGGTGGTCAGAATTATCATCAAAAACAGAAATTATAAATGATGGT------
Dasypus_novemcinctus|9698          ATAAAAAGGTGGTGGTCAGAACTATCATCCAAAACAGAAATTAAAAATGATGGN------
Loxodonta_africana|23740           ATAAAAAGGTGGTGGTCAGAACTATCATCCAAAACAGAAATTATAAATGATGGA------
Cavia_porcellus|1585               ATAAAAAGGTGGTGGTCAGAGCTCTCATCCAAAACAGAAATTATAAATGATACA------
Vicugna_pacos|11325                ATAAAAAGATGGTGGTCAGAACTATCATCCAAAACAGAAATTATACATGACGGA------
Myotis_lucifugus|1555              ATAAAAAGGTGGTGGTCAGAACTCTCGTCCAAAACAGAAATTATAAATGATGGA------
Pteropus_vampyrus|3026             ATAAAAAGGTGGTGGTCAGAACTCTCATCTAAAACAGAAATTATAAATGATGGA------
Equus_caballus|1807                ATAAAAAGGTGGTGGTCAGAACTGTCATCCAAAACAGAAATTAGAAATGATGGA------
Callithrix_jacchus|29036           ATTAAAAGGTGGTGGTCAGACCTATCATCCAAAACAGAAATTATAAATGATAGA------
Rhesus_macaque|33786               ATTAAAAGGTGGTGGTCAGAACTATCATCCAAAACAGAAATTATAAGTGATGGA------
Gorilla_gorilla|8946               ATTAAAAGGTGGTGGTCAGAACTATCATCCAAAACAGAAATTATAAATGATGGA------
Homo_sapiens|28254                 ATTAAAAGGTGGTGGTCAGAACTATCATCCAAAACAGAAATTATAAATGATGGA------
Pan_troglodytes|12541              ATTAAAAGGTGGTGGTCAGAACTATCATCCAAAACAGAAATTATAAATGATGGA------
Pongo_abelii|9204                  ATTAAAAGGTGGTGGTCAGAACTATCATCCAAAACAGAAATTATAAATGATGGA------
Canis_familiaris|18013             ATAAAAAGGTGGTGGTCAGAACTATCATCCAAAACAGAAATTATAAATGATGGA------
Sus_scrofa|18482                   ATTAAAAGGTGGTGGTCAGAACTATCATCCAAGACAGAAATTATAAATGATGGA------
Tupaia_belangeri|1610              ATTAAAAGATGGTGGTCAGAACTATCATCCAAAACAGAAATTATAAATGATGGA------
Oryzias_latipes|14750              ------------------------------------------------------------
Danio_rerio|15372                  ATTAAGAAATGGTGGTCTGAGCTCTCCACAAACAACAAAAGTTTGCCCGAGAGCAGTTCA
Gasterosteus_aculeatus|26685       ATTAGGAAATGGTGGCCAGAACTTTCTAAGAATGAGAAAAGACTGCGGGACAGTTGTTCA
Tetraodon_nigroviridis|5251        ATCAGGAAATGGTGGCCAGAACTTTCTAGGAAGGAGAGAAGACTGCAGGACAGTCGTTCA
Fugu_rubripes|20508                ATCAGGAAATGGTGGCCAGAACTTTCTAGGAAGGAAAGAAGACTGCAGGACGGTCGTTCA
Branchiostoma_floridae|3507        CTGAAACACTGGTGGAAGGACCTGAAGTCACTGCAGGCTTCCCAGCAAAACCTG------
Nematostella_vectensis|25799       ATCAAAAGATGGTGGAATCAGCTAAAGGCGGCTTCAAGTAAAGACACTGACCCA------
                                                                                               

Oryzias_latipes|13051              ------------------------------------------------------------
Xenopus_tropicalis|11883           ---------AACATCCTGGTTTTAAAACGCCAAATAAGTGGAATGTGGCAGCAAGAAAAT
Ornithorhynchus_anatinus|3721      ------------------------------------------------------------
Anolis_carolinensis|7200           ---------aatattcaaattttaaaagaaCAGTTAAGTGGATTGTGGAAACAAGAAAAT
Gallus_gallus|16983                ---------AATATGATTATTTTAAAACAACAATTAAGTGAATTATGGGAACAAGAACAT
Taeniopygia_guttata|12184          ---------aacattcatattttaaagcaacagCTAAGTATTTTGTGGGAACAGGAGAAT
Macropus_eugenii|15656             ---------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Erinaceus_europaeus|16291          ---------AATATTCAGATTTTAAAACAACAATTAAGTGGATTGTGGGAACAGGAGAGT
Ochotona_princeps|7101             ---------AATATTCAAATTTTGAAACAACAATTAAGTGGATTATGGGAACAGGAAAAC
Callithrix_jacchus|54031           ---------AATACGCAGATTTTAAAACACCAATTAAATGGATTATGGGACCAGGAAAGC
Felis_catus|45365                  ---------AATATTCAGATTTTAAAGCAGCAATTAAGCGGATTATGGGAACAGGAAAAT
Tarsius_syrichta|689               ---------AATATTCAGATTTTAAAACAACAATTAAGTGGATTGTGGGAACAGGAAAAT
Monodelphis_domestica|1955         ---------AACATTCATATTTTAAAACAACAGTTAAGTGGATTGTGGAAGCAAGAAAAC
Tursiops_truncatus|7340            ---------AATATTCAGATTTTAAAACAACAATTAAGTGGATTGTGGGAACAGGAAAAC
Spermophilus_tridecemlineatus|3816 ---------AATATTCAGATTTTAAAACAACAATTAAGTGGCTTGTGGGAACAAGAAAAC
Microcebus_murinus|4135            ---------AATATTCAGATTTTAAAACAACAATTAAGTGGATTATGGGAACAGGAAAAC
Mus_musculus|23490                 ---------AATATTAAGATTTTAAAGCAACAGTTGAGTGGACTATGGGAACAGGAAAGC
Rattus_norvegicus|22786            ---------AATATTAAGATTTTAAAGCAACAGTTGAATGGATTATGGGAACAGGAAAAC
Bos_taurus|17954                   ------------------------------------------------------------
Dipodomys_ordii|11129              ---------AATATTAAGATTTTAAAACAACAATTAAGTGGATTGTGGGAACAGGAAAAC
Otolemur_garnettii|16259           ---------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Bos_taurus|1631                    ------------------------------------------------------------
Echinops_telfairi|1678             ---------AATATTCAGATTTTAAAACAACAGTTAAGTGGGTTATGGGAACAGGAAAAC
Procavia_capensis|6460             ---------AATATTCAGATTTTAAAACAACAGTTAAATGGATTGTGGGAACAAGAAAAC
Sorex_araneus|8036                 ---------AATATTCAGATTTTAAAACAACAGTTAAGTGGATTGTGGGAACAGGAAAAC
Dasypus_novemcinctus|9698          ---------NNNNNTCAGATTTTAAAACAACAATTAAGTGGATTGTGGGATCAGGAAAAC
Loxodonta_africana|23740           ---------AATATTCAGATTCTAAAACAACAGTTAAATGGATTGTGGGAACAAGAAAAC
Cavia_porcellus|1585               ---------AATATCCAGATTTTAAAACAACAATTAAGTAGATTATGGGAGCAGGCAAAC
Vicugna_pacos|11325                ---------AATATTCAGATTTTAAAACAACAATTAAGTGGATTGTGGGAACAGGAAAAC
Myotis_lucifugus|1555              ---------AATATTCAGATTTTAAAACAACAATTAAGCAGATTGTGGGAACAAGAAAAC
Pteropus_vampyrus|3026             ---------AATATTCAGATTTTAAAACAACAATTAAGTGGATTGTGGGAACAAGAAAAC
Equus_caballus|1807                ---------AATATTCAGATTTTAAAACAACAGTTAAGTGGATTGTGGGAACAGGAACAC
Callithrix_jacchus|29036           ---------AATATTCAGATTTTAAAACAACAATTAAGTGGATTATGGGAACAGGAAAAC
Rhesus_macaque|33786               ---------AATATAAAAATTTTAAAACAACAATTAAGTGGATTATGGGAACAGGAAAAC
Gorilla_gorilla|8946               ---------AATATTCAAATTTTAAAACAACAATTAAGTGGATTATGGGAACAGGAAAAC
Homo_sapiens|28254                 ---------AATATTCAAATTTTAAAACAACAATTAAGTGGATTATGGGAACAGGAAAAC
Pan_troglodytes|12541              ---------AATATTCAAATTTTAAAACAACAATTAAGTGGATTATGGGAACAGGAAAAC
Pongo_abelii|9204                  ---------AATATTCAAATTTTAAAACAACAATTAAGTGGATTATGGGAACAGGAAAAC
Canis_familiaris|18013             ---------AATATTCAGATTTTAAAACAACAATTAAGTGGATTATGGGAACAGGAAAAC
Sus_scrofa|18482                   ---------AATATTCAGATTTTAAAACAACAATTAAGTGGATTATGGGAACAGGAAAAC
Tupaia_belangeri|1610              ---------AATATTCAGATTTTAAAACAACAATTAAGTGGATTGTGGGAACAGGAAAAT
Oryzias_latipes|14750              ------------------------------------------------------------
Danio_rerio|15372                  AACGACAGGAATGTTCAGGCAATGAAGACAATGCTGCTTGAACTGTGGCAAGGAAAGAGT
Gasterosteus_aculeatus|26685       GAAGACAGGAATCTTGAAGTCATGAAGCTGAGGCTGAAGGACTTGTGGAAGGAAGGGGCC
Tetraodon_nigroviridis|5251        GAAGACAGAAATATCGAAGCGATGAAACAACGGCTAAAGGAGTTATGGAAGGAAGGAACC
Fugu_rubripes|20508                GAAGACAGGAATATTGAAGTCATGAAACAACGGCTGAAGGACTTATGGAAGGAAGGATCC
Branchiostoma_floridae|3507        ---------AGACTTGGACTCAGGAGCAGGAGTGTCAATGGGGTGTACACTAGTATAGTG
Nematostella_vectensis|25799       ---------GAGCATTTCCGATACAGCCGCAGTGTCAATGGACTCTACATGGCCATGGTA
                                                                                               

Oryzias_latipes|13051              ------------------------------------------------------------
Xenopus_tropicalis|11883           CACCTTACATCAGTC---------------------CCAGGCTATACAGGCAACATAGCC
Ornithorhynchus_anatinus|3721      ------------------------------------------------------------
Anolis_carolinensis|7200           CATCTTACTTTGGTT---------------------CCAGGATATACGGGTAATATAGCA
Gallus_gallus|16983                CATCTTACTCTGGTT---------------------CCAGGATATACTGGTAATATAGCA
Taeniopygia_guttata|12184          CATCTTACTCTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Macropus_eugenii|15656             NNNNNNNNNNNNNNN---------------------NNNNNNNNNNNNNNNNNNNNNNNN
Erinaceus_europaeus|16291          CATCTAACTTTGGCT---------------------CCAGGATATACTGGTAATATAGCT
Ochotona_princeps|7101             CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Callithrix_jacchus|54031           CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Felis_catus|45365                  CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAACATAGCC
Tarsius_syrichta|689               CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Monodelphis_domestica|1955         CATCTTACTTCTGTT---------------------CCAGGATATACTGGTAATATAGCT
Tursiops_truncatus|7340            CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCC
Spermophilus_tridecemlineatus|3816 CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Microcebus_murinus|4135            CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Mus_musculus|23490                 CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Rattus_norvegicus|22786            CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Bos_taurus|17954                   ------------------------------------------------------------
Dipodomys_ordii|11129              CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Otolemur_garnettii|16259           NNNNNNNNNNNNNNN---------------------NNNNNNNNNNNNNNNNNNNNNNNN
Bos_taurus|1631                    ------------------------------------------------------------
Echinops_telfairi|1678             CATCTGACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Procavia_capensis|6460             CATCTTACTTTGGTT---------------------CCAGGATACACTGGTAATATAGCT
Sorex_araneus|8036                 CATCTCACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Dasypus_novemcinctus|9698          CATCTTACTTTGGTT---------------------CCAGGATATACCGGCAATATAGCT
Loxodonta_africana|23740           CATCTTACTTTGGTT---------------------CCAGGATACACTGGTAATATAGCT
Cavia_porcellus|1585               CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAACATAGCT
Vicugna_pacos|11325                CATCTTACTTTGGTT---------------------CCGGGATATACTGGTAATATAGCC
Myotis_lucifugus|1555              CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Pteropus_vampyrus|3026             CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Equus_caballus|1807                CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Callithrix_jacchus|29036           CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Rhesus_macaque|33786               CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Gorilla_gorilla|8946               CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Homo_sapiens|28254                 CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Pan_troglodytes|12541              CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Pongo_abelii|9204                  CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAATATAGCT
Canis_familiaris|18013             CATCTTACTTTGGTT---------------------CCAGGATACACTGGTAATATAGCC
Sus_scrofa|18482                   CATCTTACTTTGGTT---------------------CCGGGATATACTGGTAATATAGCC
Tupaia_belangeri|1610              CATCTTACTTTGGTT---------------------CCAGGATATACTGGTAATATTGCT
Oryzias_latipes|14750              ------------------------------------------------------------
Danio_rerio|15372                  CACTTAAGCTCAGTT---------------------CCAGGAACTGTAGGAGAAACTGCA
Gasterosteus_aculeatus|26685       CGGTTATGTGGGGTT---------------------CCAGGATCTACGGGAGAACTGGCA
Tetraodon_nigroviridis|5251        CACATATGTTCAGTC---------------------CCAGGTCCTACAGGAGAACAGGCA
Fugu_rubripes|20508                CGCATCTGTTCGCTC---------------------CCGGGACCTACAGGAGAACAGGCA
Branchiostoma_floridae|3507        GCTATGACTGACACTTTGCAGAAGATAGCCAAAAGGCCTGGCAATATTGGACAGAAGGCT
Nematostella_vectensis|25799       TCTATATCAGCCATTGTCGCCAGGCTCAAGAAACGTAGAGGAATTGTAGGGCAGAAAGCA
                                                                                               

Oryzias_latipes|13051              ------------------------------------------------------------
Xenopus_tropicalis|11883           AAGGATCTAGATGGATACTTATCACAGCTCCGT---------------------------
Ornithorhynchus_anatinus|3721      ------------------------------------------------------------
Anolis_carolinensis|7200           AAGGATGTGGATGCTTATTTATTACAGCTGCAC---------------------------
Gallus_gallus|16983                AAGGAAGTAAATGCTTATTTATTACAACTATGC---------------------------
Taeniopygia_guttata|12184          AAGgaTGTAAATGCTTATTTATTGCAGCTACAC---------------------------
Macropus_eugenii|15656             NNNGATGTAGATGCTTATTTATTACAATTACAT---------------------------
Erinaceus_europaeus|16291          AAGGATGTGGATGCTTATTTATTACAATTGCAT---------------------------
Ochotona_princeps|7101             AAGGATGTAGATGCTTATTTATTACAGTTGCAT---------------------------
Callithrix_jacchus|54031           AAGGACGTAGATGCTTATTTATTCCAG---------------------------------
Felis_catus|45365                  AAG---------------------------------------------------------
Tarsius_syrichta|689               AAGGATGTAGATGCTTATTTATTACAGTTGCAT---------------------------
Monodelphis_domestica|1955         AAGGACGTAGATGCTTATTTATTACAATTACAT---------------------------
Tursiops_truncatus|7340            AAGGATGTAGATGCTTATTTATTACAGTTGCAT---------------------------
Spermophilus_tridecemlineatus|3816 AAG---------------------------------------------------------
Microcebus_murinus|4135            AAGGATGTAGATGCTTATTTATTACAGTTGCAT---------------------------
Mus_musculus|23490                 AAGGATGTAGATGCTTATTTATTACAGCTGCAT---------------------------
Rattus_norvegicus|22786            AAGGACGTAGATGCTTATTTATTACAGCTGCAT---------------------------
Bos_taurus|17954                   ------------------------------------------------------------
Dipodomys_ordii|11129              AAGGATGTAGATGCTTATTTATTACAGTTGCAT---------------------------
Otolemur_garnettii|16259           NNNGATATAGGTAATATATTATTGCAT---------------------------------
Bos_taurus|1631                    ------------------------------------------------------------
Echinops_telfairi|1678             AAGAATGTAGATGCTTATTTATTACAA---CAT---------------------------
Procavia_capensis|6460             AAG---------------------------------------------------------
Sorex_araneus|8036                 AAGGATGTAGATGCTTATTTATTACAGTTGCAT---------------------------
Dasypus_novemcinctus|9698          AAGGATGTAGATGCTTATTTATTACAGTTGCAT---------------------------
Loxodonta_africana|23740           AAGGATGTAGATGCTTATTTATTACAATTGCAT---------------------------
Cavia_porcellus|1585               AAGGATGTAGATGCTTATTTATTGCAGTTGCAT---------------------------
Vicugna_pacos|11325                AAGGATGTAGATGCTTATTTATTACAGCTGCAT---------------------------
Myotis_lucifugus|1555              AAGGATGTAGATGCTTATTTATTACAGTTGCAT---------------------------
Pteropus_vampyrus|3026             AAGGATGTAGATGCTTATTTATTACAGTTGCAT---------------------------
Equus_caballus|1807                AAGGATGTAGATGCTTATTTATTACAGTTGCAT---------------------------
Callithrix_jacchus|29036           AAGGATGTAGATGCTTATTTATTACAGTTACAT---------------------------
Rhesus_macaque|33786               AAGGATGTAGATGCTTATTTATTACAGTTACAT---------------------------
Gorilla_gorilla|8946               AAGGATGTAGATGCTTATTTATTACAGTTACAT---------------------------
Homo_sapiens|28254                 AAGGATGTAGATGCTTATTTATTACAGTTACAT---------------------------
Pan_troglodytes|12541              AAGGATGTAGATGCTTATTTATTACAGTTACAT---------------------------
Pongo_abelii|9204                  AAGGATGTAGATGCATATTTATTACAGTTACAT---------------------------
Canis_familiaris|18013             AAGGATGTAGACGCTTATTTATTACAGTTGCAT---------------------------
Sus_scrofa|18482                   AAGGATGTAGATGCTTATTTATTACAGTTGCAT---------------------------
Tupaia_belangeri|1610              AAGGATGTAGATGCCTATTTATTACAGTTGCAT---------------------------
Oryzias_latipes|14750              ------------------------------------------------------------
Danio_rerio|15372                  AAGGTCATCGAATCATATGTGTCACAACTGCGC---------------------------
Gasterosteus_aculeatus|26685       AAGACCATCGAGTCTTATCTATCGCAGCTGCCC---------------------------
Tetraodon_nigroviridis|5251        AAGGCTATCGAGGCGTCTCTGTCGCAGCTGCCC---------------------------
Fugu_rubripes|20508                AAGGTATTAAACGGATTAACACTGTCATTACAG---------------------------
Branchiostoma_floridae|3507        CAGTGCCTCATGGCTAGTCTGCCCGTCAAACGTAATGGACATTTCCCAGTAGAAAAACCC
Nematostella_vectensis|25799       CAGATTGTGTCAAGACTATTGGACTTGTTG------------------------------
                                                                                               

Oryzias_latipes|13051              ---------------------------------------------------
Xenopus_tropicalis|11883           ------------------------------------------------TGA
Ornithorhynchus_anatinus|3721      ------------------------------------------------TGA
Anolis_carolinensis|7200           ------------------------------------------------TGA
Gallus_gallus|16983                ------------------------------------------------TGA
Taeniopygia_guttata|12184          ------------------------------------------------TGA
Macropus_eugenii|15656             ------------------------------------------------TGA
Erinaceus_europaeus|16291          ------------------------------------------------TGA
Ochotona_princeps|7101             ------------------------------------------------TGA
Callithrix_jacchus|54031           ------------------------------------------------TAA
Felis_catus|45365                  ---------------------------------------------------
Tarsius_syrichta|689               ------------------------------------------------TGA
Monodelphis_domestica|1955         ---------------------------------------------------
Tursiops_truncatus|7340            ------------------------------------------------TGA
Spermophilus_tridecemlineatus|3816 ---------------------------------------------------
Microcebus_murinus|4135            ------------------------------------------------TGA
Mus_musculus|23490                 ------------------------------------------------TGA
Rattus_norvegicus|22786            ------------------------------------------------TGA
Bos_taurus|17954                   ---------------------------------------------------
Dipodomys_ordii|11129              ------------------------------------------------TGA
Otolemur_garnettii|16259           ------------------------------------------------TGA
Bos_taurus|1631                    ---------------------------------------------------
Echinops_telfairi|1678             ------------------------------------------------TGA
Procavia_capensis|6460             ---------------------------------------------------
Sorex_araneus|8036                 ------------------------------------------------TGA
Dasypus_novemcinctus|9698          ------------------------------------------------TGA
Loxodonta_africana|23740           ------------------------------------------------TGA
Cavia_porcellus|1585               ---------------------------------------------------
Vicugna_pacos|11325                ------------------------------------------------TGA
Myotis_lucifugus|1555              ------------------------------------------------TGA
Pteropus_vampyrus|3026             ------------------------------------------------TGA
Equus_caballus|1807                ------------------------------------------------TGA
Callithrix_jacchus|29036           ------------------------------------------------TGA
Rhesus_macaque|33786               ------------------------------------------------TGA
Gorilla_gorilla|8946               ------------------------------------------------TGA
Homo_sapiens|28254                 ------------------------------------------------TGA
Pan_troglodytes|12541              ------------------------------------------------TGA
Pongo_abelii|9204                  ------------------------------------------------TGA
Canis_familiaris|18013             ------------------------------------------------TGA
Sus_scrofa|18482                   ------------------------------------------------TGA
Tupaia_belangeri|1610              ------------------------------------------------TGA
Oryzias_latipes|14750              ---------------------------------------------------
Danio_rerio|15372                  ------------------------------------------------TGA
Gasterosteus_aculeatus|26685       ------------------------------------------------TGA
Tetraodon_nigroviridis|5251        ------------------------------------------------TGA
Fugu_rubripes|20508                ------------------------------------------------TAA
Branchiostoma_floridae|3507        AGCACAGGTAAGTGCCGCAACAAGGGTGCCGTACATAACAACGGTCAGTAA
Nematostella_vectensis|25799       ------------------------------------------------TAA
                                                                                      

multiple sequence alignment in CLUSTALW format


Oryzias_latipes|20261              MDSDSEERNSHGL-----DHP-VSWHKPQDKGSFGTTTKQSKSDSNEEF--YKKRYPISR
Xenopus_tropicalis|20033           MASGAHLTKKRD----LDESSSNDFPRKRISPSAKQNMKEGNNKSQEELVSDRNRTQIEQ
Ornithorhynchus_anatinus|1922      MASEPHHDWKRNPLQD------DHLLRKRASRFPRKIMKEGK-RAPKQLASYTHR-PAGR
Anolis_carolinensis|14843          --------------------------------------------------------TVGQ
Gallus_gallus|13081                MASEAHNAKKQKVLH-IEGRP-VDLPRKAISSSTKKIMKEDK-KAPKQLASYTNRITVGK
Taeniopygia_guttata|15474          MASEAHNAKKQKVLL-IEGHP-IDLPRKRISSSTKKIMKEGK-KSPKQLASYTNRVTVGK
Macropus_eugenii|14257             ------------------------------------------------------------
Erinaceus_europaeus|13392          MASDTHDDEKRNFTN--EDQF-IDLPRKKISNFTNKNMKEXX-XXXXXXXXXXXX-XXXX
Ochotona_princeps|6183             --------------------------------------------------------TVGQ
Callithrix_jacchus|44982           MASETHNVKKRNFRNKIEDHF-IDLTRKKICDFTNKNMKEVK-KSPKQLAAYINR-TVGQ
Felis_catus|11429                  MATEAHNVKKRTFCNNIEDHS-TDLPRKRISNFTNKNMKEXX-XXXXXXXXXXXX-XXXX
Tarsius_syrichta|635               MASETHNVKKRNFCNNIEDHS-IDLPRKKISNFTKKNMKEXX-XXXXXXXXXXXX-TVGQ
Monodelphis_domestica|15477        ----AHNDRKRNLLY-IEGHS-IDLPRKRISHFTNKNMKEGK-KSPKQLAAYTNR-TVGY
Tursiops_truncatus|6924            MASETHNVKKRNFCNNIEDHF-IDVPRKRVSNFTNKNMKEVK-KSPKQLAAYITR-TVGQ
Spermophilus_tridecemlineatus|3420 MASETHNVKKRNFSNNIEDHS-IDLPRKKISNFTNKNMKEVK-KSPKQLAAYINX-XXXX
Microcebus_murinus|3515            MASETHNVKKRNFCDNIEDHS-TDLPRKRISNFTNKNMKEVK-KSPKQLAAYKNR-TVGQ
Mus_musculus|6626                  MAFDTHHVKKRNFSNS------IDLPRKRISNFTSKNMKEVK-RSPKQLAAYISR-TVAQ
Rattus_norvegicus|14529            MAFDTHHVKKRNFSNS------IDLPRKRISNFTSKNMKEVK-ISPKQLAAYISR-TVGQ
Bos_taurus|7790                    MASETHNVKKRNFCNHTEDHS-IDLPRKRISNFTNKNMKEEE------------------
Dipodomys_ordii|10456              ----------------------------------------VK-KSPKQLAAYINR-TVGK
Otolemur_garnettii|14002           ----------------------------------------VK-KSPKQLAAYINR-TVGQ
Bos_taurus|15902                   MASETHNVKKRNFCNHTEDHS-IDLPRKRISNFTNKNMKEV-------------------
Echinops_telfairi|1321             MASETHNVKKRNLCNNTEDHSKXXXXXXXXXXXXXXXXXXVK-KSPKQLAAYINR-TVGL
Procavia_capensis|6063             MASKTHNVKKR-FCNKIEDHS-LDLXXXXXXXXXXXXXXXVK-KSPKQLAAYINR-TVGQ
Sorex_araneus|7141                 MASETHNVKKRNFCYDIEDHS-IDLPRKRISNFTSKNMKEVK-KSPKQLAAYINR-TVGQ
Dasypus_novemcinctus|8567          MASETHNVKKRNFCNNIEDHS-VDLPRKRISNFTIKNMKEVK-KSRKQLAAYINR-TVGQ
Loxodonta_africana|792             MASETHNVKKRNFCNNIEDHF-LDLPRKRNSNFTKKNMKEVK-KSPKQLAAYKNR-TVGQ
Cavia_porcellus|1226               MASENHNVKKRNFCNNIEDHS-IDLPRKRISNFTNKNMKEVK-RSPKQLAAYINR-TVGQ
Vicugna_pacos|10527                MASETHNVKKRNFCDNIEDHS-TDLPRKRISNFTNKNMKEXX-XXXXXXXXXXXX-TVGQ
Myotis_lucifugus|1405              MASETHNVKKRNFYNNIEDHS-IDRPRKRISNFTNKNMKEVK-KSPKQLAAYINR-TVGH
Pteropus_vampyrus|2855             MASETHNVKKRNFCNNIEDHP-IDLPRKRISNFTNKNMKEVK-KSPKQLAAYINR-TVGQ
Equus_caballus|20890               MASETHNVKKRNFCNNIEDHY-IDLPRKRISKFTNKNMKEVK-KSPKQLAAYINR-TVGQ
Callithrix_jacchus|21039           MASETHNVKKRNFYNKIEDHF-IDLPRKKISNFTNKNMKEVK-KSPKQLAAYINR-TVGQ
Rhesus_macaque|27299               MASETHNVKKRNFCNKIEDHF-IDLPRKKISNFTNKNMKEVK-KSPKQLAAYINR-TVGQ
Gorilla_gorilla|7692               MASETHNVKKRNFCNKIEDHF-IDLPRKKISNFTNKNMKE-------QLAAYINR-TVGQ
Homo_sapiens|56957                 MASETHNVKKRNFCNKIEDHF-IDLPRKKISNFTNKNMKEVK-KSPKQLAAYINR-TVGQ
Pan_troglodytes|2459               MASETHNVKKRNFCNKIEDHF-IDLPRKKISNFTNKNMKEVK-KSPKQLAAYINR-TVGQ
Pongo_abelii|8124                  MALETHNVKKRNFCNKIEDHF-IDLPRKKISNFTNKNMKEVK-KSPKQLAAYINR-TVGQ
Canis_familiaris|5036              MASEAHNVKKRTFCNNIEDHS-TDLPRKRISNFTNKNMKEIK-KSPKQLAAYKNR-TVGQ
Sus_scrofa|2435                    MASETHNVKKCNSCNNIEDHS-IDLPRKRISNFTNKNMKEVK-KSPKQLAAYITR-TVGQ
Tupaia_belangeri|1401              --------------------------------------------------------TVGQ
Oryzias_latipes|21518              MAAGELRGQSHHITP-------DGFQRLCTRLSTDHIMKQVE-VCHQEDL-DKDRFQVHH
Danio_rerio|13312                  MATGSHVGSNAEVHRLKQAQP-HDLLKRMLCSGDEKNMREVD--YLLKDETDQERFPVGR
Gasterosteus_aculeatus|10060       -------------------------------------MKEVD-IINKEEL-DKERFQVHY
Tetraodon_nigroviridis|2478        ------------------------------------NMKQVD-IINKEEL-DKERFQVHY
Fugu_rubripes|46381                ------------------------------------NMKQVD-IINKEEL-DKERFQVHY
Branchiostoma_floridae|19685       MAAVPGHGGRIQWDFVKRKYVWVNENEPKPKEGHEQPKKKVTPYGEDQVQAMLKRRAMNL
Nematostella_vectensis|25874       ----MAALKKRSVEENVGHFY-YDWAQAKYK------------WTAEDVKKNQNN-KVNL
                                                                                               

Oryzias_latipes|20261              SGNNPGRV-KR--VVSCKRKTHHLT------VVRRKQHASERTFEAAN--KENNMAVLQD
Xenopus_tropicalis|20033           SLHSNENH-FK--VVYCKRKAHYQT---LSPTYKKKQLPKAWGCDMAN--KENELA-AGN
Ornithorhynchus_anatinus|1922      AVRSPNKA-PK--AGSHRRGRRH-F---PSPRSRKAASPGGGSLVMAN--KENELACAGP
Anolis_carolinensis|14843          TVISPHPL-FK--VVYCRRKVHYYS---PKPSFRKKPLSKVKSRDMAN--KENELACAGN
Gallus_gallus|13081                TVTSPLSL-FK--AVHCKRKVHCYT---AKPCYKRKQFPKSRGCNMAN--KENELACAGN
Taeniopygia_guttata|15474          TVTSPLSL-FK--VVYCKRKVHCYT---PKPCYRKKLSPKSRGRDMAN--KENELACAGN
Macropus_eugenii|14257             ------------------------------------------------------------
Erinaceus_europaeus|13392          XXXXXXXX-XX--XXXXXXXXXXXX---XXXXXXXXXXXXXXXXXXXX--XXXXXXXXXX
Ochotona_princeps|6183             AVKNPDKL-RK--VIYRRKKVHHPF---PDPCYRKKQSPSSGGCDMAN--KENELACAGH
Callithrix_jacchus|44982           TVKRPDKL-CK--VIYPRK------------------VPGSGGCNMAN--KENELACAGH
Felis_catus|11429                  XXXXXXXX-XX--XXXXXXXXXXXX---XXXXXXXXXXXXXXXXXXXX--XXXXXXXXXX
Tarsius_syrichta|635               AVKSPDKL-RK--VIYLRKKVHHSF---PNPCYRKKQSPRSGGWDMA---KKNELACA-H
Monodelphis_domestica|15477        TVKSPDKL-HK--EVYYRKKVHHYF---PNPCYRRKHFPRSRGCDMAN--KENELACAGH
Tursiops_truncatus|6924            AVKSPDKL-RK--VIYHRKKVHHPF---QNPCYRKKQSPNSGGCDMAN--KENELACAGR
Spermophilus_tridecemlineatus|3420 XXXXXXXX-XX--XXXXXXXXXXXX---XXXXXXXXXXXXXXXXXXXX--XXXXXXXXXX
Microcebus_murinus|3515            AVKSPD-L-HK--VIYHRKKVHHLF---PNPCYRKKQSPRSGGCDMAN--KENELACAGH
Mus_musculus|6626                  AVKSPEKL-RK--VLYHRKLVRRSF---PNPCYKTKQSPKSGGCDMAN--KENELACAGH
Rattus_norvegicus|14529            AVKSPDKL-RK--VLYHRKLVRHSF---PNPCYKTKQSPRSGGCDMAN--KENELACAGH
Bos_taurus|7790                    ------------------------------------------------------------
Dipodomys_ordii|10456              AVKSPDKL-RK--VIYHRKKVYHPF---PNPCYRRRQSLPSGGCDMAN--KENELACTGH
Otolemur_garnettii|14002           AVKNPDKL-HK--VIYHRKKVRHSF---PSPCYRKKQSPQSGGCDMAN--KENELACAGH
Bos_taurus|15902                   ------------------------------------------------------------
Echinops_telfairi|1321             AVKSPDKL-RK--AIYFRKKVHRPL---PSPCYRKKQAPRSGGCVMAN--KENELACAGH
Procavia_capensis|6063             AVKTPDKL-RK--VIYCRKKVQRPF---PNPCYRKKQSPKSGGCVMAN--KENELACAGH
Sorex_araneus|7141                 AVKSPDKL-LK--VIYRRKKIHHPF---PHPCDRKKQSPKSGDCDMAN--KENELACAGH
Dasypus_novemcinctus|8567          AVKSTDKL-YK--VIYRRKKVHHPS---PNPYYRRKQSPRSGGCDMAN--KENEVACASH
Loxodonta_africana|792             TVKTPDKL-RK--VIYCRKKVQRPF---PNPCYRKKQSPKSGGCVMAN--KENELACAGH
Cavia_porcellus|1226               AVKSPGIL-HK--VINRRKKVHHPF---PNPCYRKKESPRSGGCDMAN--KENELACAGH
Vicugna_pacos|10527                AVKSPDKL-RK--VIYRRKKIHHPF---PNPCYRKKQSPTSGGCDMAN--KENELACAGH
Myotis_lucifugus|1405              AVKSPDKL-RK--VIYHRKKVHYPF---PNSCFKKKQSPRSGGCDMAN--KENELACAGH
Pteropus_vampyrus|2855             AVKSPDKL-RK--VIYHRKKVHHPF---SNPCYKKKQSPRSGGCDMAN--KENELACAGH
Equus_caballus|20890               AVKSPDKL-RK--VIYHRKKVHHSS---PNTCYRKKQSPRSGGCDMAN--KENELACAGH
Callithrix_jacchus|21039           TVKSPDKL-RK--VIYRRKKVHHPF---PSPCYRKKQSPGSGGCDMAN--KENELACAGH
Rhesus_macaque|27299               TLKSPDKL-RK--VIYRRKKVHHPF---PNPCYRKKQSPGSGGCDMAN--KENELACASH
Gorilla_gorilla|7692               TVKSPDKL-RK--VIYRRKKVHHPF---PNPCYRKKQSPGSRGCDMAN--KENELACAGH
Homo_sapiens|56957                 TVKSPDKL-RK--VIYRRKKVHHPF---PNPCYRKKQSPGSGGCDMAN--KENELACAGH
Pan_troglodytes|2459               TVKSPDKL-RK--VIYRRKKVHHPF---PNPCYRKKQSPGSGGCDMAN--KENELACAGH
Pongo_abelii|8124                  TVKSPDKL-RK--VIYRRKKVHHPF---PNPCYRKKQSPGSGGCDMAN--KENELACAGH
Canis_familiaris|5036              AVKSPDKL-RK--VIYRRKKVHHPF---PNPCYRKKQSPRSGGCDMAN--KENELACAGH
Sus_scrofa|2435                    AVKSPDKL-RK--VIYRRKKVHHPF---PNPCYRRKQSPRSGGCDMAN--KENELACAGH
Tupaia_belangeri|1401              AVRSPDKL-RK--VIYHRKKVHHSF---PNPCYRKKQSPRSGGCDMAN--KENELACAGH
Oryzias_latipes|21518              RVQNPGKA-KR--PSSYKRRSCAPVEAGVKLQRRSSDAGRYREPGMANREKENELTC---
Danio_rerio|13312                  CVHKYSKT-KREGVGKKKTRLSGVG---PRAC--RKLPTTSRTSDMAN--KENELTCVDE
Gasterosteus_aculeatus|10060       GVQSPAKT-KR--LSSCKRKGGPLVEVGLKLHRRTSDVGRVPKPGMAN--KENELTCTDD
Tetraodon_nigroviridis|2478        SVHSPGKA-KR--ASSVKRKGCPVVEVGSKLHRRTSNADRAHDCGMAN--KENELTCSDD
Fugu_rubripes|46381                RVPSPAKAKKR--VSSVKRKGCPVVEGGSKLHRQASDVGRAHDCSMAN--KENELTCSDD
Branchiostoma_floridae|19685       QLQGRQNQVKQPPVFQMPGKKGCKK---PTPSKRKKSKSPSPPRAVV---KQPRVEAMDW
Nematostella_vectensis|25874       NDHFPNEN-AK--VQAKKNFVCAPV---AEEILSKGFKEDDPKKPLQN--RDINQPISDE
                                                                                               

Oryzias_latipes|20261              AQQEMFHWDSLEHSQNINNNHKTSLTGSEHTGYSLFTELSKDHKTMVDVLFGRHLRLKVA
Xenopus_tropicalis|20033           LHDKLQN-DRRSFALNSSDSSSSHTEGPSNKYSSFFAEVSKDHETMEQVLFSRNLRLNVA
Ornithorhynchus_anatinus|1922      LADKLRQ-DGRAPGLGPSDSSVAQTESPSSKYSSFFSEV-------------RPPRAPPL
Anolis_carolinensis|14843          LPAKLPA-DGRTFLLNSSDSGRAQAESPSSKYSGFFSEVSEDHETMAQVLFSRNLRLNVA
Gallus_gallus|13081                LPAKL-N-DSRTHLLNSSDSGSSQTEGPSSKYSAFFSEVSQDHETMAQVLFSRNLRLNVA
Taeniopygia_guttata|15474          LPAKL-H-CSRTHLLNSSDSGSSQTEGPSSKYSAFFSEVSQDHETMAQVLFSRNLRLNVA
Macropus_eugenii|14257             --------------------------------------VSQDHETMAQVLFSRNLRLNVA
Erinaceus_europaeus|13392          XXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSQDHETMTQVLFSRNLRLNVA
Ochotona_princeps|6183             LPEKLRH-DSRTYLINSSDSGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNLRLNVA
Callithrix_jacchus|44982           RAEKLHQ-DSRTYLVNSSDSGSSPRESLSLKHSRFFPEVSQDHETMAQVLFSRNLRLNVA
Felis_catus|11429                  XXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tarsius_syrichta|635               LPEKLRH-DSRTYLLNSSDSGSSQTESPSSKYSGFFSEVSQDHGTMAQVLFSRNLRLNVA
Monodelphis_domestica|15477        LPEKLRH-DGRTFLLNASDSSSSQTESPSSKYSGFFTEVSQDHETMAQVLFSRNLRLNVA
Tursiops_truncatus|6924            LPEQVRQ-GSRPYLVSPSDSGSSQTESPSSKYSGFFSEXXXXXXXXXXXXFSRNLR-NVA
Spermophilus_tridecemlineatus|3420 XXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Microcebus_murinus|3515            LPEKLRH-DSRTYLINSSDSSSSQTESPSSKYSGFFSEXXXXXXXXXXXXXXXXXXXXXX
Mus_musculus|6626                  LPENLRH-DSRTFVINTSDSGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNLRLNVA
Rattus_norvegicus|14529            LPENLHH-DSRTFVINTSDSGSSQTENPSSKYSGFFSEVSQDHETMAQVLFSRNLRLNVA
Bos_taurus|7790                    ------------------------------------------------------------
Dipodomys_ordii|10456              LPEKLHH-DSRTYLVNSSEAGSSQTESPASKFSGFFSEVSQDHETMAQVLFSRNLRLNVA
Otolemur_garnettii|14002           LPEKLHH-DSRTYLINSSDSSSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNLRLNVA
Bos_taurus|15902                   ------------------------------------------------------------
Echinops_telfairi|1321             LPDKLRH-DSRTYLINSSDSGASQTEGPSSKYSGFFSEVSQDHETMAQVLFSRNLRLNVA
Procavia_capensis|6063             LPEKLHH-DSRTYLINLSDSGSSQTENPSSKYSGFFSEVSQDHETMAQVLFSRNLRLNVA
Sorex_araneus|7141                 LPEKLRP-DCRTYLVNASDSGSSQTENPSSKYSTFFSEVSQDHETMAQVLFSRNLRLNVA
Dasypus_novemcinctus|8567          LPEKLRH-DSRTYLVNSSDSGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNLRLNVA
Loxodonta_africana|792             LPEKLHH-DSRTYLINFSDAGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNLRLNVA
Cavia_porcellus|1226               LPEKLHH-DSRTYVVNSSDSSSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNLRLNVA
Vicugna_pacos|10527                LPEKLRH-DTRTYLVNSSDSGSSQTESPSSKYSSFFSEVSQDHETMAQVLFSRNLRLNVA
Myotis_lucifugus|1405              PPEKLHH-GSRTYLLNSSDSGSSQTESASSKYSGFFSEVSQDHETMAQVLFSRNLRLNVA
Pteropus_vampyrus|2855             LPEKLYH-DSRTYLLNSRDSGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNLRLNVA
Equus_caballus|20890               LPEKLRH-DSRTYLVNSSDSSSSQTESPSSKYGGFFSEVSQDHETMAQVLFSRNLRLNVA
Callithrix_jacchus|21039           LPEKLHH-DSRTYLINSSDSGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNLRLNVA
Rhesus_macaque|27299               LPEKLHH-DSRTYLVNSSDSGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNMRLNVA
Gorilla_gorilla|7692               LPEKLHH-DSRTYLVNSSDSGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNMRLNVA
Homo_sapiens|56957                 LPEKLHH-DSRTYLVNSSDSGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNMRLNVA
Pan_troglodytes|2459               LPEKLHH-DSRTYLVNSSDSGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNMRLNVA
Pongo_abelii|8124                  LPEKLHH-DSRTYLVNSSDSGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNMRLNVA
Canis_familiaris|5036              LPEKLRH-DSRTYLVNSSDAGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNLRLNVA
Sus_scrofa|2435                    LPEKLRH-DSRTYSVNSSDSSSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNLRLNVA
Tupaia_belangeri|1401              LPEKLHH-DSRTYLVNSSDSGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNLRLNVA
Oryzias_latipes|21518              --------PDGGQGLRCYDNGEPWVNAPTSRMAGASSKCSDFTE----------------
Danio_rerio|13312                  VQAFLYS-DNCGFPVNSTDA---KMAGAGSKYSDYFTELSKDHEAMSHVLFGRNLRLNVA
Gasterosteus_aculeatus|10060       VRRTHYN-DNRGLPVNSAEA--SKMAGAGSKYKDF-TELSKDHEAMTRVLFGRNLRLKVA
Tetraodon_nigroviridis|2478        LPR------NGGLPVNSGEA--SKMAGATSKCSDF-TELSKDHEAMTHILFGRNLRLKVA
Fugu_rubripes|46381                TRR------NCGLPVNPGDA--PKMAGASSKYSDF-TELSKDHEAMTHILFGRNLRLKVA
Branchiostoma_floridae|19685       EPVLSPSAEDRENRPVAANVRKSKDSGAAAEEEDALLQLSSGHPTMTKVLSGRLLWLQAA
Nematostella_vectensis|25874       APQKPIKISQRDSSNQNDPARKSSAQGSSDTDET--NEIRKGHLAMTTVLSSRLLKLRAA
                                                                                               

Oryzias_latipes|20261              FTLWQ-RNAEELLTFFLKF-----------------------------------------
Xenopus_tropicalis|20033           LTFWRKRSINELVAYLVRMQDLGVLVDCLPVLTNSLQE---DKASISVGCCVDLLPLVKS
Ornithorhynchus_anatinus|1922      AHFPPPPGAGELVAYLVRIEDLGVVVDCLPVLTSSLQE---EKQAVSLGCCVDLLPLVKS
Anolis_carolinensis|14843          LTFWRRRSISELIAYLVRIQDLGVMVDCLPVLTSSLQE---EKPYISVGCCVDLLPLVKL
Gallus_gallus|13081                LTFWRRRSISELVAYLLRIQDLGVVVDCLPVLTNSLQE---EKPYISVGCCVDLLPLVKS
Taeniopygia_guttata|15474          LTFWRRRSISELVAYLVRIQDLGVVVDCLPVLTNSLQE---EKPYVSVGCCVDLLPLVKS
Macropus_eugenii|14257             LTFWRKRSISELVAYLVRIEDLGVVVDCLPVLTSSLQE---EKQYISLGCCVDLLPLVKS
Erinaceus_europaeus|13392          LTFWRKRSISELVAYLVRIEDLGVVVDCLPVLTNSLQE---EKQYISLGCCVDLLPLVKS
Ochotona_princeps|6183             LTFWRKRSISELVAYLVRIEDLGVVVDCLPVLTNSLQE---EKHYISLGCCVDLLPLVKS
Callithrix_jacchus|44982           LTFWRKRSISGLADYLLRIEDLGVVVECLPVHTNSLQE---EKQYISLCYCVDLLALVKS
Felis_catus|11429                  XXXXXXXXXXXXXXXXXXIEDLGVVVDCLPVLTNSLQE---EKQYISLGCCVDLLPLVKS
Tarsius_syrichta|635               LTFWRKRSISELVAYLVXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXXXXXXXX
Monodelphis_domestica|15477        LTFWRKRSISELVAYLVRIEDLGVVVDCLPVLTSSLQE---EKQYISLGCCVDLLPLVKS
Tursiops_truncatus|6924            LTFWRKRSISELVAYLVRIEDLGVVVDCLPVLTNSLQE---EKQYISLGCCVDLLPLVKS
Spermophilus_tridecemlineatus|3420 FTFWRKRSISELVAYLVRIEDLGVVVDCLPVLTNSLQE---EKQYISLGCCVDLLPLVKS
Microcebus_murinus|3515            XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXXXXXXXX
Mus_musculus|6626                  LTFWRKRSISELVAYLVRIEDLGVVVDCLPVLTNSLQE---EKQYISLGCCVDLLPLVKS
Rattus_norvegicus|14529            LTFWRKRSVSELVAYLVRIEDLGVVVDCLPVLTNSLQE---EKQCISLGCCVDLFPLVKS
Bos_taurus|7790                    ------------------------------------------------------------
Dipodomys_ordii|10456              LTFWRKRSISELVAYLVRIEDLGVVVDCLPVLTNSLQE---EKQYVSLGCCVDLLPLVKS
Otolemur_garnettii|14002           LTFWKKRSISELVAYLVRIEDLGVVVDCFPVLT-SLQE---EKQYISLGCCVDLLPLVKS
Bos_taurus|15902                   ------------------------------------------------------------
Echinops_telfairi|1321             LTFWRKRSISELVAYLVRIEDLGVVVDCLPVLTNSLQE---EKQYISLGCCVDLLPLVKS
Procavia_capensis|6063             LTFWRKRSISELVAYLVRIEDLGVVVDCLPVLTNSLQE---EKQYISLGCCVDLLPLVKS
Sorex_araneus|7141                 LTFWRKRSISELVAYLVRIEDLGVVVDCLPVLTNSLQE---EKQYISLGCCVDLLPLVKS
Dasypus_novemcinctus|8567          LTFWRKRNISELVAYLVRIEDLGVVVDCLPVLTNSLQE---GKQYISLGCCVDLLPLVKS
Loxodonta_africana|792             LTFWRKRSISELVAYLVRIEDLGVVVDCLPVLTNSLQE---EKQYISLGCCVDLLPLVKS
Cavia_porcellus|1226               LTFWRKRSISELVAYLVRIEDLGVVVDCLPVLTNSLQE---EKQYISLGCCVDLLPLVKS
Vicugna_pacos|10527                LTFWRKRSISELVAYLVRIEDLGVVVDCLPVLTNSLQE---EKQYISLGCCVDLLPLVKS
Myotis_lucifugus|1405              LTFWKKRSISELVAYLVRIEDLGVVVDCLPVLTNSLQE---EKQYISLGCCVDLLPLVKS
Pteropus_vampyrus|2855             LTFWKKRSISELVAYLVRIEDLGVVVDCLPVLTNSLQE---EKQYISLGCCVDLLPLVKS
Equus_caballus|20890               LTFWRKRSISELVAYLVRIEDLGVVVDCLPVLTNSLQE---EKQYISLGCCVDLLPLVKS
Callithrix_jacchus|21039           LTFWRKRSISELVAYLLRIEDLGVVVDCLPVLTNSLQE---EKQCISLGCCVDLLPLVKS
Rhesus_macaque|27299               LTFWRKRSISELVAYLLRIEDLGVVVDCLPVLTNCLQE---EKQYISLGCCVDLLPLVKS
Gorilla_gorilla|7692               LTFWRKRSISELVAYLLRIEDLGVVVDCLPVLTNCLQE---EKQYISLGCCVDLLPLVKS
Homo_sapiens|56957                 LTFWRKRSISELVAYLLRIEDLGVVVDCLPVLTNCLQE---EKQYISLGCCVDLLPLVKS
Pan_troglodytes|2459               LTFWRKRSISELVAYLLRIEDLGVVVDCLPVLTNCLQE---EKQYISLGCCVDLLPLVKS
Pongo_abelii|8124                  LTFWRKRSISELVAYLLRIEDLGVVVDCLPVLTNCLQE---EKQYISLGCCVDLLPLVKS
Canis_familiaris|5036              LTFWRKRSISELVAYLVRIEDLGVVVDCLPVLTNSLQE---EKQYISLGCCVDLLPLVKS
Sus_scrofa|2435                    LTFWRKRSISELVAYLVRIEDLGVVVDCLPVLTNSLQE---EKQYISLGCCVDLLPLVKS
Tupaia_belangeri|1401              LTFWRKRSISELVAYLVRIDDLGVVVDCLPVLTNSLQE---EKQYISLGCCVDLLPLVKS
Oryzias_latipes|21518              ------------------------------------------------------------
Danio_rerio|13312                  LTLWR-KNASELVAYLNRIQDTGVLVDCLPVLTKSLQG---EQPCISLGCCVDLFPQVKM
Gasterosteus_aculeatus|10060       QTLWR-KNASELVAYLIRIEDTGVLLDCLPVLTNNLQT---EAPCLSLGCCVDLVPLVKA
Tetraodon_nigroviridis|2478        QTLWR-RSASELVAYLIRIQDPGVLLDCLPVLTNDLQG---ESPCLSLGCCVDLMPQVKV
Fugu_rubripes|46381                QTLWR-RNASELVAYLIRIQDTGVLLDCLPVLTNDLQN---EAPCLSLGCCVDLMPQLKV
Branchiostoma_floridae|19685       LTFWK-QSPTALVSYILRINNDALLADVIPILIKSIKDGNAIGKPISMGACLELLPALQK
Nematostella_vectensis|25874       ETLWHKDTSNGFVEYILRLKDDSVLVDVMPLLTSRVKENAPEEHSLSMGACLEMLPALER
                                                                                               

Oryzias_latipes|20261              ------------------------------------------------------------
Xenopus_tropicalis|20033           LLKSKFEEYVIVGLNWLQAVVKRWWTQLSVNSENASDE-----NILVLKRQISGMWQQEN
Ornithorhynchus_anatinus|1922      LLRSKFEE----------------------------------------------------
Anolis_carolinensis|14843          MLKSKFEEYVIVGLNWLQAVIKRWWSDLSANTEKIEDG-----NIQILKEQLSGLWKQEN
Gallus_gallus|13081                LLKSKYEEYVIVGLNWLQAVIKRWWSELSAHKERAEDG-----NMIILKQQLSELWEQEH
Taeniopygia_guttata|15474          LLKSKYEEYVIVGLNWLQAVIKRWWSELSAHTEKTEDG-----NIHILKQQLSILWEQEN
Macropus_eugenii|14257             LLKSKFEEYVIVGLNWIQAVIKRWWSELSANTEIVKDG-----XXXXXXXXXXXXXXXXX
Erinaceus_europaeus|13392          LLKSRFEEYIIVGLNWLQAVIKRWWSELSSKTEIINDG-----NIQILKQQLSGLWEQES
Ochotona_princeps|6183             LLKSRFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----NIQILKQQLSGLWEQEN
Callithrix_jacchus|44982           LLKSTFEEYVIVGLNWLPAVTKRWWSGLSSKTEIINDG-----NTQILKHQLNGLWDQES
Felis_catus|11429                  LLKSKFEEYIIVGLNWLQAVIKRWWSELSSKTEIINDG-----NIQILKQQLSGLWEQEN
Tarsius_syrichta|635               XXXXXXXXXXXXXXXXXXXXXXXXWSELSSKPEIINDG-----NIQILKQQLSGLWEQEN
Monodelphis_domestica|15477        LLKSKFEEYVIVGLNWLQAVIKRWWSELSANTEIAKDG-----NIHILKQQLSGLWKQEN
Tursiops_truncatus|6924            LLKSKFEEYIIVGLNWLQAVIKRWWSELSSKTEIINDG-----NIQILKQQLSGLWEQEN
Spermophilus_tridecemlineatus|3420 LLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTEIISDG-----NIQILKQQLSGLWEQEN
Microcebus_murinus|3515            XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----NIQILKQQLSGLWEQEN
Mus_musculus|6626                  LLQSRFEEYVIVGLNWLQAVIKRWWSELSSTSEIISDG-----NIKILKQQLSGLWEQES
Rattus_norvegicus|14529            LLQSRFEEYVIVGLNWLQAVIKRWWSELSSKSEIISDG-----NIKILKQQLNGLWEQEN
Bos_taurus|7790                    ------------------------------------------------------------
Dipodomys_ordii|10456              LLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTDVINDG-----NIKILKQQLSGLWEQEN
Otolemur_garnettii|14002           LLKSKFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXXXXXXXXXXX
Bos_taurus|15902                   ------------------------------------------------------------
Echinops_telfairi|1321             LLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTEIKNDG-----NIQILKQQLSGLWEQEN
Procavia_capensis|6063             LLNSKFEEYVVVGLNWLQAVIKRWWSELSSKTETVNDG-----NIQILKQQLNGLWEQEN
Sorex_araneus|7141                 LLKSRFEEYIIVGLNWLQAVIKRWWSELSSKTEIINDG-----NIQILKQQLSGLWEQEN
Dasypus_novemcinctus|8567          LLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTEIKNDG-----XXQILKQQLSGLWDQEN
Loxodonta_africana|792             LLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTEIINDG-----NIQILKQQLNGLWEQEN
Cavia_porcellus|1226               LLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTEIINDT-----NIQILKQQLSRLWEQAN
Vicugna_pacos|10527                LLKSRFEEYIIVGLNWLQAVIKRWWSELSSKTEIIHDG-----NIQILKQQLSGLWEQEN
Myotis_lucifugus|1405              LLKSKFEEYIIVGLNWLQAVIKRWWSELSSKTEIINDG-----NIQILKQQLSRLWEQEN
Pteropus_vampyrus|2855             LLKSKFEEYIIVGLNWLQAVIKRWWSELSSKTEIINDG-----NIQILKQQLSGLWEQEN
Equus_caballus|20890               LLKSKFEEYIIVGLNWLQAVIKRWWSELSSKTEIRNDG-----NIQILKQQLSGLWEQEH
Callithrix_jacchus|21039           LLKSKFEEYVIVGLNWLQAVIKRWWSDLSSKTEIINDR-----NIQILKQQLSGLWEQEN
Rhesus_macaque|27299               LLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTEIISDG-----NIKILKQQLSGLWEQEN
Gorilla_gorilla|7692               LLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTEIINDG-----NIQILKQQLSGLWEQEN
Homo_sapiens|56957                 LLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTEIINDG-----NIQILKQQLSGLWEQEN
Pan_troglodytes|2459               LLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTEIINDG-----NIQILKQQLSGLWEQEN
Pongo_abelii|8124                  LLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTEIINDG-----NIQILKQQLSGLWEQEN
Canis_familiaris|5036              LLKSRFEEYIIVGLNWLQAVIKRWWSELSSKTEIINDG-----NIQILKQQLSGLWEQEN
Sus_scrofa|2435                    LLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTEIINDG-----NIQILKQQLSGLWEQEN
Tupaia_belangeri|1401              LLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTEIINDG-----NIQILKQQLSGLWEQEN
Oryzias_latipes|21518              ------------------------------------------------------------
Danio_rerio|13312                  ILNTKYEEHLIVALHWVQSIIKKWWSELSTNNKSLPESSSNDRNVQAMKTMLLELWQGKS
Gasterosteus_aculeatus|10060       ILASQYEENIMVGLHWVQSVIRKWWPELSKNEKRLRDSCSEDRNLEVMKLRLKDLWKEGA
Tetraodon_nigroviridis|2478        IIAGKYEEHIKVGLHWVQSVIRKWWPELSRKERRLQDSRSEDRNIEAMKQRLKELWKEGT
Fugu_rubripes|46381                IVASKYEEHIKVVLHWVQSVIRKWWPELSRKERRLQDGRSEDRNIEVMKQRLKDLWKEGS
Branchiostoma_floridae|19685       MLTSKYEDYISGSLDLIRTILKHWWKDLKSLQASQQNL-----RLGLRSRSVNGVYTSIV
Nematostella_vectensis|25874       LLASKYEDYIVAALNMMREMIKRWWNQLKAASSKDTDP-----EHFRYSRSVNGLYMAMV
                                                                                               

Oryzias_latipes|20261              --------------------------------------------------------
Xenopus_tropicalis|20033           HLTSV-------PGYTGNIAKDLDGYLSQLR-------------------------
Ornithorhynchus_anatinus|1922      --------------------------------------------------------
Anolis_carolinensis|14843          HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Gallus_gallus|13081                HLTLV-------PGYTGNIAKEVNAYLLQLC-------------------------
Taeniopygia_guttata|15474          HLTLV-------PGYTGNIAKDVNAYLLQLH-------------------------
Macropus_eugenii|14257             XXXXX-------XXXXXXXXXDVDAYLLQLH-------------------------
Erinaceus_europaeus|13392          HLTLA-------PGYTGNIAKDVDAYLLQLH-------------------------
Ochotona_princeps|6183             HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Callithrix_jacchus|44982           HLTLV-------PGYTGNIAKDVDAYLFQ---------------------------
Felis_catus|11429                  HLTLV-------PGYTGNIAK-----------------------------------
Tarsius_syrichta|635               HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Monodelphis_domestica|15477        HLTSV-------PGYTGNIAKDVDAYLLQLH-------------------------
Tursiops_truncatus|6924            HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Spermophilus_tridecemlineatus|3420 HLTLV-------PGYTGNIAK-----------------------------------
Microcebus_murinus|3515            HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Mus_musculus|6626                  HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Rattus_norvegicus|14529            HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Bos_taurus|7790                    --------------------------------------------------------
Dipodomys_ordii|10456              HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Otolemur_garnettii|14002           XXXXX-------XXXXXXXXXDIGNILLH---------------------------
Bos_taurus|15902                   --------------------------------------------------------
Echinops_telfairi|1321             HLTLV-------PGYTGNIAKNVDAYLLQ-H-------------------------
Procavia_capensis|6063             HLTLV-------PGYTGNIAK-----------------------------------
Sorex_araneus|7141                 HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Dasypus_novemcinctus|8567          HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Loxodonta_africana|792             HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Cavia_porcellus|1226               HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Vicugna_pacos|10527                HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Myotis_lucifugus|1405              HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Pteropus_vampyrus|2855             HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Equus_caballus|20890               HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Callithrix_jacchus|21039           HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Rhesus_macaque|27299               HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Gorilla_gorilla|7692               HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Homo_sapiens|56957                 HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Pan_troglodytes|2459               HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Pongo_abelii|8124                  HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Canis_familiaris|5036              HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Sus_scrofa|2435                    HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Tupaia_belangeri|1401              HLTLV-------PGYTGNIAKDVDAYLLQLH-------------------------
Oryzias_latipes|21518              --------------------------------------------------------
Danio_rerio|13312                  HLSSV-------PGTVGETAKVIESYVSQLR-------------------------
Gasterosteus_aculeatus|10060       RLCGV-------PGSTGELAKTIESYLSQLP-------------------------
Tetraodon_nigroviridis|2478        HICSV-------PGPTGEQAKAIEASLSQLP-------------------------
Fugu_rubripes|46381                RICSL-------PGPTGEQAKVLNGLTLSLQ-------------------------
Branchiostoma_floridae|19685       AMTDTLQKIAKRPGNIGQKAQCLMASLPVKRNGHFPVEKPSTGKCRNKGAVHNNGQ
Nematostella_vectensis|25874       SISAIVARLKKRRGIVGQKAQIVSRLLDLL--------------------------