Orthologs Set ID: EOG4006CQ


Orthology Database
OrthoDB4
Gene Symbol(s)
GD18114,GM10160,RB97D

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Drosophila melanogaster 17965 69, 299, 544, 1285
Drosophila sechellia 12634 69, 299, 544, 1267
Drosophila simulans 6421 69, 299, 544, 1267

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Drosophila melanogaster 17965 FBtr0085092, NM_170293 43231 FBgn0004903 Rb97D dm3
Drosophila sechellia 12634 FBtr0193145 6617094 FBgn0165111 GM10160 droSec1
Drosophila simulans 6421 FBtr0218024 6729788 FBgn0189656 GD18114 droSim1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Drosophila melanogaster 16519 FBpp0084462 43231 FBgn0004903 Rb97D dm3
Drosophila sechellia 217 FBpp0191637 6617094 FBgn0165111 GM10160 droSec1
Drosophila simulans 7994 FBpp0216516 6729788 FBgn0189656 GD18114 droSim1

multiple sequence alignment in CLUSTALW format


Drosophila_melanogaster|17965 ATGGTGAAGGATGAGCCCCTATCGGACGAGTCCGCCGATGTGATTGTGCTTGCAGATCGC
Drosophila_sechellia|12634    ATGGTGAAGGATGAGCTCCAATCGGACGAGTCCACCGATGTGATTTTGGTTGCAGATCGC
Drosophila_simulans|6421      ATGGTGAAGGATGAGCTCCAATCGGACGAGTCCACCGATGTGATTTTGCTTGCAGATCGC
                              **************** **:*************.*********** ** ***********

Drosophila_melanogaster|17965 GAGGAAGATGACATATGCGAGCTGGAGCACTTGCGTAAGCTCTTCATCGGCGGGCTGGCC
Drosophila_sechellia|12634    GAGGAAGATGACATATGCGAGCTGGAGCACTTGCGTAAGCTCTTCATCGGCGGGCTGGCC
Drosophila_simulans|6421      GAGGAAGATGACATATGCGAGCTGGAGCACTTGCGTAAGCTCTTCATCGGCGGGCTGGCC
                              ************************************************************

Drosophila_melanogaster|17965 CCGTACACCACCGAGGAGAACCTGAAGTTGTTCTACGGCCAGTGGGGCAAGGTGGTCGAT
Drosophila_sechellia|12634    CCGTACACCACCGAAGAGAACTTGAAGGTGTTCTATGGCCAGTGGGGCAGGGTGGTCGAT
Drosophila_simulans|6421      CCGTACACCACCGAAGAGAACTTGAAGGTGTTCTACGGCCAGTGGGGCAGGGTGGTCGAT
                              **************.****** ***** ******* *************.**********

Drosophila_melanogaster|17965 GTTGTGGTGATGCGCGATGCTGCCACCAAGAGATCTCGCGGCTTCGGCTTCATCACCTAC
Drosophila_sechellia|12634    GTTGTGGTGATGCGCGATGCTGCCACCAAGAGATCTCGCGGCTTCGGCTTCATCACCTAC
Drosophila_simulans|6421      GTTGTGGTGATGCGCGATGCTGCCACCAAGAGATCTCGCGGCTTCGGCTTCATCACCTAC
                              ************************************************************

Drosophila_melanogaster|17965 ACAAAGTCTCTCATGGTCGACAGGGCCCAGGAGAACCGTCCGCACATCATCGACGGCAAA
Drosophila_sechellia|12634    ACAAAGTCCCTCATGGTCGACAGGGCCCAGGAGAACCGTCCGCACATCATCGACGGCAAA
Drosophila_simulans|6421      ACAAAGTCCCTCATGGTCGACAGGGCCCAGGAGAACCGTCCGCACATCATCGACGGCAAA
                              ******** ***************************************************

Drosophila_melanogaster|17965 ACTGTGGAAGCCAAGCGTGCTCTGCCCCGTCCCGAACGCGAATCGCGCGAGACCAATATA
Drosophila_sechellia|12634    ACTGTGGAAGCCAAGCGTGCTCTGCCCCGTCCCGAACGCGAATCGCGCGAGACCAATATT
Drosophila_simulans|6421      ACTGTGGAAGCCAAGCGTGCTCTGCCCCGTCCCGAACGCGAATCGCGCGAGACCAATATT
                              ***********************************************************:

Drosophila_melanogaster|17965 TCCGTGAAGAAGCTGTTCGTAGGCGGTCTTAAGGATAACCACGATGAGGAATGCCTTCGT
Drosophila_sechellia|12634    TCCGTGAAGAAGCTGTTCGTAGGCGGTCTTAAGGATAACCACGATGAGGAATGCCTGCGT
Drosophila_simulans|6421      TCCGTGAAGAAGCTGTTCGTAGGCGGTCTTAAGGATAACCACGATGAGGAATGCCTGCGT
                              ******************************************************** ***

Drosophila_melanogaster|17965 GAATACTTCCTCCAATTCGGGAATGTAGTCTCCGTTAAATTGCTTACTGACAAAACCACT
Drosophila_sechellia|12634    GAATACTTCCTCCAATTCGGGAATGTGGTCTCCGTTAAATTGCTTACTGACAAAACCACT
Drosophila_simulans|6421      GAATACTTCCTCCAATTCGGGAATGTGGTCTCCGTTAAATTGCTTACTGACAAAACCACT
                              **************************.*********************************

Drosophila_melanogaster|17965 GGCAAGCGTCGCGGCTTCGCCTTCGTCGAGTTCGACGACTACGATGCAGTGGATAAGGCT
Drosophila_sechellia|12634    GGCAAGCGTCGCGGCTTCGCCTTCGTCGAGTTCGACGACTACGATGCAGTGGATAAGGCC
Drosophila_simulans|6421      GGCAAGCGTCGCGGCTTCGCCTTCGTCGAGTTCGACGACTACGATGCAGTGGATAAGGCT
                              *********************************************************** 

Drosophila_melanogaster|17965 ATCCTTAAAAAGCAACATGCGATTAAGTACGTTCACGTGGACGTCAAGAAGTCCATTTAT
Drosophila_sechellia|12634    ATCCTTAAAAAGCAACATGCAATTAAGTACGTTCACGTGGACGTCAAGAAGTCCATTTAT
Drosophila_simulans|6421      ATCCTTAAAAAGCAACATGCAATTAAGTACGTTCACGTGGACGTCAAGAAGTCCATTTAT
                              ********************.***************************************

Drosophila_melanogaster|17965 AACCTGGACAAGAAGGAGAAACAGCAGCCAGGTGGGCTGGCCAACGCCATCAAGCCGTCG
Drosophila_sechellia|12634    AACTTGGAGAAGAAGGACAAACAGCAGCCAGGTGGTATGGCCAACGCCATCAAGCCATCG
Drosophila_simulans|6421      AACTTGGAGAAGAAGGACAAACAGCAGCCAGGTGGTATGGCCAACGCCATCAAGCCATCG
                              *** **** ******** ***************** .*******************.***

Drosophila_melanogaster|17965 CTCAATCAGCAGCAGCAACAGCAGGGTGGCGGACAGCAGCCACCTAATGGCAATATGCAG
Drosophila_sechellia|12634    CTCAATCAGCAGCAGCAACAGCAGGGTGGGGGACAGCAGCCACCGAATGGCAATATGCCC
Drosophila_simulans|6421      CTCAATCAGCAGCAGCAACAGCAGGGTGGGGGACAGCAGCCACCGAATGGCAATATGCCC
                              ***************************** ************** *************. 

Drosophila_melanogaster|17965 GCACCTAGCTTTCGACCACCAGTGCCGCCACAACAGGCCATGGGCCCCTACCAACAACAG
Drosophila_sechellia|12634    CCACCTAATTTTCGACCGCCAGTGCCGCCACAACAGGCCATGGGCCCCTACCAACAACAG
Drosophila_simulans|6421      CCACCTAATTTTCGACCGCCAGTGCCGCCACAACAGGCCATGGGCCCCTATCAACAACAG
                               ******. ********.******************************** *********

Drosophila_melanogaster|17965 CCACCACCGGCGCCTATGTCTGCTCCACCACCAAACTTCAACTACTGGGGACCACCTCCG
Drosophila_sechellia|12634    CCACCACCGGCACCGATGTCCGCTCCACCACCAAACTTCAACTACTGGGGACCACCTCCG
Drosophila_simulans|6421      CCACCACCGGCACCGATGTCCGCTCCACCACCAAACTTCAACTACTGGGGACCACCTCCG
                              ***********.** ***** ***************************************

Drosophila_melanogaster|17965 CCGGCTATGCCGCCCTACTACCAGCAGCCACCGCCGCAGCAGATGAACGGCTGGGGTCCA
Drosophila_sechellia|12634    CCGGCTATGCCGCCCTACTACCAGCAGCCACCGCCGCAGCAGATGAACGGCTGGGGTCCC
Drosophila_simulans|6421      CCGGCTATGCCGCCCTACTACCAGCAGCCACCGCCGCAGCAGATGAACGGCTGGGGTCCC
                              ***********************************************************.

Drosophila_melanogaster|17965 TATCCGCCGCCGCAACAAAATGGCTGGAATGCACCACCACCGCCACCACCGGGTGCCCAG
Drosophila_sechellia|12634    TATCCGCCGCCGCAACAAAATGGCTGGAATGCACCACCACCCCCACCACCGGGTGCCCAG
Drosophila_simulans|6421      TATCCGCCGCCGCAACAAAATGGCTGGAATGCACCACCACCCCCACCACCCGGTGCCCAG
                              ***************************************** ******** *********

Drosophila_melanogaster|17965 CAGTGGCACGCCAACCAGTGGGGTTGTCCTCCACCAGTGCAACAGGTGCCGCCGGTTGGA
Drosophila_sechellia|12634    CAGTGGCACGCCAACCAGTGGGGTTGTCCTCCACCAGTGCAACAGATGCCGCCAGTTGGA
Drosophila_simulans|6421      CAGTGGCACGCCAACCAGTGGGGTTGTCCTCCACCAGTGCAACAGATGCCGCCGGTTGGA
                              *********************************************.*******.******

Drosophila_melanogaster|17965 GCAGTGCCACCACCCATGGGTCACAATGGACCACCGCCGACGGCTCCAGGTAACTGGAAC
Drosophila_sechellia|12634    GCAGTGCCACCACCCATGGGTCACAATGGACCACCGCCGCCGGCTCCAGGTAACTGGAAC
Drosophila_simulans|6421      GCAGTGCCACCACCCATGGGTCACAATGGACCACCGCCGCCGGCTCCAGGTAACTGGAAC
                              ***************************************.********************

Drosophila_melanogaster|17965 ATGCCGCCCCCAGTGCCGGGTGCAGCTCCTCCATCCCACCAGCAGCAGTCT---TCGCAA
Drosophila_sechellia|12634    ATGCCGCCCCCAGTGCCGGGTGCAGCTCCTCCATCCCACCAGCAGCAGTCTCAGCAACAG
Drosophila_simulans|6421      ATGCCGCCCCCAGTGCCGGGTGCAGCTCCTCCATCCCACCAGCAGCAGTCTCAGCAACAG
                              ***************************************************    ..**.

Drosophila_melanogaster|17965 CAGCCAACACCACAACCAAATTTCGGCACTGGCTATCAGCAAAACTACGGAGGCGGACCA
Drosophila_sechellia|12634    CAGCCAACACCACAACCAAATTTCGGCTCTGGCTATCAGCAAAACTACGGAGGCGGACCA
Drosophila_simulans|6421      CAGCCAACACCACAACCAAATTTCGGCTCTGGCTATCAGCAAAACTACGGAGGCGGACCA
                              ***************************:********************************

Drosophila_melanogaster|17965 TCCAAGCACAACAATATGAATGCAAACCGCATGAATCCTTACTCGGCAGGTCCGCCCAAC
Drosophila_sechellia|12634    TCCAAGCATAACAATATGAATGCAAACCGCATGAATCCTTACTCGGCAGGTCCGCCCAAC
Drosophila_simulans|6421      TCCAAGCACAACAATATGAATGCAAACCGCATGAATCCTTACTCGACAGGTCCGCCCAAC
                              ******** ************************************.**************

Drosophila_melanogaster|17965 AGCTAC------------------CCATATACGGGCTACAACGCTGGACCACTGCCGCCT
Drosophila_sechellia|12634    AGCTACCACACTCCTCAACCACCAGCATATCCTGGCTACAACGCTGGGCCACTGCCGCCT
Drosophila_simulans|6421      AGCTACCACACTCCTCAACCACCAGCATATCCTGGCTACAACGCTGGGCCACTGCCGCCT
                              ******                   *****.* **************.************

Drosophila_melanogaster|17965 AATGGAAGCGTTCCGCCGCCAACTGGGGCCAAGGCTGTTGGCGTATCCAATGGCTCCGTG
Drosophila_sechellia|12634    AATGGAAGCGTTCCGCCGTCAACTGGGGCCAAGGCTGTGGGCGTATCCAATGGCTCCGTG
Drosophila_simulans|6421      AATGGAAGCGTTCCGCCGTCAACTGGGGCCAAGGCTGTGGGCGTATCCAATGGCTCCGTG
                              ****************** ******************* *********************

Drosophila_melanogaster|17965 GCCACTGGAGGCAGTGCCAACAGCAAATATCGCCGCTAG
Drosophila_sechellia|12634    GCCACTGGAGGCAGTGCCAACAGCAAGTATCGCCGCTAG
Drosophila_simulans|6421      GCCACTGGAGGCAGTGCCAACAGCAAGTATCGCCGCTAG
                              **************************.************

multiple sequence alignment in CLUSTALW format


Drosophila_melanogaster|16519 MVKDEPLSDESADVIVLADREEDDICELEHLRKLFIGGLAPYTTEENLKLFYGQWGKVVD
Drosophila_sechellia|217      MVKDELQSDESTDVILVADREEDDICELEHLRKLFIGGLAPYTTEENLKVFYGQWGRVVD
Drosophila_simulans|7994      MVKDELQSDESTDVILLADREEDDICELEHLRKLFIGGLAPYTTEENLKVFYGQWGRVVD
                              *****  ****:***::********************************:******:***

Drosophila_melanogaster|16519 VVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERESRETNI
Drosophila_sechellia|217      VVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERESRETNI
Drosophila_simulans|7994      VVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERESRETNI
                              ************************************************************

Drosophila_melanogaster|16519 SVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKA
Drosophila_sechellia|217      SVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKA
Drosophila_simulans|7994      SVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKA
                              ************************************************************

Drosophila_melanogaster|16519 ILKKQHAIKYVHVDVKKSIYNLDKKEKQQPGGLANAIKPSLNQQQQQQGGGQQPPNGNMQ
Drosophila_sechellia|217      ILKKQHAIKYVHVDVKKSIYNLEKKDKQQPGGMANAIKPSLNQQQQQQGGGQQPPNGNMP
Drosophila_simulans|7994      ILKKQHAIKYVHVDVKKSIYNLEKKDKQQPGGMANAIKPSLNQQQQQQGGGQQPPNGNMP
                              **********************:**:******:************************** 

Drosophila_melanogaster|16519 APSFRPPVPPQQAMGPYQQQPPPAPMSAPPPNFNYWGPPPPAMPPYYQQPPPQQMNGWGP
Drosophila_sechellia|217      PPNFRPPVPPQQAMGPYQQQPPPAPMSAPPPNFNYWGPPPPAMPPYYQQPPPQQMNGWGP
Drosophila_simulans|7994      PPNFRPPVPPQQAMGPYQQQPPPAPMSAPPPNFNYWGPPPPAMPPYYQQPPPQQMNGWGP
                              .*.*********************************************************

Drosophila_melanogaster|16519 YPPPQQNGWNAPPPPPPGAQQWHANQWGCPPPVQQVPPVGAVPPPMGHNGPPPTAPGNWN
Drosophila_sechellia|217      YPPPQQNGWNAPPPPPPGAQQWHANQWGCPPPVQQMPPVGAVPPPMGHNGPPPPAPGNWN
Drosophila_simulans|7994      YPPPQQNGWNAPPPPPPGAQQWHANQWGCPPPVQQMPPVGAVPPPMGHNGPPPPAPGNWN
                              ***********************************:*****************.******

Drosophila_melanogaster|16519 MPPPVPGAAPPSHQQQS-SQQPTPQPNFGTGYQQNYGGGPSKHNNMNANRMNPYSAGPPN
Drosophila_sechellia|217      MPPPVPGAAPPSHQQQSQQQQPTPQPNFGSGYQQNYGGGPSKHNNMNANRMNPYSAGPPN
Drosophila_simulans|7994      MPPPVPGAAPPSHQQQSQQQQPTPQPNFGSGYQQNYGGGPSKHNNMNANRMNPYSTGPPN
                              ***************** .**********:*************************:****

Drosophila_melanogaster|16519 SY------PYTGYNAGPLPPNGSVPPPTGAKAVGVSNGSVATGGSANSKYRR
Drosophila_sechellia|217      SYHTPQPPAYPGYNAGPLPPNGSVPPSTGAKAVGVSNGSVATGGSANSKYRR
Drosophila_simulans|7994      SYHTPQPPAYPGYNAGPLPPNGSVPPSTGAKAVGVSNGSVATGGSANSKYRR
                              **      .*.***************.*************************