Orthologs Set ID: EOG4006CR


Orthology Database
OrthoDB4
Gene Symbol(s)
TSFM

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Anolis carolinensis 8161 285, 423, 549, 712
Bombyx mori 14079 285, 549, 867, 1077, 1170, 1267, 1573
Bos taurus 21593 111, 285, 423, 549, 712
Branchiostoma floridae 28207 285, 423, 549
Callithrix jacchus 33342 69, 285, 423, 549, 712
Canis familiaris 1819 31, 128, 153, 285, 423, 549, 712
Choloepus hoffmanni 2371 285, 423, 549, 687, 1155
Danio rerio 27878 66, 285, 423, 549, 712
Dasypus novemcinctus 3623 69, 285, 423, 549, 612, 712
Dipodomys ordii 7565 69, 285, 423, 549, 612, 712
Echinops telfairi 2743 69, 285, 423, 549, 712
Equus caballus 23559 69, 285, 423, 549, 712
Erinaceus europaeus 4605 69, 285, 423, 549
Fugu rubripes 37364 54, 285, 423, 549, 712
Gasterosteus aculeatus 7324 54, 285, 423, 549, 712, 1518, 1538
Gorilla gorilla 13920 69, 285, 423, 549, 712
Homo sapiens 21911 69, 285, 423, 549, 712
Loxodonta africana 9658 69, 285, 423, 549, 712
Macropus eugenii 4057 132, 285, 423, 549, 612, 712
Microcebus murinus 4087 69, 285, 423, 549, 712
Monodelphis domestica 33031 180, 285, 423, 549, 712
Myotis lucifugus 6026 69, 129, 285, 423, 549, 612, 712
Nematostella vectensis 12314 423
Ochotona princeps 10887 69, 285, 423, 549, 612, 712
Oryctolagus cuniculus 20731 69, 285, 423, 584, 712
Oryzias latipes 22623 78, 285, 423, 549, 712
Otolemur garnettii 12725 423, 549, 612, 712
Pan troglodytes 8842 69, 285, 423, 549, 612, 712
Pongo abelii 6638 69, 285, 423, 549, 712
Procavia capensis 17205 69, 285, 423, 549, 552, 582, 712
Pteropus vampyrus 2243 69, 285, 423, 549, 712
Rhesus macaque 7906 69, 285, 423, 553, 555, 618, 712
Sorex araneus 803 66, 135, 138, 144, 285, 474, 480, 549, 612, 712
Spermophilus tridecemlineatus 1155 69, 285, 423, 549, 612, 712
Tetraodon nigroviridis 2918 54, 285, 423, 549, 712
Tupaia belangeri 11603 69, 285, 353, 364, 423, 481, 549, 612, 712
Tursiops truncatus 15356 69, 285, 423, 549, 712
Vicugna pacos 12248 285, 423, 549, 612, 712
Xenopus tropicalis 22987 285, 423, 549, 712

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 8161 ENSACAT00000013080 100566410 ENSACAG00000013044 tsfm anoCar1
Bombyx mori 14079 BGIBMGA003119-TA v2.0
Bos taurus 21593 ENSBTAT00000022496 281551 ENSBTAG00000016912 TSFM bosTau4
Branchiostoma floridae 28207 fgenesh2_pg.scaffold_128000106 braFlo1
Callithrix jacchus 33342 ENSCJAT00000052848 100389321 ENSCJAG00000006600 TSFM calJac3
Canis familiaris 1819 ENSCAFT00000000451 100688454 ENSCAFG00000000293 METTL21B canFam2
Choloepus hoffmanni 2371 ENSCHOT00000002372 ENSCHOG00000002360 TSFM choHof1
Danio rerio 27878 ENSDART00000085945 567785 ENSDARG00000060748 tsfm danRer6
Dasypus novemcinctus 3623 ENSDNOT00000017737 ENSDNOG00000017737 TSFM dasNov2
Dipodomys ordii 7565 ENSDORT00000007272 ENSDORG00000007272 Tsfm dipOrd1
Echinops telfairi 2743 ENSETET00000002685 101644749 ENSETEG00000002686 TENREC
Equus caballus 23559 ENSECAT00000010899 100053864 ENSECAG00000010520 TSFM equCab2
Erinaceus europaeus 4605 ENSEEUT00000004129 ENSEEUG00000004147 TSFM eriEur1
Fugu rubripes 37364 ENSTRUT00000007240 101079014 ENSTRUG00000003081 tsfm fr2
Gasterosteus aculeatus 7324 ENSGACT00000000901 ENSGACG00000000697 tsfm gasAcu1
Gorilla gorilla 13920 ENSGGOT00000001424 101150529 ENSGGOG00000001415 TSFM gorGor3
Homo sapiens 21911 ENST00000454289 10102 ENSG00000123297 TSFM hg19,GRCh37
Loxodonta africana 9658 ENSLAFT00000015173 100662640 ENSLAFG00000015177 TSFM loxAfr3
Macropus eugenii 4057 ENSMEUT00000004055 ENSMEUG00000004047 TSFM Meug_1.0
Microcebus murinus 4087 ENSMICT00000003810 ENSMICG00000003812 TSFM micMur1
Monodelphis domestica 33031 ENSMODT00000027162 100031520 ENSMODG00000021351 TSFM monDom5
Myotis lucifugus 6026 ENSMLUT00000005941 102430019 ENSMLUG00000005940 TSFM myoLuc1
Nematostella vectensis 12314 fgenesh1_pg.scaffold_232000018 Nemve1
Ochotona princeps 10887 ENSOPRT00000006668 ENSOPRG00000006670 TSFM OchPri2.0
Oryctolagus cuniculus 20731 ENSOCUT00000012506 ENSOCUG00000012512 TSFM oryCun2.0
Oryzias latipes 22623 ENSORLT00000024896 101160042 ENSORLG00000020061 tsfm oryLat2
Otolemur garnettii 12725 ENSOGAT00000012237 100962568 ENSOGAG00000012235 TSFM otoGar1
Pan troglodytes 8842 ENSPTRT00000009477 452028 ENSPTRG00000005152 TSFM panTro2
Pongo abelii 6638 ENSPPYT00000005574 100445615 ENSPPYG00000004708 TSFM ponAbe2
Procavia capensis 17205 ENSPCAT00000003776 ENSPCAG00000003789 TSFM proCap1
Pteropus vampyrus 2243 ENSPVAT00000012140 ENSPVAG00000012141 TSFM pteVam1
Rhesus macaque 7906 ENSMMUT00000046256 715916 ENSMMUG00000005893 rheMac2
Sorex araneus 803 ENSSART00000000785 ENSSARG00000000785 TSFM sorAra1
Spermophilus tridecemlineatus 1155 ENSSTOT00000001155 101954764 ENSSTOG00000001159 Tsfm speTri1
Tetraodon nigroviridis 2918 ENSTNIT00000017826 ENSTNIG00000014578 tsfm tetNig2
Tupaia belangeri 11603 ENSTBET00000011604 ENSTBEG00000011603 TSFM tupBel1
Tursiops truncatus 15356 ENSTTRT00000008350 101327888 ENSTTRG00000008351 TSFM turTru1
Vicugna pacos 12248 ENSVPAT00000000209 ENSVPAG00000000209 TSFM vicPac1
Xenopus tropicalis 22987 ENSXETT00000021253 100497317 ENSXETG00000009653 tsfm xenTro2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 12625 ENSACAP00000012823 100566410 ENSACAG00000013044 tsfm anoCar1
Bombyx mori 3119 BGIBMGA003119-PA v2.0
Bos taurus 21152 ENSBTAP00000022496 281551 ENSBTAG00000016912 TSFM bosTau4
Branchiostoma floridae 15086 fgenesh2_pg.scaffold_128000106 braFlo1
Callithrix jacchus 25173 ENSCJAP00000046790 100389321 ENSCJAG00000006600 TSFM calJac3
Canis familiaris 23271 ENSCAFP00000000409 100688454 ENSCAFG00000000293 METTL21B canFam2
Choloepus hoffmanni 2088 ENSCHOP00000002088 ENSCHOG00000002360 TSFM choHof1
Danio rerio 23314 ENSDARP00000080380 567785 ENSDARG00000060748 tsfm danRer6
Dasypus novemcinctus 3191 ENSDNOP00000013758 ENSDNOG00000017737 TSFM dasNov2
Dipodomys ordii 7111 ENSDORP00000006817 ENSDORG00000007272 Tsfm dipOrd1
Echinops telfairi 2187 ENSETEP00000002191 101644749 ENSETEG00000002686 TENREC
Equus caballus 8494 ENSECAP00000008458 100053864 ENSECAG00000010520 TSFM equCab2
Erinaceus europaeus 3772 ENSEEUP00000003751 ENSEEUG00000004147 TSFM eriEur1
Fugu rubripes 7195 ENSTRUP00000007195 101079014 ENSTRUG00000003081 tsfm fr2
Gasterosteus aculeatus 868 ENSGACP00000000901 ENSGACG00000000697 tsfm gasAcu1
Gorilla gorilla 11351 ENSGGOP00000001398 101150529 ENSGGOG00000001415 TSFM gorGor3
Homo sapiens 80826 ENSP00000388330 10102 ENSG00000123297 TSFM hg19,GRCh37
Loxodonta africana 17391 ENSLAFP00000012704 100662640 ENSLAFG00000015177 TSFM loxAfr3
Macropus eugenii 3692 ENSMEUP00000003684 ENSMEUG00000004047 TSFM Meug_1.0
Microcebus murinus 3475 ENSMICP00000003474 ENSMICG00000003812 TSFM micMur1
Monodelphis domestica 12937 ENSMODP00000026683 100031520 ENSMODG00000021351 TSFM monDom5
Myotis lucifugus 5429 ENSMLUP00000005429 102430019 ENSMLUG00000005940 TSFM myoLuc1
Nematostella vectensis 19971 fgenesh1_pg.scaffold_232000018 Nemve1
Ochotona princeps 9478 ENSOPRP00000006106 ENSOPRG00000006670 TSFM OchPri2.0
Oryctolagus cuniculus 20005 ENSOCUP00000010768 ENSOCUG00000012512 TSFM oryCun2.0
Oryzias latipes 23767 ENSORLP00000024895 101160042 ENSORLG00000020061 tsfm oryLat2
Otolemur garnettii 10944 ENSOGAP00000010944 100962568 ENSOGAG00000012235 TSFM otoGar1
Pan troglodytes 14651 ENSPTRP00000008766 452028 ENSPTRG00000005152 TSFM panTro2
Pongo abelii 20815 ENSPPYP00000005365 100445615 ENSPPYG00000004708 TSFM ponAbe2
Procavia capensis 16094 ENSPCAP00000003545 ENSPCAG00000003789 TSFM proCap1
Pteropus vampyrus 2120 ENSPVAP00000011442 ENSPVAG00000012141 TSFM pteVam1
Rhesus macaque 7308 ENSMMUP00000039298 715916 ENSMMUG00000005893 rheMac2
Sorex araneus 720 ENSSARP00000000721 ENSSARG00000000785 TSFM sorAra1
Spermophilus tridecemlineatus 1037 ENSSTOP00000001033 101954764 ENSSTOG00000001159 Tsfm speTri1
Tetraodon nigroviridis 11323 ENSTNIP00000017605 ENSTNIG00000014578 tsfm tetNig2
Tupaia belangeri 10030 ENSTBEP00000010027 ENSTBEG00000011603 TSFM tupBel1
Tursiops truncatus 14523 ENSTTRP00000007911 101327888 ENSTTRG00000008351 TSFM turTru1
Vicugna pacos 11378 ENSVPAP00000000193 ENSVPAG00000000209 TSFM vicPac1
Xenopus tropicalis 21938 ENSXETP00000021253 100497317 ENSXETG00000009653 tsfm xenTro2

multiple sequence alignment in CLUSTALW format


Bombyx_mori|14079                  ------------------------------ATGATTTTCCAGCTGATTCGAAGAATTCAT
Nematostella_vectensis|12314       ------------------------------------------------------------
Branchiostoma_floridae|28207       ------------------------------------------ATGCCCTGCCCTACAGGT
Sorex_araneus|803                  ATGTCCCTGCTGCGGCCG---------CTCCGCTACTGC---CTGATGGCGCGGCCCGGG
Xenopus_tropicalis|22987           ------------------------------------------------------------
Anolis_carolinensis|8161           ------------------------------------------------------------
Macropus_eugenii|4057              ------------CGGTCG---------CTGCGACTTTTC---------------------
Dasypus_novemcinctus|3623          ATGTTGCAAATACAGCCT---------CTGCGCCTCTTC---TTCGTCGCGAGGACTGGT
Vicugna_pacos|12248                ------------------------------------------------------------
Monodelphis_domestica|33031        ATGTCCTTCTTTCGGTCT---------TTGCGCCTTTTC---AGGGACTTGGGGTGCCGG
Erinaceus_europaeus|4605           ATGTCGCTGCTTCGATCG---------CTGCGCTCCTGC---CTGCCAGCACGTTCTGGG
Dipodomys_ordii|7565               ATGTCCCTGCTGCGGTCC---------CTGCAGCTCAGC---CTGGCCGCGCGGGCCGCA
Choloepus_hoffmanni|2371           GCG---------------------------------------------------------
Tupaia_belangeri|11603             ATGTCGCTGCTGCGGTCA---------CTGCGCATCTGC---CTAGTCGTGCGAAGTGGA
Myotis_lucifugus|6026              ATGTCGCTGCTGCGGTCA---------CTGCGCCTCTGT---CTGGTCGCACGGACCGGG
Ochotona_princeps|10887            ATGTCGCTGCTGTGGTCA---------CTGCGCCTGGGC---TTGGTCGCGCGGACTGGG
Oryctolagus_cuniculus|20731        ATGTCGCTGCTGCGGTCG---------CTACGCCTGTGC---TTAGTCGCGCGGACGGGG
Echinops_telfairi|2743             ATGTTGCTCCTACGGTCG---------CTGCGCCTCTTC---CAGGTTGCGCGCCCCGGA
Loxodonta_africana|9658            ATGTTGCTGCTGCGGTCG---------CTGCGCCTCTGC---TTGGTCGCGTGGAACGGA
Procavia_capensis|17205            ATGTTGCTCTTACGCTCG---------CTACGCCTCTGC---CTGGTGGCACCGATCGGA
Equus_caballus|23559               ATGTCGCTGCTGCGAGCT---------CTGCGCCTCTGC---CTGGTCGCGCGGCCCCGG
Pteropus_vampyrus|2243             ATGTCGCTGCTGCGGTCG---------CTGCGCCTCTAC---CTGGCCGCGCAGACCAGG
Bos_taurus|21593                   ATGTCGCTGCTGCGGTCA---------TTGCGTCTCTGC---CTGGTCGCGCGGACCGGG
Tursiops_truncatus|15356           ATGTCGCTGCTGCGCTCGCTGCGCTCACTGCGCCTCTGT---TTGGTCGCGCGGGCCGGG
Canis_familiaris|1819              ------CTTTTACGGAGC---------CTCCTTTTTTTC------CCCTTCAGATGCCTA
Microcebus_murinus|4087            ATGTCGCTGCTGCGGTCA---------TTGAGCTTTTGC---CTGGTCTCGCGGACCAGG
Callithrix_jacchus|33342           ATGTGGATGCTGCGGTCA---------CTGCGCGTGTTCCTCCTGGTCGCGCGGACCGGG
Rhesus_macaque|7906                ATGTCGCTGCTACGGTCA---------CTGCGTGTGTTC---CTGGTCGCGCGGACCGGG
Homo_sapiens|21911                 ATGTCGCTGCTGCGGTCG---------CTGCGCGTGTTT---CTGGTCGCGCGGACCGGG
Pongo_abelii|6638                  ATGTCGCTGCTGCGGTCG---------CTGCGCGTGTTC---CTGGTCGCGCGGACCGGG
Gorilla_gorilla|13920              ATGTCGCTGCTGCGGTCG---------CTGCGCGTGTTC---CTGGTCGCGCGGACCGGG
Pan_troglodytes|8842               ATGTCGCTGCTGCGGTCG---------CTGCGCGTGTTC---CTGGTCGCGCGGACCGGG
Otolemur_garnettii|12725           ------------------------------------------------------------
Spermophilus_tridecemlineatus|1155 ATGTCCCTGCTGCGGTCG---------CTGCGCTTGTTC---CTGGACGCGCGGACAGTG
Danio_rerio|27878                  GGAAGATACCGTACAGAAGTGGCTATGTATTCTTTATTTCGGTCTGTCAGGAGTGAAGTA
Oryzias_latipes|22623              ---------------------------atgaaaatgtttaaatgtgcgTTCAGAGCAGCT
Gasterosteus_aculeatus|7324        ------------------------------ATGACGAGA---GACTTTGCAAAGGTCAGT
Tetraodon_nigroviridis|2918        ATGTCTTTG------------------GGCTTTTTATTTAGAACAGCGGCAAAGCTCGGT
Fugu_rubripes|37364                ATGTCGTTAGGC---------------TTTTTAGCCAGA---ACAGTGGCGAAGGTCAGT
                                                                                               

Bombyx_mori|14079                  ACAAGTCCAGCG------------------------------------------------
Nematostella_vectensis|12314       ------------------------------------------------------------
Branchiostoma_floridae|28207       GTGACCAGGTGT------------------------------------------------
Sorex_araneus|803                  AGCTGC------------------------------------------------------
Xenopus_tropicalis|22987           ------------------------------------------------------------
Anolis_carolinensis|8161           ------------------------------------------------------------
Macropus_eugenii|4057              ---AAGCACTTG---------------GGTTTCCGG------------------------
Dasypus_novemcinctus|3623          TGTCGCCTGGCG---------------GGGCCCCTT------------------------
Vicugna_pacos|12248                ---------GCG---------------GGGCCCCTT------------------------
Monodelphis_domestica|33031        AGCCGTCCGGTAAGGGGATGTGGCCGCGGAGCTCGT------------------------
Erinaceus_europaeus|4605           AGCAGCCCGGCA---------------GGGCGCCTC------------------------
Dipodomys_ordii|7565               AGCCGCCAGGCG---------------GGGTCCCTT------------------------
Choloepus_hoffmanni|2371           ---------------------------GGGCCCCTC------------------------
Tupaia_belangeri|11603             AGTCGCCCGGCG---------------AGGCCCCTC------------------------
Myotis_lucifugus|6026              AGCTGTCCGGCA---------------GGGCCCCTT------------------------
Ochotona_princeps|10887            AGTCGAGCGGCG---------------GGGTGCTCG------------------------
Oryctolagus_cuniculus|20731        AGCCGACCGGCG---------------GGGTGCCTT------------------------
Echinops_telfairi|2743             AGCCGCCCGGCG---------------GGGCCCGGT------------------------
Loxodonta_africana|9658            CGCCCCCCGGCG---------------GGGCCCCTT------------------------
Procavia_capensis|17205            AGCCGTGCGGCA---------------GGGCCCCTT------------------------
Equus_caballus|23559               CGCTGCCCGGAG---------------GGGCCTCTT------------------------
Pteropus_vampyrus|2243             AACTGCCCGGCG---------------GGGGCCCTT------------------------
Bos_taurus|21593                   AGCTGCCCGCTGAGCGCTCTTGGCCCTGGTCCCTTGCTGCCTTCCTTGCAGGCCGGGCTC
Tursiops_truncatus|15356           AGCTGCCCAGTG---------------GGGCCCCTT------------------------
Canis_familiaris|1819              CCCCCTTTGGCA---------------GCAAGCTTT------------------------
Microcebus_murinus|4087            AGTTGCCTGGCA---------------GGGTCTCTT------------------------
Callithrix_jacchus|33342           AGCCACCCGGCC---------------GGGTCCCTT------------------------
Rhesus_macaque|7906                AGCCACTCGGCT---------------GGGTCTCTT------------------------
Homo_sapiens|21911                 AGCTACCCGGCT---------------GGGTCTCTT------------------------
Pongo_abelii|6638                  AGCCACCCGGCT---------------GGGTCTCTT------------------------
Gorilla_gorilla|13920              AGCCACCCGGCT---------------GGGTCTCTT------------------------
Pan_troglodytes|8842               AGCCACCCGGCT---------------GGGTCTCTT------------------------
Otolemur_garnettii|12725           ------------------------------------------------------------
Spermophilus_tridecemlineatus|1155 AGTCTCCCGGCC---------------GGGTCCCTT------------------------
Danio_rerio|27878                  GTCAAGGGATGT------------------------------------------------
Oryzias_latipes|22623              TCAGCAAACGCTTTTAAAGTTAACCATGGCAGCCTT------------------------
Gasterosteus_aculeatus|7324        GTTTGCCAGCAC------------------------------------------------
Tetraodon_nigroviridis|2918        GTTTGCCAGCAT------------------------------------------------
Fugu_rubripes|37364                GTTTGCCAGCAT------------------------------------------------
                                                                                               

Bombyx_mori|14079                  ---------------------------------------------------------TAT
Nematostella_vectensis|12314       ------------------------------------------------------------
Branchiostoma_floridae|28207       ---TCTGCAGGTGTGTCATCGTTGGCCAGGTGTCTGCACACCTGTCCAGTGCTGGAA---
Sorex_araneus|803                  ------TTCCCGCCGCCCTGTCCG---------------------------------GCC
Xenopus_tropicalis|22987           ------------------------------------------------------------
Anolis_carolinensis|8161           ------------------------------------------------------------
Macropus_eugenii|4057              ---AGCCGGCCGGTGCCCCTGAGGTCCCGCCCCTTCCACGCGGGAGGCGTGGGGCCCCAG
Dasypus_novemcinctus|3623          ---CTGCTTCAAGCGCCCCAGCCATGGCACACATTTCACGCCGGTACCTGGCTGTCTGTC
Vicugna_pacos|12248                ---CTGCTTCAGTCGCCGCAGCCATGGCACACGTTTCACGCTGGGCCCTGGCTGTCGTCC
Monodelphis_domestica|33031        ---ATCTACCCAGCCCTCTCCACCACGTCCTCCTTTTTTGCAAGTTCCCTTTCCCACCTA
Erinaceus_europaeus|4605           ---CTCTCTCGGCCGCCCCCG------------TTTCTCGCTGGCGCCGGCCTGTCTTCG
Dipodomys_ordii|7565               ---CTACCTCCGACGCCCCAGCCATGGCACACGTTTCACGCAGGCCCTTGTCTGTCC---
Choloepus_hoffmanni|2371           ---CTGCTTCAGCCGCCCCAGCCATGGCACACATTTCACGCTGGGACCTGGCTGTTTGTC
Tupaia_belangeri|11603             ---CAGTCA------CTCCAGCCATGGCACACATTTCACTCTGGGCCCTGGATGGCTTCT
Myotis_lucifugus|6026              ---CCGCTTCAGTCGCCGCAGCCATGGCACACCTTTCACGCGGGGCACTGGCTGTCC---
Ochotona_princeps|10887            ---GTGTTTCCTGCGCCCCAGCCACGGCCCACGTTCCACACCGGCCCCCTGCTCTCTTCC
Oryctolagus_cuniculus|20731        ---GTGTTTCAGCCGGCCCAGCCATGGCACGCGGTTCACACGGGGCCCGGGCTGGCTTCC
Echinops_telfairi|2743             ---CGGCGAGAGCCGCCGCCGTCATGGCCCTGGTTTCACAGCGGGCCCACGCCGGCCGCC
Loxodonta_africana|9658            ---CTGCTTCAGCCGCCCCAGCCATGGAACACGTTTCATGTGGGGCCCTCGCTGTCTGAC
Procavia_capensis|17205            ---CTGCTTCAGCCACCCCAGCCATGGCACGCGTTTCACGCTGGGTCCTGGCTGTCTGCC
Equus_caballus|23559               ---TTGCTTCAGTCGCCCGAGCCATGGCACTCATTTCATGCCGGGCGCTGGCTGTCTTCC
Pteropus_vampyrus|2243             ---CTGTTTCAATCGCTTCAGCCATGGCACACATTTCACGCTGGGCCCTGGCTGTCCTCC
Bos_taurus|21593                   CCTCTGCTTCAGTCGCCCCAGCAGTGGCATACTTTTCACTCTGGATCCTGGCTGTCC---
Tursiops_truncatus|15356           ---CTGCTTCAGTCGCCCCAGCCGTGGCATACATTTCACGCTGGGCCCTGGCTGTCCTCC
Canis_familiaris|1819              ---ACAAATCAGGTGATATTTACAGCCTTATTGTTCCACGCGGGTCCATGGCTGTGGTCG
Microcebus_murinus|4087            ---CTGCTTCAGTCGCCTCAGCTGTGGCACACATTTCACGCTGGGTCCTGGCTGTCTTCC
Callithrix_jacchus|33342           ---CTGCGTCAGTCGCCCCAGCCACCGCACACATTTCATGCTGGGCCATGTCTGTCTGCC
Rhesus_macaque|7906                ---CTGCGTCAGTCGCCCCAGCCACGGCACACACTTCATGCTGGGCCCCGTCTGTCTGCC
Homo_sapiens|21911                 ---CTGCGTCAGTCGCCCCAGCCAAGGCACACATTTTATGCTGGGCCCCGTCTGTCTGCC
Pongo_abelii|6638                  ---TTGCGTCAGTCGCCCCAGCCAAGGCACACATTTCATGCTGGGCCCCGTCTGTCTGCC
Gorilla_gorilla|13920              ---CTGCGTCAGTCGCCCCAGCCAAGGCACACATTTCATGCTGGGCCCCGTCTGTCTGCC
Pan_troglodytes|8842               ---CTGCGTCAGTCGCCCCAGCCAAGGCACACATTTCATGCTGGGCCCCGTCTGTCTGCC
Otolemur_garnettii|12725           ------------------------------------------------------------
Spermophilus_tridecemlineatus|1155 ---CGGCTTCAGTCGCCCCAGCCACGGCACACCTTTCACGCTGCGTCCTGGTTGTCTGCC
Danio_rerio|27878                  ---------TTGACGCAGCACGTTCAGTCTCTGTTCACCAGCTGCCCGAGTTTA------
Oryzias_latipes|22623              ------------------------CAGCAGTCTGTACATACTGGAGGTCAGCTCTTT---
Gasterosteus_aculeatus|7324        ------------------------GTGCAGTCCTTGCACACTGGTTGTCAGCTCCTG---
Tetraodon_nigroviridis|2918        ------------------------GTCCAGCCTTTACACACTGGATGTCAGCTCCTG---
Fugu_rubripes|37364                ------------------------GTACAGTCGTTACACACAGGATGTAAACTCCTG---
                                                                                               

Bombyx_mori|14079                  AAAGCAGCTGAATCTTCGCTGCTTGCTAAACTCCGGAAAAAAACGGGCTACACAATCGCT
Nematostella_vectensis|12314       ------ATGGACAAATCATTACTTGGAAAACTTCGTAAAGAAACAGGTTTTGGATTTTCT
Branchiostoma_floridae|28207       ---GGTGTCACCAAAGCCAACCTGTCCAAGCTGCGCAAGAAAACCGGCTTCACATTCGTC
Sorex_araneus|803                  GCCGCCTCCAGCAAGGAGCTGCTCGTGGCGCTGCGCCGGAAGACGGGCTACTCGTTTGTG
Xenopus_tropicalis|22987           ---GCAGCAGACAAGGAGCTCCTGGTGAAACTCAGGAAGAGGACGGGCTACTCGTTTATC
Anolis_carolinensis|8161           ------GCAGCAAAAGAGCTTCTGGTGAAGCTTAGGAAGAAAACTGGTTACTCATATGTG
Macropus_eugenii|4057              GCCGCGTCCAGCAAGGAGCACCTGAAGAAGCTGAGGCGGAAGACCGGCTACTCCTTCACC
Dasypus_novemcinctus|3623          TCGGCCTCCAGCAAGGAGCTCCTTATGAAGCTGCGACGGAAAACGGGTCACTCCTTTGTG
Vicugna_pacos|12248                TCGGCCTCCAGCAAGGAGCTCCTCATGAAGCTGCGGCGGAAAACTGGCTACTCCTTTGTA
Monodelphis_domestica|33031        GTGGTCTCCAGCAAGGAGCACCTGCAGAAGCTGAGGCGGAAGACAGGCTACTCCTTCACC
Erinaceus_europaeus|4605           TCGACCTCCAGCAAGGAGCAACTCTTGAAGCTGCGGCAGAAGACGGGCTACTCCTTTGTA
Dipodomys_ordii|7565               ---TCCTCGGGCAAGGAGCTCCTTATGAAGCTGCGGCGGCGAACAGGCTACTCCTTTGTC
Choloepus_hoffmanni|2371           TCGGCCTCCAGCAAGGAGCTTCTTATGAAGCTACGGCGGAAAACGGGCTACTCCTTTGTG
Tupaia_belangeri|11603             TCGGCCTCCAGCAAGGAGCTCCTCATGAAGCTGCGGCGGAAGACGGGCTACTCCTTTGTA
Myotis_lucifugus|6026              TCGGCCTCCAGCAAGGATCTGCTCATGAAGTTGCGGCGGAAAACGGGCTATTCCTTTGTG
Ochotona_princeps|10887            TCGGCCTCCAGCAAGGAACTGCTCATGAAACTGCGCCGGAAAACGGGCTACTCTTTTGTC
Oryctolagus_cuniculus|20731        TCGGCCTCCAGCAAGGAGCTCCTCATGAAACTGCGGCGGAAAACGGGCTACTCCTTTGTA
Echinops_telfairi|2743             TCGCCGCCCAGCAAGGAGCTGCTCGTGAAGCTGCGGCGGAAAACGGGCTACTCCTTTGTG
Loxodonta_africana|9658            TCGGCTTCCAGCAAGGAGCTCCTCATGAAGCTGCGGCGGAAAACGGGCTACTCTTTTGTG
Procavia_capensis|17205            TCGGCTTACAGCAAGGAGCTCCTCGTGAAGCTACGGCGGAAAACGGGCTACTCTTTTGTG
Equus_caballus|23559               TCGGCCTCCAGCAAGGAGCTCCTCATGAAGCTGCGGCGAAAAACGGGCTACGCCTTTGTA
Pteropus_vampyrus|2243             TCAGTCTCCAGCAAGGAGCTCCTCATGAAGCTGCGGCGAAAAACGGGCTATTCCTTTGTA
Bos_taurus|21593                   TCGGCTTCCAGCAAGGAGCTTCTCATGAAGCTGCGGAGGAAAACGGGCTACTCCTTTATA
Tursiops_truncatus|15356           TCGGCTTCCAGCAAGGAGCTCCTCATGAAGCTGCGGCGGAGAACGGGCTACTCCTTTGTA
Canis_familiaris|1819              TCGGCCCCGAGCAAGGACGCCCTCGTGAAGCTGCGGCGAAGAACAGGCTACTCCTTTGTA
Microcebus_murinus|4087            TCGGCCTCCAGCAAGGAACTTCTCATGAAATTGCGGCGGAAGACGGGCTACTCCTTTGTA
Callithrix_jacchus|33342           TCGGCCTCCAGCAAGGAGCTCCTCATGAAACTGCGGCGGAAAACAGGCTACTCTTTTGTA
Rhesus_macaque|7906                TCGGCCTCCAGCAAGGAGCTCCTCATGAAACTGCGGCGGAATACAGGCTACTCCTTTGTA
Homo_sapiens|21911                 TCGGCCTCCAGCAAGGAGCTCCTCATGAAGCTGCGGCGGAAAACAGGCTACTCCTTTGTA
Pongo_abelii|6638                  TCGGCCTCCAGCAAGGAGCTCCTCATGAAGCTGCGGCGGAAAACAGGCTACTCTTTTGTA
Gorilla_gorilla|13920              TCGGCCTCCAGCAAGGAGCTCCTCATGAAGCTGCGGCGGAAAACAGGCTACTCCTTTGTA
Pan_troglodytes|8842               TCGGCCTCCAGCAAGGAGCTTCTCATGAAGCTGCGGCGGAAAACAGGCTACTCCTTTGTA
Otolemur_garnettii|12725           ------------------------------------------------------------
Spermophilus_tridecemlineatus|1155 TCTTCTTCCAGCAAGGAGCTCCTTATGAAGCTGCGGCAGAAAACAGGCTACTCCTTTGTA
Danio_rerio|27878                  ---GCAGCAGACAAAGCGCTTCTACTGCAGCTACGCAAATCTACGGGCTACACATTCGTC
Oryzias_latipes|22623              ---GCAGCGGACAAAGCTTTGCTGATGAAACTGCGGAAAAGCACTGGCTACACTTTCATC
Gasterosteus_aculeatus|7324        ---GCAGCAGAGAAAGCCCTCCTGATGAAACTGCGGAAAACCACCGGCTACACTTTCATC
Tetraodon_nigroviridis|2918        ---GCAGCAGAGAAGGCTCTCCTGATGAAGCTGCGCAAAAACACCGGCTACACCTTTACT
Fugu_rubripes|37364                ---GCAGCAGAGAAGGCTCTCCTGATGAAACTACGAAAAAACACCGGCTACACCTTCACC
                                                                                               

Bombyx_mori|14079                  AATTGCAAGAAAGCATTAGAAATGCATAATAATGATGCAGATAAGGCTGAGACATGGCTC
Nematostella_vectensis|12314       AAGTGTCGGGAAGCCTTGGTACTGGCAAGGAATGATTACGCTGCGGCAGAGGCATGGTTG
Branchiostoma_floridae|28207       AACTGTAGGAAGGCACTGGAGAAGTTTGAAAATGACTTAGAGCAGGCAGAGAAGTGGCTG
Sorex_araneus|803                  AACTGCAAGAAGGCGCTGGAGACGTGCGGCGGGGATCTCCAGCAGNNNNNNNNNNNNNNN
Xenopus_tropicalis|22987           AACTGCAAGAAGGCTCTGGAACAATTTAGCAATGATTTTAAACAAGCAGAGACGTGGCTG
Anolis_carolinensis|8161           AACTGTAAGAAAGCCTTGGAAAAATTTGATGATGACCTTAAAGAGGCTGAAATCTGGCTG
Macropus_eugenii|4057              AACTGCAAGAAAGCGCTGGAGACTTGTGGTGGCGATCTGGCCCAGGCAGAAGCTTGGCTA
Dasypus_novemcinctus|3623          AACTGCAAGAAAGCTCTGCAGGCTTGTGGCGAGGATCTCAAACAGGCAGAGAGCTGGCTC
Vicugna_pacos|12248                AACTGCAAGAAAGCTCTGGAGACTTGTGGCGGGGATCTCAAGCAGGCCGAGAGCTGGCTC
Monodelphis_domestica|33031        AACTGTAAGAAAGCGCTGGAAAATTGTGGTGGAGACCTGACCCAGGCAGAAGCTTGGCTA
Erinaceus_europaeus|4605           AACTGCAAGAAAGCTCTGGAGACGTGCGGCGGGGATCTCAGACAGGCAGAGACTTGGCTC
Dipodomys_ordii|7565               AACTGCAAGAAAGCTCTGGAGACCTGTGATGGGGATCTCAAACAGGCTGAGATGTGGCTT
Choloepus_hoffmanni|2371           AACTGCAAGAAAGCTCTGGAGACTTGTGGCGAGGATCTCAAACAGGCAGAGAGCTGGCTC
Tupaia_belangeri|11603             AACTGCAAAAAAGCTCTGGAGACTTGTGGCGGGGATCTGAAACAGGCAGAGATCTGGCTC
Myotis_lucifugus|6026              AACTGCAAGAAAGCCCTGGAGACTTGCGGCGGGGATCTCAGACAGGCAGAGAGCTGGCTT
Ochotona_princeps|10887            AACTGCAAGAAAGCCCTGGAGACTTGCGGCGGGGATTTGAAGCAGGCAGAGACATGGCTC
Oryctolagus_cuniculus|20731        AACTGCAAGAAAGCTCTGGAGAGTTGCGGCGGGGACCTCAAGCAGGCGGAGACCTGGCTG
Echinops_telfairi|2743             AACTGCAAGAAAGCTCTGGACACGTGTGGTGGGGATCTCAAAGAGGCAGAAAGTTGGCTC
Loxodonta_africana|9658            AACTGCAAGAAAGCTCTGGAGGCTTGTGGCGGGGATCTCAAAGAGGCAGAGAGTTGGCTC
Procavia_capensis|17205            AACTGCAAGAAAGCTTTGGAGACTTGTGGCGGGGATCTCAAAGAAGCAGAGAGTTGGCTC
Equus_caballus|23559               AACTGCAAGAAAGCTCTGGAGGCTTGTGGCGGGGATCTCAAAAAGGCAGAGAGCTGGCTC
Pteropus_vampyrus|2243             AACTGCAAGAAAGCTCTGGAGACTTGTGGCGGGGATCTCAAACAGGCAGAGAGCTGGCTC
Bos_taurus|21593                   AACTGCAAGAAAGCCCTGGAGACTTGTGGCGGGGATCTCAAACAGGCAGAGAGCTGGCTC
Tursiops_truncatus|15356           AACTGCAAGAAGGCTCTGGAGACTTGTGGCGGGGATCTCAAACAGGCAGAGAGCTGGCTC
Canis_familiaris|1819              AACTGCAAGAAGGCTCTGGAGGCCTGCGGCGGGGATCTCAAGCAGGCAGAGAGCTGGCTG
Microcebus_murinus|4087            AATTGCAAGAAAGCTCTAGAGACTTGTGGCGGGGATCTCAAACAGGCTGAGGTCTGGCTC
Callithrix_jacchus|33342           AATTGCAAGAAAGCTCTGGAGACTTGTGGCGAGGACCTCAAACAGGCAGAGATCTGGCTC
Rhesus_macaque|7906                AATTGCAAGAAAGCTCTGGAGACTTGTGGCGGGGACCTCAAACAGGCAGAGATCTGGCTC
Homo_sapiens|21911                 AATTGCAAGAAAGCTCTGGAGACTTGTGGCGGGGACCTCAAACAGGCAGAGATCTGGCTC
Pongo_abelii|6638                  AATTGCAAGAAAGCTCTGGAGACTTGTGGCGGGGACCTCAAACAGGCAGAGATCTGGCTC
Gorilla_gorilla|13920              AATTGCAAGAAAGCTCTGGAGACTTGTGGCGGGGACCTCAAACAGGCAGAGATCTGGCTC
Pan_troglodytes|8842               AATTGCAAGAAAGCTCTGGAGACTTGTGGCGGGGACCTCAAACAGGCAGAGATCTGGCTC
Otolemur_garnettii|12725           ---------------------------------------------GCAGAGATCTGGCTC
Spermophilus_tridecemlineatus|1155 AATTGCAAGAAAGCTCTGGAAACTTGTGGTGGAGATCTCAAAAAGGCAGAGATCTGGCTT
Danio_rerio|27878                  AACTGCAAAAAGGCCCTGGAGAAATGCAACAATGACATAACACAGGCAGAAAGCTGGCTT
Oryzias_latipes|22623              AACTGCAAGAAAGCTCTGGAGATGTTTGATAATGATCCTGCTCAGGCTGAAAGCTGGCTG
Gasterosteus_aculeatus|7324        AACTGCAAGAAAGCCCTGGAGAGGTTTGATAACGACATAACACAGGCAGAGACCTGGCTG
Tetraodon_nigroviridis|2918        AATTGCAAGAAAGCACTGGAGAAGTTTGACAATGACCTTacacagGCTGAGACTTGGTTA
Fugu_rubripes|37364                AACTGCAAAAAAGCCCTGGAGAAGTTTGACAATGACGTCACACAGGCTGAAACCTGGTTG
                                                                                .  .     ... . 

Bombyx_mori|14079                  CATGAACAAGCCCAAGCAATGGGATGGGCAAAGGCAACTAAATTAGCTGGCAGGACGGCC
Nematostella_vectensis|12314       CATGAGCAAGCAGAGAAAGAGGGCTGGCAGAAAGCCAATAAACTGCAGGGTCGCTCAGCA
Branchiostoma_floridae|28207       AAGGAACAGGCACAGAAGGAGGGCTGGGCTAAAGCTACCAAACTACAGGACAGGCAGACT
Sorex_araneus|803                  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|22987           CACCAACAAGCTCAGAAAGAAGGCTGGGACAAGGCTTCCAAACTTCAAGGAAGAAAAACT
Anolis_carolinensis|8161           CATGAACAAGCCCAAAAGGAGGGATGGAGCAAAGCTTCCAAACTGCAAGGGAGGAAGACG
Macropus_eugenii|4057              CATAAGCAGGCCCAGAAGGAAGGATGGAGCAAAGCTGCTAAACTTCAGGGAAGAAAAACT
Dasypus_novemcinctus|3623          CACGAGCAGGCCCAGAAGGAAGGCTGGAGCAAAGCTGCCAAACTCCATGGAAGGAAGACT
Vicugna_pacos|12248                CACAAGCAGGCCCAGAAGGAGGGCTGGAGTAAAGCTGCCAAGCTCCATGGGAGGAAGACT
Monodelphis_domestica|33031        CATAAGCAGGCCCAGAAAGAAGGATGGAGCAAAGCTACCAAACTTAAGGGGAGAAAAACT
Erinaceus_europaeus|4605           CATGAGCAAGCCCAGAAGGAAGGCTGGAGCAAAATCTCCAAGCTCCAGGGAAGGAAGACG
Dipodomys_ordii|7565               CACAAGCAAGCCCAGAAAGAGGGCTGGAGCAAAGCTGCCAAGCTCCATGGAAGGAAGACC
Choloepus_hoffmanni|2371           CACAAGCAGGCACAGAAGGAGGGCTGGAGCAAAGTTGCCAAACTCCATGGGAGAAAGACT
Tupaia_belangeri|11603             CACAAGCATGCCCAGAAGGAGGGCTGGAGCAAAGCTGCCAAGCTCCATGGAAGAAAGACC
Myotis_lucifugus|6026              CATGAGCAGGCCCAGAAGGAGGGCTGGGGCAAAGCTGCCAAGCTCCATGGAAGGAAGACT
Ochotona_princeps|10887            CAGCAGCAGGCCCAGAAGGAGGGCTGGAGCAAAGCTGCCAAGCTGCATGGGAGGAAGACC
Oryctolagus_cuniculus|20731        CACAAGCAGGCGCAGAAGGAGGGCTGGAGCAAAGCGGCCAAGCTGCATGGGAGGAAGACC
Echinops_telfairi|2743             CACCAGGAGGCCCAGAAGGAGGGCTGGAGCAAAGCTATCAAGCTCCATGGGAGGAAGACC
Loxodonta_africana|9658            CACAAGCAGGCCCAGAATGAGGGCTGGAGCAAAGCTGTCAAACTCCAAGGGAGGAAGACT
Procavia_capensis|17205            CACAAGCAGGCCCAAAAGGAGGGCTGGAGCAAAGCTGTCAAACTCCATGGGAGGAAGACT
Equus_caballus|23559               CATAAGCAGGCCCAGAAGGAGGGCTGGAGCAAAGCTGCCAAGCTCCATGGGAGAAAGACT
Pteropus_vampyrus|2243             CATGAGCAGGCCCAGAAGGAGGGCTGGAGCAAAGCTGCCAAGCTTCATGGAAGGAAGACT
Bos_taurus|21593                   CATAAGCAGGCCCAGAAGGAGGGCTGGAGTAAAGCTGCTAGGCTCCATGGGAGGAAGACC
Tursiops_truncatus|15356           CACAAACAGGCCCAGAAGGAGGGCTGGAGTAAAGCTGCCAGGCTCCATGGCAGGAAGACC
Canis_familiaris|1819              CACAAGCAGGCCCAGAAGGAAGGCTGGAGCAGAGCTGCCAAACTCCACGGCAGGAAGACT
Microcebus_murinus|4087            CACAAGCAGGCCCAGCAGGAGGGCTGGAGCAAAGCTGCCAAGCTCCATGGGAGGAAGACT
Callithrix_jacchus|33342           CACAAGCAGGCCCAGAAGGAGGGCTGGAGCAAAGCTGCCAAGCTCCAAGGGAGGAAGACC
Rhesus_macaque|7906                CACAAGCAGGCCCAGAAAGAGGGCTGGAGCAAAGCTGCCAAGCTCCAAGGGAGAAAGACC
Homo_sapiens|21911                 CACAAGGAGGCCCAGAAGGAGGGCTGGAGCAAAGCTGCCAAGCTCCAAGGGAGGAAGACC
Pongo_abelii|6638                  CACAAGGAGGCCCAGAAGGAGGGCTGGAGCAAAGCTGCCAAGCTCCAAGGGAGGAAGACC
Gorilla_gorilla|13920              CACAAGGAGGCCCAGAAGGAGGGCTGGAGCAAAGCTGCCAAGCTCCAAGGGAGGAAGACT
Pan_troglodytes|8842               CACAAGGAGGCCCAGAAGGAGGGCTGGAGCAAAGCTGCCAAGCTCCAAGGGAGGAAGACC
Otolemur_garnettii|12725           CACAAGCAGGCCCAGAAGGAGGGCTGGAGCAAAGCTGCCAAGCTCCAGGGAAGGAAGACT
Spermophilus_tridecemlineatus|1155 CACAAGCAGGCCCAGAAGGAGGGCTGGAGCAAAGCTACCAAGCTCAGTGGGAGAAAGACT
Danio_rerio|27878                  CACGGACAAGCAAAAAAAGAGGGCTGGAGTAAAGCGACCAAACTGGAAGGTCGGAAAGCC
Oryzias_latipes|22623              CACGAACAGGCTCAGAAGGAGGGCTGGAGCAAAGCTAACAAGCTGGAGGGCCGAAAAGCC
Gasterosteus_aculeatus|7324        CACGCGGAGGCCCAGAAGGAGGGCTGGAGCAGAGCGAGCAAGCTGGAGGGTCGCAAAGCC
Tetraodon_nigroviridis|2918        CATGAACAGGCCCAGAAAGAGGGCTGGAGCAAAGCAAACAAGCTGGAAGGCCGAAAAACC
Fugu_rubripes|37364                CACGAACAGGCTCAGAAAGAGGGCTGGACCAAAGCAAACAAGCTGGAAGGACGAAAAACC
                                            .           .. ...                .    .   .       

Bombyx_mori|14079                  CTCCAGGGGTTGGTAGCTGTTAAG---------TTTGACAAGAACCATGGTGCTCTGGTG
Nematostella_vectensis|12314       ACAGAGGGCCTAATTGGAGTGATAGTCAACCACAGTGACATGAACTTGGGGGCAATGGTG
Branchiostoma_floridae|28207       GCACAGGGGCTGGTGGGCGTGGCT---------CAGGAGGGCACCATGGCAACCATGGTG
Sorex_araneus|803                  NNNNNN------------------------------------------------------
Xenopus_tropicalis|22987           ACAGAAGGTCTTGTGGGGCTGCTG---------CAAGATGGCAACACATCTGTGATGGTG
Anolis_carolinensis|8161           AAGGAAGGGCTGATAGGGCTGCTA---------CAGGAGGGGAACTCGGCTGTGATGGTG
Macropus_eugenii|4057              AAGGAGGGACTGATTGGATTGTTA---------CGGGAAGGGAATTCAGCTGTAATGGTG
Dasypus_novemcinctus|3623          AGGCAAGGCCTGATTGGTTTGCTG---------CAGGAAGGAAACACGACTGTGTTAGTA
Vicugna_pacos|12248                AAAGAAGGACTGATTGGGTTGCTG---------CAGGAAGGAAACACGAGTGTGTTAGTA
Monodelphis_domestica|33031        AAAGAAGGGCTGATTGGATTGTTA---------CAAGAAGGAAATTCAGCTGTAATGGTA
Erinaceus_europaeus|4605           AAAGAAGGGCTGATCGGGCTGCTG---------CAGGAGGAAAATGCGGCTGTGTTAGTA
Dipodomys_ordii|7565               AAAGAAGGCTTGATTGGGCTGCTA---------CACGAAGGAAACACAGCTGTATTAGTG
Choloepus_hoffmanni|2371           AAAGAAGGCCTCATTGGTCTGCTG---------CAGGAAGGGAACACGACTGTGTTAGTA
Tupaia_belangeri|11603             AAAGAAGGCTTGATTGGGCTGCTG---------CTGGAAGGAAACACGACTGTATTAGTA
Myotis_lucifugus|6026              AAAGAAGGTCTGATCGGGCTGCTG---------CAGGAAGGAAACTCGACTGTGTTAGTT
Ochotona_princeps|10887            AGGGAGGGCTTAATCGGTCTGCTG---------CAGGAAGGAAATGCCACCGTGCTGGTC
Oryctolagus_cuniculus|20731        AGGGAGGGCCTCATTGGGCTGCTG---------CAGGAGGGAAACGCGGCTGTGCTGGTC
Echinops_telfairi|2743             AAGGAAGGCTTGATTGGGCTGCTG---------CAGGAAGGCAACACAGCTGTGTTAGTG
Loxodonta_africana|9658            AAAGAAGGCTTGATTGGGCTGCTG---------CAGGAAGGAAACACAACTGTGTTAGTA
Procavia_capensis|17205            AAAGAAGGCTTGGTTGGGCTGCTG---------CAGGAAGGAAACACATCTGTGTTAGTA
Equus_caballus|23559               AAAGAAGGGCTGATTGGGCTGCTG---------CAGGAAGGAAACACGACAGTGCTAGTA
Pteropus_vampyrus|2243             AAAGAAGGCCTGATTGGGTTGCTA---------CAGGAAGGAAGCACGACTGTGTTAGTA
Bos_taurus|21593                   AAAGAAGGTCTGATTGGGCTGCTG---------CAGGAAGGAGACACAACTGTGTTAGTA
Tursiops_truncatus|15356           AAAGAAGGTCTGATTGGGCTGCTG---------CAGGAAGGAAACACGACTGTGTTAGTA
Canis_familiaris|1819              AAAGAAGGCCTGATTGGGCTGCTT---------CAGGATGGAAACGCAACCGTGTTGGTA
Microcebus_murinus|4087            AAAGAAGGCCTGATTGGGCTGTTG---------CAGGAAGGAAACGTGACTGTATTAGTA
Callithrix_jacchus|33342           AAAGAAGGCCTGATTGGACTGTTG---------CAGGAAGGAAACATAACTGTATTAGTA
Rhesus_macaque|7906                AAAGAAGGCCTGATTGGGCTGTTG---------CAGGAAGGAAACACAACTGTATTAGTA
Homo_sapiens|21911                 AAAGAAGGCCTGATTGGGCTGTTG---------CAGGAAGGAAACACAACTGTATTAGTA
Pongo_abelii|6638                  AAAGAAGGCCTGATTGGGCTGTTG---------CAGGAAGGAAACACAACTGTATTAGTA
Gorilla_gorilla|13920              AAAGAAGGCCTGATTGGGCTGTTG---------CAGGAAGGAAACACAACTGTATTAGTA
Pan_troglodytes|8842               AAAGAAGGCCTGATTGGGCTGTTG---------CAGGAAGGAAACACAACTGTATTAGTA
Otolemur_garnettii|12725           AAAGAAGGCCTGATTGGGCTGTTG---------CAGGAAGGAAATGCGACTGTATTAGTA
Spermophilus_tridecemlineatus|1155 AAAGAAGGACTGATTGGGCTGCTG---------CAAGAAGGAAATACTACTGTATTAGTA
Danio_rerio|27878                  AAAGAAGGACTGATTGGTCTCATG---------ATGCATGACAATGCTGCCGTCATGGTT
Oryzias_latipes|22623              AAAGAGGGTCTGATTGGTGTGTTT---------GTAGGAGATGCAGCTGCAGTCATGGTG
Gasterosteus_aculeatus|7324        AAAGAGGGGCTGGTTGGCCTGTTT---------ATACAAGACACGGCTGCAGTTATGGTT
Tetraodon_nigroviridis|2918        AAAGAGGGCCTGATAGGTTTGTTT---------ATAGGAGACAACGAAGCAGTGATGGTC
Fugu_rubripes|37364                AAAGAGGGCCTCGTAGGTTTGTTC---------ATTGGAAACAACGAAGCAGTGATGGTG
                                                                                               

Bombyx_mori|14079                  GAACTCAACTGTGAAACTGATTTTGTGGCCAAGAACGACAAGTTTCAGAAAATGATTGAA
Nematostella_vectensis|12314       GAGGTAAATTGTGAGACCGACTTTGTGGCAAGAAATGAGAACTTTGTTGACTTGGTCAAC
Branchiostoma_floridae|28207       GAGGTGAACTGTGAGACAGACTTCGTGGCCAGGAACCCCAAGTTCCGCCAGCTGGTCACG
Sorex_araneus|803                  ------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGGTC
Xenopus_tropicalis|22987           GAAGTTAACTGCGAAACTGACTTTGTTGCCAGGAATTCAAAGTTTCAGCAGCTAGTTCAG
Anolis_carolinensis|8161           GAGGTAAACTGTGAAACAGACTTTGTGGCCCGAAATGCCAGGTTTCAACACCTTGTTCAA
Macropus_eugenii|4057              GAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dasypus_novemcinctus|3623          GAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Vicugna_pacos|12248                GAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Monodelphis_domestica|33031        GAGGTGAATTGTGAGACAGATTTTGTTTCTAGAAATGTAAAGTTTCAACAACTGGTCCAG
Erinaceus_europaeus|4605           GAGGTCAACTGTGAGACAGATTTTGTTTCCAGAAATTCAAATTTTCAGCACTTGGTCCAG
Dipodomys_ordii|7565               GAGGTAAACTGTGAGACAGACTTTGTTTCCAGAAATTTAAAATTTCAACAGTTGGTCCAG
Choloepus_hoffmanni|2371           GAGGTAAACTGTGAAACAGATTTTGTTTCCAGAAACTTAAAATTTCAACAGTTGGTCCAT
Tupaia_belangeri|11603             GAGGTAAACTGTGAGACAGATTTTGTTTCTAGAAATTTAAAATTTCAGCAGTTGGTCCAG
Myotis_lucifugus|6026              GAGGTAAACTGTGAGACAGATTTTGTTGCAAGAAATCTAAAATTTCAACAGTTGGTCCAG
Ochotona_princeps|10887            GAGGTGAACTGTGAGACGGATTTTGTTTCCAGAAATGTAAAATTTCAGCAGTTGGTGCAG
Oryctolagus_cuniculus|20731        GAGGTAAACTGTGAGACAGATTTTGTTTCCAGAAATTTGAAGTTTCAGCAGTTGGTCCAG
Echinops_telfairi|2743             GAGGTAAACTGTGAGACAGATTTTGTTTCCAGAAATTCAAAATTTCAACAGTTGGTCCAG
Loxodonta_africana|9658            GAGGTAAACTGTGAGACAGATTTTGTTTCCAGAAATTCAAAATTTCAACAGTTGGTCCAG
Procavia_capensis|17205            GAAGTAAACTGTGAAACAGATTTTGTTTCCAGAAATTCAAAATTTCAACAGTTGGTCCAG
Equus_caballus|23559               GAGGTAAACTGTGAGACAGATTTTGTTTCCAGAAATTTGAAATTTCAGCAGTTGGTCCAG
Pteropus_vampyrus|2243             GAGGTAAACTGTGAGACAGATTTTGTTTCCAGAAATCTAAAATTTCAACAGTTGGTCCAG
Bos_taurus|21593                   GAGGTGAACTGTGAGACAGATTTTGTTTCCAGAAATTTAAAATTTCAACAGTTGGTCCAG
Tursiops_truncatus|15356           GAGGTGAACTGTGAGACAGATTTTGTTTCCAGAAATTTAAAATTTCAACAATTGGTCCAG
Canis_familiaris|1819              GAGGTAAACTGTGAGACAGATTTTGTTTCCAGAAATTTAAAATTTCAACAGTTGGTCCAG
Microcebus_murinus|4087            GAGGTAAACTGTGAGACAGATTTTGTTTCCAAGAACTTAAGATTTCAACAGCTGGTCCAG
Callithrix_jacchus|33342           GAGGTAAACTGTGAGACGGATTTTGTTTCTAGAAATTTAAAATTTCAACAGTTGGTCCAG
Rhesus_macaque|7906                GAGGTAAACTGTGAGACAGATTTTGTTTCTAGAAATTTAAAATTTCAACAGTTGGTCCAG
Homo_sapiens|21911                 GAGGTAAACTGTGAGACAGATTTTGTTTCTAGAAATTTAAAATTTCAACTGTTGGTCCAG
Pongo_abelii|6638                  GAGGTAAACTGTGAGACGGATTTTGTTTCTAGAAATTTAAAATTTCAACAGTTGGTCCAG
Gorilla_gorilla|13920              GAGGTAAACTGTGAGACAGATTTTGTTTCTAGAAATTTAAAATTTCAACTGTTGGTCCAG
Pan_troglodytes|8842               GAGGTAAACTGTGAGACAGATTTTGTTTCTAGAAATTTAAAATTTCAACTGTTGGTCCAG
Otolemur_garnettii|12725           GAGGTAAACTGTGAGACAGATTTTGTTTCCAGAAATTTAAGATTTCAACAGCTCGTCCAG
Spermophilus_tridecemlineatus|1155 GAGGTAAACTGTGAGACAGATTTTGTTTCCAGAAATTTAAAATTTCAACAGTTGGTCCAG
Danio_rerio|27878                  GAGGTTAACTGCGAGACAGACTTTGTGGCGAGGAATGAGAAATTTCAGCAGCTGGTGAAG
Oryzias_latipes|22623              GAGGTCAACTGTGAGACAGACTTTGTTGCCAGAAATGACAAGTTCCAACAGCTGGTAAAA
Gasterosteus_aculeatus|7324        GAGGTTAACTGTGAGACCGACTTTGTAGCCCGTAATGACAAGTTCCAGCAGCTGGTTAAA
Tetraodon_nigroviridis|2918        GAGGTTAATTGTGAAACAGACTTTGTGGCTCGCAATGAGAAGTTCCAGCAGCTGGTCAAG
Fugu_rubripes|37364                GAGGTTAACTGTGAGACAGATTTTGTGGCTCGCAATGAGAAGTTCCAGCAGCTGGTGAAG
                                            .. .     .  .. ..                ..        .  .    

Bombyx_mori|14079                  GATGCAGCTATAGCCTCATTC---AAATTCGCTCATACTAAACTGCAAGCTAAAGGACCT
Nematostella_vectensis|12314       ACTGTAACAAGTACAACTCTG---GCATACCGGCGAGGCATAATCCAGCGCAATCAAAAG
Branchiostoma_floridae|28207       CAGGTTGCCATGGCAACACTC---GGTGATGTCAAAGCTCACCCGCAGTGGACCCTGGGC
Sorex_araneus|803                  AATGTAGCCCTTGGAACCATG---TCTCACCGTCAGAGCTCAAATGATCAAATTTCAACA
Xenopus_tropicalis|22987           CAGGTGGCTGTGAGCACTCTG---AGGCATTGCCAGAGTCATCAGGAGAACATGTCTTCT
Anolis_carolinensis|8161           CAAGCAGCAATTGGAACAATG---CACCATTATCAGGGGACCATGAACCAGTTAAACACA
Macropus_eugenii|4057              NNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dasypus_novemcinctus|3623          NNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Vicugna_pacos|12248                NNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Monodelphis_domestica|33031        CAAGTGGCCCTGGGAACCATG---CTGTACTGTCAGAGCCTGAGGGAACAGCTCTCCTCA
Erinaceus_europaeus|4605           CAAGTAGCCCTGGGAGCCATG---CTGCATTGTCAGAGCCTGACGGAGCAACTCTCCACA
Dipodomys_ordii|7565               AAAGTAGCCCTGGGAACCATG---CTGCATTGTAAGAATCTAAAGGATCAACTCTCCACA
Choloepus_hoffmanni|2371           CAAGTAGCCCTTGGAACCATG---TTGCATTGTCAGAGCCTAAAGGATGAACTCTCCACG
Tupaia_belangeri|11603             CAAGTAGCCCTTGGAACCATG---TTGCATTGTCAGAGCCTCAAGGATCAACTCTCCACA
Myotis_lucifugus|6026              CAAGTAGCCCTTGGAACCATG---TTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|10887            CAGGTGGCCCTGGGCACCATG---TTGCACTGTCAGAGCCAACAGGATCAGCTCTCCACA
Oryctolagus_cuniculus|20731        CAAGTGGCCCTGGGAGCCATG---CTGCACTGTCGGAGCCTGGAGGAGCAGCCGTCCACA
Echinops_telfairi|2743             CAAGTAGCTGTTGGAACCTTG---CTGCATTGTCAGAGCCTTAAGGAGCAACTCCCCACA
Loxodonta_africana|9658            CAAGTAGCAGTTGGAACCTTG---CTGCATTGTCAGAACCTAAAGGATCAACTGTCCACA
Procavia_capensis|17205            CAAGTAGCTGTTGGAACCTTG---CTGCACTGTCAGAGCCTAAAGGATCAACTCTCTACA
Equus_caballus|23559               CAAGTAGCCCTTGGAACCATG---TTGCATTGTCAGAGCCTAAAGGATCAACTCTCCTCG
Pteropus_vampyrus|2243             CAAGTAGCCCTTGGAACCATA---TTGCATTGCCAGAGCCTAAAAAGTCAACTCTCCACG
Bos_taurus|21593                   CAAGTAGCCCTGGGAACCCTG---TTGCATTGTCAGAACTTAAAGGATCAACTCTCCACA
Tursiops_truncatus|15356           CAAGTAGCCCTGGGAACCCTG---TTGCATTGTCAGAGCCTAAAGGATCAACTGTCTACA
Canis_familiaris|1819              CAAGTCGCCCTGGGAACCTTG---TTGCATTGTCAGAACCTAAAGGATCAACTCTCCACA
Microcebus_murinus|4087            CAAGTAGCCCTTGGAACCATG---CTACATTGTCAGAGCCTAAAGGATCAAGTCTCCACC
Callithrix_jacchus|33342           CAAGTAGCCCTTGGAACCATG---ATGCATTGTCAGAACTTAAAGGATCAACTGTCTACA
Rhesus_macaque|7906                CAAGTTGCCCTTGGAACCATG---ATGTATTGTCAGAGCCTAAAGGATCAGCTCTCTACA
Homo_sapiens|21911                 CAAGTAGCCCTTGGAACCATG---ATGCATTGTCAGACCCTAAAGGATCAACCCTCTGCA
Pongo_abelii|6638                  CAAGTAGCCCTTGGAACCATG---ATGCATTGTCAGACCCTAAAGGATCAACCCTCTACA
Gorilla_gorilla|13920              CAAGTAGCCCTTGGAACCATG---ATGCATTGTCAGACCCTAAAGGATCAACCCTCTACA
Pan_troglodytes|8842               CAAGTAGCCCTTGGAACCATG---ATGCATTGTCAGACCCTAAAGGATCAACCCTCTACA
Otolemur_garnettii|12725           CAAGTAGCCCTCGGAACCATG---CTGCACTGTCAGAACCTGAAGGAGCAAGTCTCCACA
Spermophilus_tridecemlineatus|1155 CAGGTAGCCCTGGGAACCATG---TTGCATTGTCGGAGCCTAAAGGATCAACTCTCCACG
Danio_rerio|27878                  GATGTTGCATTGTCAGTAATG---GCTCATCAA------TCTACCAGCAAAAAAACTGGG
Oryzias_latipes|22623              GATGTGACCTTTGCCACTTTGGATCACCATCTTCAGAGTAGAAATCAGTCTAAATCAGGA
Gasterosteus_aculeatus|7324        GATGTGGCATTTGCCACCTTG---GCTCACCACCGGAATAAAACCCAAAGCAAGACCGGC
Tetraodon_nigroviridis|2918        GACGTGGCCATGGCCACCCTG---GCTCACCGT------CCGAAGAAAGGCCAAGCAGGA
Fugu_rubripes|37364                AACGTGGCGTTTGCCTCCCTG---GCTCACCGTCAGAAAAAAGACCAAGCA------GGA
                                      .               .                                        

Bombyx_mori|14079                  ATAACAAAAGGTGTATATATAGTGGATAGTGGAAGCCGAGGAGTCTGGGCATGGATA---
Nematostella_vectensis|12314       TTGAATATGTTTGGTGATCAAGTGACGCATCTCAGG------------------------
Branchiostoma_floridae|28207       TGGCTTAAG---------------------------------------------------
Sorex_araneus|803                  TACAGTGGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|22987           TATGTAAAG---------------------------------------------------
Anolis_carolinensis|8161           TATGCGAAG---------------------------------------------------
Macropus_eugenii|4057              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dasypus_novemcinctus|3623          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Vicugna_pacos|12248                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Monodelphis_domestica|33031        TATAGGAAG---------------------------------------------------
Erinaceus_europaeus|4605           TATAGGAAG---------------------------------------------------
Dipodomys_ordii|7565               TATAGTAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|2371           TATAGTAAA---------------------------------------------------
Tupaia_belangeri|11603             TACAGCAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Myotis_lucifugus|6026              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|10887            TACAGGAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Oryctolagus_cuniculus|20731        TACAGCAAGGTGAGTCTGGGCTCGGCCCCGGCGCCGGGCCTTTGGGCTCCTCTTTGTCCC
Echinops_telfairi|2743             TACAGTAAA---------------------------------------------------
Loxodonta_africana|9658            TACAGTAAA---------------------------------------------------
Procavia_capensis|17205            TACAGTAAAGTGTGGTTAAATACTGTAGCGGCCAATGGAAAG------------------
Equus_caballus|23559               TACAGTAAA---------------------------------------------------
Pteropus_vampyrus|2243             TATAGTAAA---------------------------------------------------
Bos_taurus|21593                   TACAGTAAA---------------------------------------------------
Tursiops_truncatus|15356           TATAGTAAA---------------------------------------------------
Canis_familiaris|1819              TACAGTAAA---------------------------------------------------
Microcebus_murinus|4087            TACAGTAAA---------------------------------------------------
Callithrix_jacchus|33342           TACAGTAAA---------------------------------------------------
Rhesus_macaque|7906                TACAGTAAAGTAAgatggcttacgcctgtaatcccagcactttgggaggctaaagcagga
Homo_sapiens|21911                 TACAGTAAA---------------------------------------------------
Pongo_abelii|6638                  TACAGTAAA---------------------------------------------------
Gorilla_gorilla|13920              TACAGTAAA---------------------------------------------------
Pan_troglodytes|8842               TACAGTAAAGTGCAGTGGCTCACGCCTGTAAACCTAGCACTTTGGGAGGCTGAAGCAGGT
Otolemur_garnettii|12725           TACAGTAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|1155 TACAGTAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Danio_rerio|27878                  TTTATTAAG---------------------------------------------------
Oryzias_latipes|22623              TACGTGAAG---------------------------------------------------
Gasterosteus_aculeatus|7324        TATGTCAAG---------------------------------------------------
Tetraodon_nigroviridis|2918        TACGTAAAG---------------------------------------------------
Fugu_rubripes|37364                TATGTAAAG---------------------------------------------------
                                                                                               

Bombyx_mori|14079                  ------------------GGACCACAAGCGACAGGTCCTGGTAAGCGTGGTGCTTTGGCA
Nematostella_vectensis|12314       ------------------GAATTCATCCTAACACATGAACTAAGTAATCTCAGAGTGGAA
Branchiostoma_floridae|28207       ------------------GCCCTCCACACAGGCGAGGAGCTGAAGCAGCTGCAGATAGGA
Sorex_araneus|803                  NNNNNNNNNNNN------GGCTTCTTGAATTCCTCGGAGCTCTCCGAACTCCCCGCTGGG
Xenopus_tropicalis|22987           ------------------GGTTTTCTAAGCGGTGAAGAACTCTTACAAATGAAAGCT---
Anolis_carolinensis|8161           ------------------TGTTTGTTAAAATCGAATGAGCTTTCTCAACTGAAGATTGGA
Macropus_eugenii|4057              NNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dasypus_novemcinctus|3623          NNNNNNNNNNNN------GGCTTCTTGAATTCCTCCGAGCTCTGTGGACTTCGAGCTGGG
Vicugna_pacos|12248                NNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Monodelphis_domestica|33031        ------------------GGTTTTCTAGAGACAGCTGAACTTTCTCAGCTTAGAGCTGGA
Erinaceus_europaeus|4605           ------------------GGCTTCTTGAGTTCTTCTGAGCTTTCTGAACTTCCAGCTGGG
Dipodomys_ordii|7565               NNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|2371           ------------------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|11603             NNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Myotis_lucifugus|6026              NNNNNNNNNNNN------GGCTTCTTGAACTCCTCTGAGCTCTCTGAACTTCCCTTTGGG
Ochotona_princeps|10887            NNNNNNNNNNNN------GGCTTCCTGGATTCCAAGGCGCTCTCGGGCCTTCCCACAGGG
Oryctolagus_cuniculus|20731        CTTGTGCACCAG------GGCTTCCTGGATTCCTCTGAGCTCTCGGGACTCCCCGCTGGG
Echinops_telfairi|2743             ------------------GGCTTTCTGAATTCCTCTGAGCTCTCTGAACTTCGAGCTGGG
Loxodonta_africana|9658            ------------------GGCTTTCTGAATTCCACTGAGCTATCTGAACTTCCAGCTGGG
Procavia_capensis|17205            ------------------GGCTTTCTGAATTCCTCTGAGCTCTCGGAACTTCAAGCTGGG
Equus_caballus|23559               ------------------GGTTTCTTGAATTCCTCTGAGCTCTCTGAACTTCCAGCTGGC
Pteropus_vampyrus|2243             ------------------GGCTTTTTGAATTCCTCTGAGCTCTCTGAACTTCCTGCTGGG
Bos_taurus|21593                   ------------------GGCTTCTTGAATTCCTCTGAGCTCTCTGAACTTCCAGCAGGA
Tursiops_truncatus|15356           ------------------GGCTTCTTGAATTCCTCTGAGCTCTCTGAACTTCCAGCTGGG
Canis_familiaris|1819              ------------------GGCTTCTTGAATTCCTCTGAGCTCTCTGAACTTCCGGCTGGG
Microcebus_murinus|4087            ------------------GGCTTCTTGAATTCCTCTGAGCTTTCTGGACTTCCAGCTGGA
Callithrix_jacchus|33342           ------------------GGTTTCTTGAATTCCTCTGAGCTTTCTAGACTTCCAGCGGGG
Rhesus_macaque|7906                ggatctcttaagctaggaGGCTTCTTAAATTCCTCTGAGCTTTCTGGACTTCCAGCTGGG
Homo_sapiens|21911                 ------------------GGTTTCTTGAATTCCTCTGAGCTTTCTGGACTTCCAGCTGGG
Pongo_abelii|6638                  ------------------GGTTTCTTGAATTCCTCTGAGCTTTCTGGACTTCCAGCTGGG
Gorilla_gorilla|13920              ------------------GGTTTCTTGAATTCCTCTGAGCTTTCTGGACTTCCAGCTGGG
Pan_troglodytes|8842               GGATCACTTGAG------GGTTTCTTGAATTCCTCTGAGCTTTCTGGACTTCCAGCTGGG
Otolemur_garnettii|12725           NNNNNNNNNNNN------GGGTTTTTGAATTCCTCTGAGCTTTCTGGACTTCCAGCTGGA
Spermophilus_tridecemlineatus|1155 NNNNNNNNNNNN------GGCTTCCTCAATTCCTCTGAGCTTTCTGGACTTCCAGCTGGG
Danio_rerio|27878                  ------------------AGTGTGCTGTCATCTGAGGACATGTCTAAACTCAATGCTCCT
Oryzias_latipes|22623              ------------------AATCTCCTTGCAGGTGATGAATTAAGCAGACTCCGCATGGGT
Gasterosteus_aculeatus|7324        ------------------AGCATCCTTGCAGGTGATGAGTTAAACAAACTCTGTGTGGAG
Tetraodon_nigroviridis|2918        ------------------AATTTTCTGTCAAATGAGGACCTAAACAAACTGAGTCTG---
Fugu_rubripes|37364                ------------------AATTTTCTGTCAACTGAAGATTTAAGCAAACTGAGTACGGCT
                                                                                               

Bombyx_mori|14079                  GCTGCCCGCGGCCTTGCTCGTGCTAAGCGCCACACCGGCGCAGTATGTGTGACCACAGCT
Nematostella_vectensis|12314       CACAACAATCCCGACTCCATGCTTTTATCTGACATGGTAGCCAAGGTGATAGGCAAGCTA
Branchiostoma_floridae|28207       GACACGACC---------------TTAGGTGACCTCACGGCCCTCACCATCGGCACTCTG
Sorex_araneus|803                  CCGGGGCGAGAAGGATCC------CTTAAGGACCAGCTGACCTTAGCCATTGGGAAACTG
Xenopus_tropicalis|22987           ------GAGGAGTCATTA------TTAAAAGATCAACTTGCTTTGGCAATAGGGAAGTTA
Anolis_carolinensis|8161           CCAGAT---GGATCCTTA------CTTAGCGACCAACTGGCTTTGGCTATTGGCAAACTG
Macropus_eugenii|4057              NNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNGCAAACTG
Dasypus_novemcinctus|3623          CCTGACAGAGAAGGCTGT------CTCAAGGACCAGTTGGCCCTGGCAATTGGGAAACTG
Vicugna_pacos|12248                NNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAAACTG
Monodelphis_domestica|33031        CCTGATAGAGAAGATTCT------CTCAAGGACCAGTTGACATTATTTATTGGCAAACTG
Erinaceus_europaeus|4605           CCTGAGCACGAAGGATTT------CTCAAGGACCAGCTAGCACTAGCAGTT---------
Dipodomys_ordii|7565               NNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAAGCTG
Choloepus_hoffmanni|2371           NNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|11603             NNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAAATTG
Myotis_lucifugus|6026              CCTGAGAGGAAAGGCTCT------CTCAAGGATCAGCTGGCCTTAGCAATTGAGAAAGTG
Ochotona_princeps|10887            CCTGACCAGGAAGGCTTC------CTGAAGGATCAGCTGGCCTTAGCCATTGGGAAACTG
Oryctolagus_cuniculus|20731        CCTGACCGAGAAGGCTGT------CTGAAGGACCAGCTGGCCTTGGCAATTGGGAAGCTG
Echinops_telfairi|2743             CCTGACAGAGAAGGCTCG------CTCAAGGATCAGTTGGCCCTAGCAATTGGTAACCTG
Loxodonta_africana|9658            CCTGACAGAGAAGGCTCT------CTCAAGGATCAGTTGGCCCTAGCAATTGGGAACCTG
Procavia_capensis|17205            CCTGACAGAGAAGGCTCT------CTCAAGGATCAGTTGGCCCTAGCAATTGGGAACCTG
Equus_caballus|23559               CCTGAGACGGAAGGCTTT------CTCAAGGATCAGCTGGCCTTAGCAATCGGGAAACTG
Pteropus_vampyrus|2243             CCTGAGAGAGAAGGCTGT------CTCAAGGATCAGCTGGCCTTAGCAATTGGGAAACTG
Bos_taurus|21593                   CCTGAGAGAGAGGGTTCT------CTCAAGGATCAGCTGGCTTTAGCAATTGGGAAACTG
Tursiops_truncatus|15356           CGTGAGAGAGAAGGCTGT------CTCAGGGATCAGCTGGCCTTAGCAATTGGGAAGCTG
Canis_familiaris|1819              CCTGAGAAAGAAGGCTGC------CTCAAGGATCAGCTAGCCTTAGCAATAGGGAAACTG
Microcebus_murinus|4087            CTTGGCAGAGAAGGTTCT------CTCAAGGATCAGTTGGCCTTAGCAATTGGGAAACTG
Callithrix_jacchus|33342           CCTGACAGAGAAGGCTCA------CTCAAGGATCACTTGGCTTTAGCAATTGGAAAACTG
Rhesus_macaque|7906                CCTGACAGAGATGGCTCA------CTCAAGGATCAGTTGGCTTTAGCAATTGGAAAACTG
Homo_sapiens|21911                 CCTGACAGAGAAGGCTCA------CTCAAGGATCAGTTGGCTTTAGCAATTGGAAAACTG
Pongo_abelii|6638                  CCTGACAGAGAAGGCTCA------CTCAAGGATCAGTTGGCTTTAGCAATTGGAAAACTG
Gorilla_gorilla|13920              CCTGACAGAGAAGGCTCA------CTCAAGGATCAGTTGGCTTTAGCAATTGGAAAACTG
Pan_troglodytes|8842               CCTGACAGAGAAGGCTCA------CTCAAGGATCAGTTGGCTTTAGCAATTGGAAAACTG
Otolemur_garnettii|12725           CCTGACAGAGAAGGTTCT------CTCAAGGACCACTTGGCCTTAGCAATTGGAAAACTG
Spermophilus_tridecemlineatus|1155 CCTGACAGAGAACGCTCT------CTCAAGGATCAATTGGCCTTAGCAATAGGGAAACTC
Danio_rerio|27878                  ------GATGGACCTTCA------CTGGCAGATCAGTTAGCCTTGACTATAGGGCGCTTG
Oryzias_latipes|22623              ------GAAGGAGCTGCA------CTCGCTGACAGTGTGGCTCTCACAATAGgtcGCCTT
Gasterosteus_aculeatus|7324        ------GAAGGAGCTTCA------CTTTCTGATCGGGTGGCTCTCACAATTGGTCGCCTC
Tetraodon_nigroviridis|2918        ---GATGACGGAGTTTCC------CTTGCCGACCAAGTGGCTCTCACAATCGGTCGGCTC
Fugu_rubripes|37364                ------GACGGAGTCTCA------CTTGCCGACCAAGTGGCTCTCGCAATCGGTCGACTC
                                                                                    .          

Bombyx_mori|14079                  GGACGAGAACCATTAGAATTTGCTTCTCTATTCCGAAATTGGCGCTGGTGTGACGCTCGA
Nematostella_vectensis|12314       GGC---------------------------------------------------------
Branchiostoma_floridae|28207       GGA---------------------------------------------------------
Sorex_araneus|803                  GGG---------------------------------------------------------
Xenopus_tropicalis|22987           GGT---------------------------------------------------------
Anolis_carolinensis|8161           GGT---------------------------------------------------------
Macropus_eugenii|4057              GGA---------------------------------------------------------
Dasypus_novemcinctus|3623          GGA---------------------------------------------------------
Vicugna_pacos|12248                GGA---------------------------------------------------------
Monodelphis_domestica|33031        GGA---------------------------------------------------------
Erinaceus_europaeus|4605           ------------------------------------------------------------
Dipodomys_ordii|7565               GGG---------------------------------------------------------
Choloepus_hoffmanni|2371           NNN---------------------------------------------------------
Tupaia_belangeri|11603             GGA---------------------------------------------------------
Myotis_lucifugus|6026              AGA---------------------------------------------------------
Ochotona_princeps|10887            GGA---------------------------------------------------------
Oryctolagus_cuniculus|20731        GGG---------------------------------------------------------
Echinops_telfairi|2743             GGA---------------------------------------------------------
Loxodonta_africana|9658            GGA---------------------------------------------------------
Procavia_capensis|17205            GGA---------------------------------------------------------
Equus_caballus|23559               GGA---------------------------------------------------------
Pteropus_vampyrus|2243             GGA---------------------------------------------------------
Bos_taurus|21593                   GGA---------------------------------------------------------
Tursiops_truncatus|15356           GGA---------------------------------------------------------
Canis_familiaris|1819              GGA---------------------------------------------------------
Microcebus_murinus|4087            GGA---------------------------------------------------------
Callithrix_jacchus|33342           GGA---------------------------------------------------------
Rhesus_macaque|7906                GGA---------------------------------------------------------
Homo_sapiens|21911                 GGA---------------------------------------------------------
Pongo_abelii|6638                  GGA---------------------------------------------------------
Gorilla_gorilla|13920              GGA---------------------------------------------------------
Pan_troglodytes|8842               GGA---------------------------------------------------------
Otolemur_garnettii|12725           GGA---------------------------------------------------------
Spermophilus_tridecemlineatus|1155 GGA---------------------------------------------------------
Danio_rerio|27878                  GGT---------------------------------------------------------
Oryzias_latipes|22623              GGG---------------------------------------------------------
Gasterosteus_aculeatus|7324        GGT---------------------------------------------------------
Tetraodon_nigroviridis|2918        GGT---------------------------------------------------------
Fugu_rubripes|37364                GGT---------------------------------------------------------
                                                                                               

Bombyx_mori|14079                  CGGGATATCAGAGTTCGTGCAGCCCGCTCGGCAACTACAAAGCTGGACGCGGTTAACCTC
Nematostella_vectensis|12314       ---------------------------------------------GAGAATATCAAACTA
Branchiostoma_floridae|28207       ---------------------------------------------GAAAACATACAGATC
Sorex_araneus|803                  ---------------------------------------------GAGAACATGACGCTG
Xenopus_tropicalis|22987           ---------------------------------------------GAAAATATGACTATG
Anolis_carolinensis|8161           ---------------------------------------------GAGAACATGGTTATC
Macropus_eugenii|4057              ---------------------------------------------GAAAACTTGACTCTT
Dasypus_novemcinctus|3623          ---------------------------------------------GAAAACATGACTCTT
Vicugna_pacos|12248                ---------------------------------------------GAAAACATGACTCTT
Monodelphis_domestica|33031        ---------------------------------------------GAAAATTTGACTCTT
Erinaceus_europaeus|4605           ------------------------------------------------------------
Dipodomys_ordii|7565               ---------------------------------------------GAAAACATGACTCTT
Choloepus_hoffmanni|2371           ---------------------------------------------NNNNNNNNNNNNNNN
Tupaia_belangeri|11603             ---------------------------------------------GAAAACATGATTCTT
Myotis_lucifugus|6026              ---------------------------------------------GAAAACATGACTCTT
Ochotona_princeps|10887            ---------------------------------------------GAAAACATGATCCTG
Oryctolagus_cuniculus|20731        ---------------------------------------------GAAAACATGACTCTG
Echinops_telfairi|2743             ---------------------------------------------GAGAACATGACTCTT
Loxodonta_africana|9658            ---------------------------------------------GAAAACATGACCCTT
Procavia_capensis|17205            ---------------------------------------------GAAAACATGACTCTC
Equus_caballus|23559               ---------------------------------------------GAAAACATGAGTCTT
Pteropus_vampyrus|2243             ---------------------------------------------GAAAACATGATTCTT
Bos_taurus|21593                   ---------------------------------------------GAAAACATGATTCTG
Tursiops_truncatus|15356           ---------------------------------------------GAAAACATGATTCTT
Canis_familiaris|1819              ---------------------------------------------GAAAACATGACTCTT
Microcebus_murinus|4087            ---------------------------------------------GAAAACCTGACTCTT
Callithrix_jacchus|33342           ---------------------------------------------GAAAACATGACTCTT
Rhesus_macaque|7906                ---------------------------------------------GAAAACATGACTCTT
Homo_sapiens|21911                 ---------------------------------------------GAAAACATGATTCTT
Pongo_abelii|6638                  ---------------------------------------------GAAAACATGATTCTT
Gorilla_gorilla|13920              ---------------------------------------------GAAAACATGATTCTT
Pan_troglodytes|8842               ---------------------------------------------GAAAACATGATTCTT
Otolemur_garnettii|12725           ---------------------------------------------GAAAACATGACTCTT
Spermophilus_tridecemlineatus|1155 ---------------------------------------------GAAAACATGACTCTT
Danio_rerio|27878                  ---------------------------------------------GAGAACATCGCCATG
Oryzias_latipes|22623              ---------------------------------------------GAGAACATGTCAGTG
Gasterosteus_aculeatus|7324        ---------------------------------------------GAGAACTTGTCAGTG
Tetraodon_nigroviridis|2918        ---------------------------------------------GAGAACATGTCAGTC
Fugu_rubripes|37364                ---------------------------------------------GAGAACATGTCACTG
                                                                                               

Bombyx_mori|14079                  GCCACTAACGCTTGGCTTGCTGCTGAGGCACAACTACCTGACGATGGATCGGGTTCTCTA
Nematostella_vectensis|12314       GGTAAAGCTATAACCATCACGACT------------------------------------
Branchiostoma_floridae|28207       CGCCGTGCCATGTACTACTCTGTC------------------------------------
Sorex_araneus|803                  AAGCGCGCGGCCTGGGTGAGCGTG------------------------------------
Xenopus_tropicalis|22987           AAGAGAGCTGCTTGGGTGAAGACT------------------------------------
Anolis_carolinensis|8161           AAGAGGGCGGTGTGGGTGTCAGTG------------------------------------
Macropus_eugenii|4057              AAGCGAGCTGCATGGGTGACTGTA------------------------------------
Dasypus_novemcinctus|3623          AAACGAGCTGCATGGGTGAAGGTA------------------------------------
Vicugna_pacos|12248                AAACGAGCTGCATGGGTGAAGGTG------------------------------------
Monodelphis_domestica|33031        AAACGAGCTGCATGGGTGACTGTA------------------------------------
Erinaceus_europaeus|4605           ------------------------------------------------------------
Dipodomys_ordii|7565               AAACGAGCTGCCTGGGTGAAGGTG------------------------------------
Choloepus_hoffmanni|2371           NNNNNNNNNNNNNNNNNNNNNNNN------------------------------------
Tupaia_belangeri|11603             AAACGAGCTGCATGGGTGAAGGTG------------------------------------
Myotis_lucifugus|6026              AAACGAGCTGCATGGGTGAAGGTG------------------------------------
Ochotona_princeps|10887            AAACGTGCCGCCTGGGTGAAGGTG------------------------------------
Oryctolagus_cuniculus|20731        AAGCGAGCTGCCTGGGTGAAGGTG------------------------------------
Echinops_telfairi|2743             AAACGCGCTGCGTGGGTGAAGGTG------------------------------------
Loxodonta_africana|9658            AAACGAGCCGCATGGGTGAAGGTG------------------------------------
Procavia_capensis|17205            AAACGAGCTGCATGGGTGAAGGTG------------------------------------
Equus_caballus|23559               AAACGAGCTGCATGGGTGAAGGTG------------------------------------
Pteropus_vampyrus|2243             AAACGAGCTGCATGGGTGAAGGTG------------------------------------
Bos_taurus|21593                   AAACGGGCTGCATGGGTGAAGGTG------------------------------------
Tursiops_truncatus|15356           AAACGAGCTGCATGGGTGAAGGTG------------------------------------
Canis_familiaris|1819              AAACGAGCTGCATGGGTGAAGGTG------------------------------------
Microcebus_murinus|4087            AAACGAGCTGCATGGGTGAAGGTG------------------------------------
Callithrix_jacchus|33342           AAACGAGCTGCATGGGTGAAGGTG------------------------------------
Rhesus_macaque|7906                AAACGAGCTGCATGGGTGAAGGTG------------------------------------
Homo_sapiens|21911                 AAACGAGCTGCATGGGTGAAGGTG------------------------------------
Pongo_abelii|6638                  AAACGAGCTGCATGGGTGAAGGTG------------------------------------
Gorilla_gorilla|13920              AAACGAGCTGCATGGGTGAAGGTG------------------------------------
Pan_troglodytes|8842               AAACGAGCTGCATGGGTGAAGGTG------------------------------------
Otolemur_garnettii|12725           AGACGAGCTGCATGGGTGAAGGTG------------------------------------
Spermophilus_tridecemlineatus|1155 AAACGAGCTGCATGGGTGAAGGTG------------------------------------
Danio_rerio|27878                  AGGCGAGCCGTTTCACTTTCTGTG------------------------------------
Oryzias_latipes|22623              AAGCGTGCTGTGATGGTGGGGGTC------------------------------------
Gasterosteus_aculeatus|7324        CGGCGTGCGGTGACAGTGGGCGTC------------------------------------
Tetraodon_nigroviridis|2918        AAGCGAGCCGTTACTGTGGGCGTC------------------------------------
Fugu_rubripes|37364                AAGCGAGCTGTAGCTCTTGGCGTC------------------------------------
                                                                                               

Bombyx_mori|14079                  CGTGTGTGGCGCGTCCGAAGATGCGGTGTAGATGAAGACGCGGAGAAAGAGGCAGACGGT
Nematostella_vectensis|12314       ------------------------------------------------------------
Branchiostoma_floridae|28207       ------------------------------------------------------------
Sorex_araneus|803                  ------------------------------------------------------------
Xenopus_tropicalis|22987           ------------------------------------------------------------
Anolis_carolinensis|8161           ------------------------------------------------------------
Macropus_eugenii|4057              ------------------------------------------------------------
Dasypus_novemcinctus|3623          ------------------------------------------------------------
Vicugna_pacos|12248                ------------------------------------------------------------
Monodelphis_domestica|33031        ------------------------------------------------------------
Erinaceus_europaeus|4605           ------------------------------------------------------------
Dipodomys_ordii|7565               ------------------------------------------------------------
Choloepus_hoffmanni|2371           ------------------------------------------------------------
Tupaia_belangeri|11603             ------------------------------------------------------------
Myotis_lucifugus|6026              ------------------------------------------------------------
Ochotona_princeps|10887            ------------------------------------------------------------
Oryctolagus_cuniculus|20731        ------------------------------------------------------------
Echinops_telfairi|2743             ------------------------------------------------------------
Loxodonta_africana|9658            ------------------------------------------------------------
Procavia_capensis|17205            ------------------------------------------------------------
Equus_caballus|23559               ------------------------------------------------------------
Pteropus_vampyrus|2243             ------------------------------------------------------------
Bos_taurus|21593                   ------------------------------------------------------------
Tursiops_truncatus|15356           ------------------------------------------------------------
Canis_familiaris|1819              ------------------------------------------------------------
Microcebus_murinus|4087            ------------------------------------------------------------
Callithrix_jacchus|33342           ------------------------------------------------------------
Rhesus_macaque|7906                ------------------------------------------------------------
Homo_sapiens|21911                 ------------------------------------------------------------
Pongo_abelii|6638                  ------------------------------------------------------------
Gorilla_gorilla|13920              ------------------------------------------------------------
Pan_troglodytes|8842               ------------------------------------------------------------
Otolemur_garnettii|12725           ------------------------------------------------------------
Spermophilus_tridecemlineatus|1155 ------------------------------------------------------------
Danio_rerio|27878                  ------------------------------------------------------------
Oryzias_latipes|22623              ------------------------------------------------------------
Gasterosteus_aculeatus|7324        ------------------------------------------------------------
Tetraodon_nigroviridis|2918        ------------------------------------------------------------
Fugu_rubripes|37364                ------------------------------------------------------------
                                                                                               

Bombyx_mori|14079                  GCACTGGCAGAGGTCGAGCGACCACAAGCAGCTGCCTTTTACGATAGAGACTGTTACATT
Nematostella_vectensis|12314       ---------------------GAC------TCGGATAATGTCATTGGTAGCTATGTCCAT
Branchiostoma_floridae|28207       ---------------------CCCCCCATCCCCACCAAACACGTCGGGGTCTACGTCCAC
Sorex_araneus|803                  ---------------------CCC------GCCGGGCTCCACGTCGGCGCCTACGTCCAC
Xenopus_tropicalis|22987           ---------------------CCC------TCTGATATCTTCATAGGCTCTTATATGCAT
Anolis_carolinensis|8161           ---------------------CCA------GAGAACAACTTCATCGGCTCTTACGTACAT
Macropus_eugenii|4057              ---------------------CCA------AATGGATTCTACATTGGTTCCTATGTACAT
Dasypus_novemcinctus|3623          ---------------------CCA------TCTGGGTTCTACGTTGGCTCTTATGTCCAT
Vicugna_pacos|12248                ---------------------CCA------GCTGGGTTCTATGTTGGCTCTTATGTCCAC
Monodelphis_domestica|33031        ---------------------CCA------AATGGATTCTACATTGGTTCCTATGTTCAT
Erinaceus_europaeus|4605           ------------------------------------------------------------
Dipodomys_ordii|7565               ---------------------CCG------TCTGGGTTCTACGTTGGGTCGTATGTGCAT
Choloepus_hoffmanni|2371           ------------------------------------------------------------
Tupaia_belangeri|11603             ---------------------CCA------TCCGGGTTCTACGTAGGCTCTTACGTCCAT
Myotis_lucifugus|6026              ---------------------CCA------AATGGGTTCTATGTTGGCTCTTATGTCCAT
Ochotona_princeps|10887            ---------------------CCG------TCCGGCTTCTATGTGGGCTCATATGTCCAT
Oryctolagus_cuniculus|20731        ---------------------CCG------TCTGGCTTCTACATTGGCTCCTACGTCCAC
Echinops_telfairi|2743             ---------------------CCC------TCTGGGTTCTATGTTGGCTCTTACATCCAC
Loxodonta_africana|9658            ---------------------CCA------TCTGGGTTCTACGTTGGTTCTTATGTTCAT
Procavia_capensis|17205            ---------------------CCG------TCCGGGTTCTGGGTTGGCTCTTATGTCCAT
Equus_caballus|23559               ---------------------CCA------GCTGGGTTCTTTGTTGGCTCTTATGTCCAC
Pteropus_vampyrus|2243             ---------------------CCA------GCTGGGTTCTATGTTGGCTCTTATGTCCAT
Bos_taurus|21593                   ---------------------CCA------GCTGGTTTCTATGTTGGCTCTTATGTCCAT
Tursiops_truncatus|15356           ---------------------CCA------GCTGGGTTCTATGTTGGCTCTTATGTCCAT
Canis_familiaris|1819              ---------------------CCA------GCTGGGTTCTATGTTGGCTCCTATGTCCAT
Microcebus_murinus|4087            ---------------------CCA------TCTGGGTTCTACGTTGGCTCTTATGTCCAT
Callithrix_jacchus|33342           ---------------------CCA------TCTGGGTTCTACGTTGGCTCTTATGTCCAC
Rhesus_macaque|7906                ---------------------CCA------TCTGGGTTCTACGTTGGCTCTTATGTCCAC
Homo_sapiens|21911                 ---------------------CCA------TCTGGGTTCTACGTTGGCTCTTATGTCCAC
Pongo_abelii|6638                  ---------------------CCA------TCTGGGTTCTACGTTGGCTCTTATGTCCAC
Gorilla_gorilla|13920              ---------------------CCA------TCTGGGTTCTACGTTGGCTCTTATGTCCAC
Pan_troglodytes|8842               ---------------------CCA------TCTGGGTTCTACGTTGGCTCTTATGTCCAC
Otolemur_garnettii|12725           ---------------------CCA------TCTGGATTCTACGTTGGCTCTTATGTCCAC
Spermophilus_tridecemlineatus|1155 ---------------------CCA------TCTGGGTTCTACGTTGGTTCTTATGTCCAT
Danio_rerio|27878                  ---------------------CCT------TCTGATTGGCACATTGGCTCATACATTCAT
Oryzias_latipes|22623              ---------------------CCA------GCTGAGTGGCGCATTGGCTCGTACGTGCAC
Gasterosteus_aculeatus|7324        ---------------------CCA------GCTGAGTGGCACATTGGCTCGTATGTACAC
Tetraodon_nigroviridis|2918        ---------------------CCT------GCAGAGTGGCGCATTGGCTCGTACGTCCAC
Fugu_rubripes|37364                ---------------------CCT------GCAGGCTGGCATATCGGCTCATATGTCCAC
                                                                                               

Bombyx_mori|14079                  GTACTGTACACATACCATTCTCCTAACGGAGACCAAACGATGATTTACTACTGGATGGGT
Nematostella_vectensis|12314       GGTCCGTATGTC---------ACTAAGGTCCAT---CAGTGTTCCTTTGGCAAGTATGGA
Branchiostoma_floridae|28207       GCGCCCGTTGCCGGGACGACCGGCGGCCAATCGGGAAGCTGTGCTCTCGGGAAGTACGGC
Sorex_araneus|803                  GGCGCAGTGCAG------GGCCCCGCCCCCCAC---AGCCCGCTGCTGGGGAAATACGGG
Xenopus_tropicalis|22987           GGCATTCTTGTAGCAGATGTACCATCCCTATCT---AATATCACATTTGGAAAATATGGA
Anolis_carolinensis|8161           GGAGCTCCCCCAGATGGAAATCCTCTGCTGTCT---CATATAATGTTTGGCAAATATGGT
Macropus_eugenii|4057              GGAGCAGTGCAT------AGTCCCTCTCTCGGT---AACATGGTGCTTGGGAAATATGGT
Dasypus_novemcinctus|3623          GGAGCAACACAC------AGTCCCTTGCTCCAC---AACCTGGTGCTGGGCAAGTATGGG
Vicugna_pacos|12248                GGGGCAATGCAC------AGCCCCTCGCTCCAC---AACCTGGTGCTGGGGAAGTACGGG
Monodelphis_domestica|33031        GGAGCAATGCAT------AGCCCCTCTCTCGGT---AACATGGTGCTTGGAAAATATGGC
Erinaceus_europaeus|4605           ------------------------------------------------------------
Dipodomys_ordii|7565               GGAACAATGCAC------AGCCCCTCACTCCAC---AACCTGGTGTTGGGGAAGTACGGG
Choloepus_hoffmanni|2371           ------------------------------------------------------------
Tupaia_belangeri|11603             GGAGTGATGCAC------AGTCCCTTGCTCCAC---AACCTAGTGCTGGGGAAATACGGG
Myotis_lucifugus|6026              GGAACAATGCAC------AGTCCCTCACTCCAC---AACCTGGTGCTGGGGAAGTACGGG
Ochotona_princeps|10887            GGAGCCATCCAC------AGCCCCTCGCTGCAC---AACCTGGTGCTGGGCAAGTACGGG
Oryctolagus_cuniculus|20731        GGAGCAGTGCAC------AGCCCCTCGCTGCAC---AGCCTGGTGCTGGGCAAGTACGGG
Echinops_telfairi|2743             GGAGCATCGCAC------AGCCCCTCGCTCCAC---AACCTGGTGTTTGGGAAGTATGGG
Loxodonta_africana|9658            GGAGCAATGCAC------AGCCCCTCGTTCCAC---AACCTGGTACTGGGAAAGTACGGG
Procavia_capensis|17205            GGAGCAATGCAC------GGCCCCTCACTCCAC---AACCTAGTGCTGGGGAAGTATGGG
Equus_caballus|23559               GGAGCGATGCAC------AGTCCCTCACTCCAC---AACCTGGTGCTGGGGAAGTACGGG
Pteropus_vampyrus|2243             GGAGCAACACAC------AGTCCCTCGCTCCAC---AACCTGGTGCTGGGGAAATATGGG
Bos_taurus|21593                   GGGGCAATGCAC------AGCCCCTCACTCCAC---AACCTGGTGCTGGGGAAGTATGGG
Tursiops_truncatus|15356           GGGGCAATGCAC------AGTCCCTCGCTCCAC---AACCTGGTTCTGGGGAAATATGGG
Canis_familiaris|1819              GGAGCAATGCAC------AGCTCCTCCCTCCAC---AACCTGGAGCTCGGGAAGTATGGG
Microcebus_murinus|4087            GGAGGAATGCAT------ACTCCCTCCCTTCAC---AACCTGGGGCTGGGCAAGTATGGG
Callithrix_jacchus|33342           GGAGTAATGCAG------AGTCCCTCCCTTCAC---AACCTGGTGCTGGGGAAGTATGGG
Rhesus_macaque|7906                GGAGCAATGCAG------AGTCCCTCACTTCAC---AACCTGGTGCTGGGGAAGTATGGG
Homo_sapiens|21911                 GGAGCAATGCAG------AGTCCCTCACTTCAC---AAGCTGGTGCTGGGGAAGTATGGG
Pongo_abelii|6638                  GGAGCAATGCAG------AGTCCCTCACTTCAC---AACCTGGCGCTGGGGAAGTATGGG
Gorilla_gorilla|13920              GGAGCAATGCAG------AGTCCCTCACTTCAC---AAGCTGGTGCTGGGGAAGTATGGG
Pan_troglodytes|8842               GGAGCAATGCAG------AGTCCCTCACTTCAC---AAGCTGGTGCTGGGGAAGTATGGG
Otolemur_garnettii|12725           GGAACAATGCAC------AGTCCCTCCCTTCAC---AACCTGGTGCTGGGCAAGTACGCA
Spermophilus_tridecemlineatus|1155 GGAGCAATGCAC------AGTCCCTCGCTCCAC---AACCTGGTACTGGGGAAGTATGGG
Danio_rerio|27878                  GGGACGGTTGCT------------GGGCAGGTT---GGCATTGAGATGGGGCGTTATGGA
Oryzias_latipes|22623              GGCAACGTCGGC------------AGTCAGCAG---GAAGTGGCTATGGGCCGCTATGGA
Gasterosteus_aculeatus|7324        GGTGGTGTGCAC------------GGCCAGACG---GAGGTGGCCATGGGCCGGTACGCC
Tetraodon_nigroviridis|2918        GGCGGGGTCGGC------------ACCCAGCCC---GAACTAGCTATGGGTCGCTACGGT
Fugu_rubripes|37364                GGCGATGTGGGC------------ACCCAGACT---GAACTAGCCATGGGTCGGTATGGC
                                                                                               

Bombyx_mori|14079                  GGCTCTGCGCCAAATGATCTGAGGAATTTG------GGTGCAAAAGAAGCCAAAGACCTC
Nematostella_vectensis|12314       GCCATGGTTGCGGTGAAGCCAATCAAGAAGGGAATAGACACTAGCTCACTCGCGTTACTA
Branchiostoma_floridae|28207       GCGCTCGTCGCCTTCCGACGGAAGAACACAGAGTTTCAGAACTTCAACGCCGCGGAGCTT
Sorex_araneus|803                  GCCCTGGTGGTCTGCGAGGCGGCCGAGCCG---------AAAGCCAACCTGGAGGACATC
Xenopus_tropicalis|22987           GCTCTAGTCATATGCAAAGATTCCGACAGTAAC---CCTAAGAGCAACATATCTGAAGTT
Anolis_carolinensis|8161           GCCTTGGTGATCTGTAGCCCCTCTGAGCAATGT---CCCAAGTCAAACTTTCCTGAGCTT
Macropus_eugenii|4057              GCACTAGTCATCTGCCAGACATCTGAAGAG---------AACTCGAATCTTGAAGATCTT
Dasypus_novemcinctus|3623          GCAGTGGTCGTCTGCGAGACATCTGAGCAG---------AAAGCAAACCTGGAAGACCTT
Vicugna_pacos|12248                GCCCTGGTCGTCTGCGAGACGTCCGAGCGG---------AAAGCAAACCTTGAAGACCTT
Monodelphis_domestica|33031        GCACTCGTCATCTGCCAGACAACTGAGAAG---------AAACAGAACCTTGAAGACCTT
Erinaceus_europaeus|4605           ------------------------------------------------------------
Dipodomys_ordii|7565               GCCCTGGTCATCTGCGAGACATCTGTGCGG---------AAAGTAAACCTGGAGGACCTT
Choloepus_hoffmanni|2371           ------------------------------------------------------------
Tupaia_belangeri|11603             GCCCTGGTCATCTGCGAGACATCTGAGCGG---------AAAGCAAACCTCGAAGACCTT
Myotis_lucifugus|6026              GCCCTGGTCATCTGCGAGATATCTGAGTGG---------AAGGCAAACCTTGAAGAACTT
Ochotona_princeps|10887            GCCCTGGTCATCTGTGAGACGGCTGAGCAG---------CCAGCCAACCTGGAGGATCTG
Oryctolagus_cuniculus|20731        GCCTTAGTCGTCTGCGAGACGTCCGAGCAG---------AACGCAAACCTGGAGGACCTT
Echinops_telfairi|2743             GCCCTGGTCGTCTGTGAGACATCTGAGCGG---------AAAGCGAACCTCGAAGACCTT
Loxodonta_africana|9658            GCCCTGGTCGTCTGTGAGACGTCTGAGCGG---------AAAGCAAATCTTGAAGACCTT
Procavia_capensis|17205            GCCCTGGTCATCTGTGAGACATCTGAGCAG---------AAAGCAAACCTTGAAGACCTG
Equus_caballus|23559               GCGCTGGTCGTCTGCGAGACGTCGGAGCAG---------AGGGCAGACCTGGAGGACCTT
Pteropus_vampyrus|2243             GCCCTGGTCATCTGCGAGACGTCTGAGCAG---------ACAGCAAACCTCGAAGACCTT
Bos_taurus|21593                   GCCCTGGTCATCTGCGAGACGTCAGAGTTG---------AAGGCAAACCTCGCAGACCTT
Tursiops_truncatus|15356           GCCCTGGTCATCTGCGAGACGTCTGAGCAG---------AAAGCAAACCTTGAAGACCTT
Canis_familiaris|1819              GCCCTGGTGGTCTGCGAGACATCTGAGCGC---------AAAGCAAGCCTGGAAGACCTT
Microcebus_murinus|4087            GCCCTGGTTGTCTGTGAGACGTCTGAGCAG---------AAAGCAAACCTTGAAGACCTT
Callithrix_jacchus|33342           GCCCTGGTCATCTGCGAGACATCTGAACAG---------AATGCAAACCTTGAAGACATT
Rhesus_macaque|7906                GCCCTGGTCATCTGTGAGACGTCTGAACAG---------AAAACAAACCTTGAAGACATT
Homo_sapiens|21911                 GCCCTGGTCATCTGTGAGACGTCTGAACAG---------AAAACAAACCTTGAAGACGTT
Pongo_abelii|6638                  GCCCTGGTCATCTGTGAGACGTCTGAACAG---------AAAACAAACCTTGAAGACGTT
Gorilla_gorilla|13920              GCCCTGGTCATCTGTGAGACGTCTGAACAG---------AAAACAAACCTTGAAGACGTT
Pan_troglodytes|8842               GCCCTGGTCATCTGTGAGACGTCTGAACAG---------AAAACAAACCTTGAAGATGTT
Otolemur_garnettii|12725           GCCCTGGTTGTCTGTGAGACGACTGAGCAG---------AAAGCAAAACTTGAAGACTTG
Spermophilus_tridecemlineatus|1155 GCCCTGGTCATCTGTGAGACATCTGAACAG---------AAAGCAAACCTTGAAGACCTT
Danio_rerio|27878                  TCCCTAGTTGTGTTTCAAGGTGAACCT------------AAGGAAGGGACATACGCTCTT
Oryzias_latipes|22623              GCTCTGGTCATATTCCAGGGAGGGAAG------------GAAGGAGAACAAGACATGCTG
Gasterosteus_aculeatus|7324        GCCCTGGTTGTATTTCAGGGTGGCGAG------------AAGGAACAATGGGACGTTCTA
Tetraodon_nigroviridis|2918        GCCCTGGTTATATTTGAGGGTGGGAAG------------AAAGGTGAGGAGGACGTTCTC
Fugu_rubripes|37364                GCCCTGGTTGTTTTTGAGGGTGGaaag------------gagggtgaggaggaagtTCTA
                                                                                               

Bombyx_mori|14079                  TATATAAAGCTAGGCCGTCTTCCTGTCCAGGCCTGGGTGTACCAAGGAAAAGAGCCAGCG
Nematostella_vectensis|12314       GCTAACAAACTAGCACAGCATGTGGTG------------------GGAATGAACCCCAAG
Branchiostoma_floridae|28207       GGCCGGCGGTTAGGACAGCACGTCGTC------------------GGGATGAGCCCCCTG
Sorex_araneus|803                  GGCCGCCGCCTGGGGCAGCACGTGGTG------------------GGCATGGCCCCCCTC
Xenopus_tropicalis|22987           GGACGCAGATTGGGCCAGCATGTTGTG------------------GGAATGAACCCTCTG
Anolis_carolinensis|8161           GGCTGGAGGCTGGGCCAGCATGTGGTG------------------GGCATGGCTCCCCTC
Macropus_eugenii|4057              GGCCGACGGCTTGGTCAGCATGTTGTG------------------GGAATGGCACCTTTG
Dasypus_novemcinctus|3623          GGCCGCCGCCTTGGGCAGCACGTGGTG------------------GGCATGGCCCCTCTC
Vicugna_pacos|12248                GGCCGCCGCCTTGGGCAGCACGTGGTG------------------GGCATGGCCCCTCTC
Monodelphis_domestica|33031        GGCCGACGACTTGGTCAGCATGTTGTG------------------GGAATGGCTCCTCTA
Erinaceus_europaeus|4605           ------------------------------------------------------------
Dipodomys_ordii|7565               GGCCGCCGCCTGGGACAGCATGTGGTG------------------GGCATGGCCCCTCTC
Choloepus_hoffmanni|2371           ---NNNNNNNNNNNNCAGCATGTGGTG------------------GGCATGGCCCCTCTC
Tupaia_belangeri|11603             GGCCGCCGCCTTGGGCAGCACGTGGTG------------------GGCATGGCCCCACTC
Myotis_lucifugus|6026              GGCCGCCGCCTTGGGCAGCATGTGGTA------------------GGCATGGCCCCTCTC
Ochotona_princeps|10887            GGCCGCCACCTCGGGCAGCATGTGGTG------------------GGCATGGCCCCCCTC
Oryctolagus_cuniculus|20731        GGCCGCCGCCTCGGGCAGCACGTGGTG------------------GGCATGGCCCCTCTC
Echinops_telfairi|2743             GGTCGCCGCCTCGGGCAGCATGTAGTG------------------GGCATGGCCCCACTC
Loxodonta_africana|9658            GGTCGCCGCCTTGGGCAGCATGTGGTG------------------GGCATGGCCCCTCTC
Procavia_capensis|17205            GGTCGCCGCCTTGGGCAGCATGTGGTA------------------GGCATGGCCCCTCTC
Equus_caballus|23559               GGCCGCCGCCTTGGGCAGCATGTGGTG------------------GGCATGGCCCCGCTC
Pteropus_vampyrus|2243             GGTCGCCGCCTTGGGCAGCACGTGGTG------------------GGCATGGCCCCACTC
Bos_taurus|21593                   GGCCGCCGCCTTGGGCAGCACGTGGTG------------------GGCATGGCTCCCCTC
Tursiops_truncatus|15356           GGCCGCCGCCTTGGGCAGCATGTGGTG------------------GGCATGGCTCCTCTC
Canis_familiaris|1819              GGCCGCCGCCTTGGGCAGCATGTGGTG------------------GGCATGGCCCCTCTC
Microcebus_murinus|4087            GGCCGCCGCCTCGGGCAGCATGTGGTG------------------GGCATGGCTCCTCTC
Callithrix_jacchus|33342           GGCCGCCGCCTTGGGCAGCATGTGGTG------------------GGCATGGCCCCTCTC
Rhesus_macaque|7906                GGCCGCCGCCTTGGGCAGCATGTGGTG------------------GGCATGGCCCCCCTC
Homo_sapiens|21911                 GGCCGCCGCCTTGGGCAGCATGTGGTG------------------GGCATGGCCCCCCTC
Pongo_abelii|6638                  GGCCGCCGCCTTGGGCAGCATGTGGTG------------------GGCATGGCCCCCCTC
Gorilla_gorilla|13920              GGCCGCCGCCTTGGGCAGCATGTGGTG------------------GGCATGGCCCCCCTC
Pan_troglodytes|8842               GGCCGCCGCCTTGGGCAGCATGTGGTG------------------GGCATGGCCCCCCTC
Otolemur_garnettii|12725           GGCCGCCGCCTCGGGCAGCATGTGGTG------------------GGCATGGCTCCTCTC
Spermophilus_tridecemlineatus|1155 GGCCGCCGCCTTGGGCAGCATGTGGTG------------------GGCATGGCTCCTCTC
Danio_rerio|27878                  GGAAGGAAGCTGGCACAACATGTAATG------------------GGTGAAGCACCTGTT
Oryzias_latipes|22623              GGTCGGAAGTTGGGGCAGCATATTGTG------------------GGAGAGGCTCCTTTG
Gasterosteus_aculeatus|7324        GGACGTAAACTGGGACAGCATATAGTG------------------GGAGAGGCCCCTGTG
Tetraodon_nigroviridis|2918        GGACGCCAACTGGGACGGCATGTAGTC------------------GGGGAAGCTCCCCAG
Fugu_rubripes|37364                GGACGCAAACTGGGACGGCATGTAGTC------------------GGGGAGGCTCCCGAG
                                                                                               

Bombyx_mori|14079                  CATTTTCTACAAATATTCAAAGGTCGAATGATTACATACGTCGGTAGTGCAACCGAT---
Nematostella_vectensis|12314       GTT------------------------------------ATAGGTCAGGGGGGTGAAGCT
Branchiostoma_floridae|28207       ACT------------------------------------GTCGGAGAGATGCCGGAGGTT
Sorex_araneus|803                  TCC------------------------------------GTGGGCTCCCTGGACGAC---
Xenopus_tropicalis|22987           TCG------------------------------------GTAGGTTCCCTTGAGGAT---
Anolis_carolinensis|8161           TCT------------------------------------GTCGGCTCTATGGAGGAT---
Macropus_eugenii|4057              TCT------------------------------------GTAGGCTCAATGGAGGAT---
Dasypus_novemcinctus|3623          TCT------------------------------------GTTGGCTCCCTGGATGAT---
Vicugna_pacos|12248                TCT------------------------------------GTGGGCTCCCTGGATGAT---
Monodelphis_domestica|33031        TCT------------------------------------GTAGGCTCAATGGATGAT---
Erinaceus_europaeus|4605           ------------------------------------------------------------
Dipodomys_ordii|7565               TCT------------------------------------GTTGGCTCCCTGGATGAT---
Choloepus_hoffmanni|2371           TCT------------------------------------GTTGGCTCCCTGGACGAT---
Tupaia_belangeri|11603             TCT------------------------------------GTTGGCTCCCTGGACGAT---
Myotis_lucifugus|6026              TCT------------------------------------GTTGGCTCCCTGGACGAT---
Ochotona_princeps|10887            TCC------------------------------------GTGGGCTCCCTGGACGAT---
Oryctolagus_cuniculus|20731        TCT------------------------------------GTTGGCTCCCTGGACGAT---
Echinops_telfairi|2743             TCT------------------------------------GTTGGCTCCCTGGACGAT---
Loxodonta_africana|9658            TCT------------------------------------GTTGGCTCCCTGGACGAT---
Procavia_capensis|17205            TCA------------------------------------GTTGGTTCCCTGGATGAT---
Equus_caballus|23559               TCT------------------------------------GTTGGCTCCCTGGATGAT---
Pteropus_vampyrus|2243             TCT------------------------------------GTTGGCTCCCTGGATGAT---
Bos_taurus|21593                   TCT------------------------------------GTTGGCTCCCTGGACGAC---
Tursiops_truncatus|15356           TCT------------------------------------GTTGGCTCCCTGGACGAT---
Canis_familiaris|1819              TCT------------------------------------GTTGGCTCTTTGGATGAT---
Microcebus_murinus|4087            TCT------------------------------------GTTGGCTCCCTGGACGAT---
Callithrix_jacchus|33342           TCT------------------------------------GTTGGCTCCCTGGATGAT---
Rhesus_macaque|7906                TCT------------------------------------GTTGGCTCCCTGGATGAT---
Homo_sapiens|21911                 TCT------------------------------------GTTGGCTCCCTGGACGAT---
Pongo_abelii|6638                  TCT------------------------------------GTTGGCTCCCTGGATGAT---
Gorilla_gorilla|13920              TCT------------------------------------GTTGGCTCCCTGGACGAT---
Pan_troglodytes|8842               ACT------------------------------------GTTGGCTCCCTGGACGAT---
Otolemur_garnettii|12725           TCT------------------------------------GTCGGCTCCCTGGACGAT---
Spermophilus_tridecemlineatus|1155 TCT------------------------------------GTTGGCTCCCTGGATGAT---
Danio_rerio|27878                  TCT------------------------------------CTTGGCAACATGGACGAT---
Oryzias_latipes|22623              TCT------------------------------------CTTGGAAACATGGATGAT---
Gasterosteus_aculeatus|7324        TCC------------------------------------CTGGGCAACATGGATGAC---
Tetraodon_nigroviridis|2918        TCT------------------------------------TTGGGCAACATGGACGAC---
Fugu_rubripes|37364                TCT------------------------------------CTCGGCAACATGGACGAC---
                                                                                               

Bombyx_mori|14079                  TATGACCCGAGCGGT---------------------------------------------
Nematostella_vectensis|12314       GATGAGAAGGGAGGG---------------------------------------------
Branchiostoma_floridae|28207       CGGGAGGAGGAAGGGGAGAAGAAGGATGGGGATAAGCAGGATGAGGAGGAGAGGAGTACA
Sorex_araneus|803                  ---GTGCCCGGCGGC---------------------------------------------
Xenopus_tropicalis|22987           ---GAATCTAGTGGG---------------------------------------------
Anolis_carolinensis|8161           ---GAACCCGGGGGA---------------------------------------------
Macropus_eugenii|4057              ---GAGCCTGGTGGA---------------------------------------------
Dasypus_novemcinctus|3623          ---GAGCCTGGGGGA---------------------------------------------
Vicugna_pacos|12248                ---GAACCTGGGGGA---------------------------------------------
Monodelphis_domestica|33031        ---GAGCCTGGCGGA---------------------------------------------
Erinaceus_europaeus|4605           ------------------------------------------------------------
Dipodomys_ordii|7565               ---GAACCTGGAGGA---------------------------------------------
Choloepus_hoffmanni|2371           ---GAGCCTGGGGGA---------------------------------------------
Tupaia_belangeri|11603             ---GAGCCTGGGGGA---------------------------------------------
Myotis_lucifugus|6026              ---GAGCCTGGGGGA---------------------------------------------
Ochotona_princeps|10887            ---GAGCCCGGGGGA---------------------------------------------
Oryctolagus_cuniculus|20731        ---GAGCCCGGGGGA---------------------------------------------
Echinops_telfairi|2743             ---GAGCCTGGGGGA---------------------------------------------
Loxodonta_africana|9658            ---GAGCCTGGGGGA---------------------------------------------
Procavia_capensis|17205            ---GAACCTGGGGGA---------------------------------------------
Equus_caballus|23559               ---GAGCCTGGGGGA---------------------------------------------
Pteropus_vampyrus|2243             ---GAGCCTGGAGGC---------------------------------------------
Bos_taurus|21593                   ---GAGCCCGGGGGA---------------------------------------------
Tursiops_truncatus|15356           ---GAGCCTGGGGGA---------------------------------------------
Canis_familiaris|1819              ---GAGCCTGGGGGA---------------------------------------------
Microcebus_murinus|4087            ---GAGCCTGGGGGA---------------------------------------------
Callithrix_jacchus|33342           ---GAGCCTGGGGGA---------------------------------------------
Rhesus_macaque|7906                ---GAGCCTGGGGGG---------------------------------------------
Homo_sapiens|21911                 ---GAGCCTGGGGGA---------------------------------------------
Pongo_abelii|6638                  ---GAGCCTGGGGGA---------------------------------------------
Gorilla_gorilla|13920              ---GAGCCTGGGGGA---------------------------------------------
Pan_troglodytes|8842               ---GAGCCTGGGGGA---------------------------------------------
Otolemur_garnettii|12725           ---GAGCCTGGGGGA---------------------------------------------
Spermophilus_tridecemlineatus|1155 ---GAACCTGGGGGA---------------------------------------------
Danio_rerio|27878                  ---TTATCATGTGGT---------------------------------------------
Oryzias_latipes|22623              ---CTGCCCTGTGGT---------------------------------------------
Gasterosteus_aculeatus|7324        ---CTTCCTTGTGGG---------------------------------------------
Tetraodon_nigroviridis|2918        ---CTGCCCTGTGGG---------------------------------------------
Fugu_rubripes|37364                ---CTGCCCTGTGGG---------------------------------------------
                                                                                               

Bombyx_mori|14079                  ---------CGT---------CGAGTGATTCCGCCTAGCCGTGTGCTG------ATCCTA
Nematostella_vectensis|12314       ---------GAGAGTGAGGCA---TTACTAGATCAGGAATATCTCCTGGATGGGTCTCTG
Branchiostoma_floridae|28207       GACAGTGATGAGGATGAGACACAGATGCTGCGGCAGACCTTCCTGCTGGACCCCACCATG
Sorex_araneus|803                  ---------GACTCGGAAACCAGGATGCTGTCCCAGCCGTACCTGCTGGACCCGTCCATC
Xenopus_tropicalis|22987           ---------GAGACAGAGACAAAGATGCTGGCACAGTCCTTTCTTCTGGAGCCCAGTCTA
Anolis_carolinensis|8161           ---------GATTCTGAAACAAAGATGCTTCCACAGCCCTTCCTCCTGGACCCCACAATT
Macropus_eugenii|4057              ---------GAAGAGGAAACAAAAATGCTCGCCCAACCCTATTTGCTGAATCCTAGTATT
Dasypus_novemcinctus|3623          ---------GAGGCAGAAACCAAGATGCTGTCTCAGCCCTACTTGCTGGATCCCTCCATC
Vicugna_pacos|12248                ---------GAGGCAGAAACCAAGATGCTGTCCCAGCCGTACTTGCTGGACCCCTCCATC
Monodelphis_domestica|33031        ---------GAAGAGGAAACAAAGATGCTTGCTCAGCCCTATTTGCTGGATCCCAGCATC
Erinaceus_europaeus|4605           ------------------------------------------------------------
Dipodomys_ordii|7565               ---------GAGTCAGAGACCAAGATGCTATCCCAGCCATACTTGCTGGACCCCTCCATT
Choloepus_hoffmanni|2371           ---------GACGCAGAAACCAAGATGCTGTCCCAGCCGTATTTGCTGGATCCTTCTATC
Tupaia_belangeri|11603             ---------GAGGCAGAAACGAAGATGCTGTCCCAGCCATACTTGCTGGATCCGTCCGTC
Myotis_lucifugus|6026              ---------GAGACGGAAACCAAGATGCTGTCCCAGCCGTACTTGCTGGATCCCTCTATC
Ochotona_princeps|10887            ---------GAGGCAGAGACCAAGATGCTGTCCCAGCCCTACCTGCTGGACCCCTCCATC
Oryctolagus_cuniculus|20731        ---------GAGGCAGAAACCAAGATGCTGTCGCAGCCGTACCTGCTGGACCCCTCCATC
Echinops_telfairi|2743             ---------GAAGCAGAGACCAAGATGCTCTCCCAACCCTATTTGCTGGATCCCTCTATC
Loxodonta_africana|9658            ---------GAGATGGAAACCAAGATGCTGTCCCAGCCGTACTTGCTGGATCCCTCTATC
Procavia_capensis|17205            ---------GAGATGGAAACCAGGATGCTCTGCCAGCCGTACTTGCTAGATCCTTCAATC
Equus_caballus|23559               ---------GAGGCGGAAACCAAGATGCTGTCCCAGCCATATTTGCTGGATCCTTCCATC
Pteropus_vampyrus|2243             ---------GAGGCCGAAACCAAGATGCTGTCCCAACCATACTTGCTGGATCCCTCTATC
Bos_taurus|21593                   ---------GAGGCGGAAACCAAGATGCTGTCCCAGCCATACTTGCTGGACCCTTCCATC
Tursiops_truncatus|15356           ---------GAGGCAGAAACCAAGATGCTGTCCCAGCCGTACTTGCTGGATCCCTCCATC
Canis_familiaris|1819              ---------GAGGCGGAAACCAAGATGCTGTCCCAGCCATACTTGCTGGATCCCTCCATC
Microcebus_murinus|4087            ---------GAGGCAGAGACCAAGATGCTGTCCCAGCCTTACTTGCTGGATCCCTCCATC
Callithrix_jacchus|33342           ---------GAGGCAGAGACGAAGATGCTGTCCCAGCCCTACTTGCTGGATCCCTCCATT
Rhesus_macaque|7906                ---------GAGGCAGAGACTAAGATGTTGTCCCAGCCATACTTGCTGGATCCCTCCATT
Homo_sapiens|21911                 ---------GAGGCAGAGACTAAGATGCTGTCCCAGCCGTATTTGCTGGATCCCTCCATT
Pongo_abelii|6638                  ---------GAGGCAGAGACTAAGATGCTGTCCCAGCCGTATTTGCTGGATCCCTCCATT
Gorilla_gorilla|13920              ---------GAGGCAGAGACTAAGATGCTGTCCCAGCCGTATTTGCTGGATCCCTCCATT
Pan_troglodytes|8842               ---------GAGGCAGAGACTAAGATGCTGTCCCAGCCATATTTGCTGGATCCCTCCATT
Otolemur_garnettii|12725           ---------GAGGCAGAGACCAAGATGCTGTCCCAGCCATACCTGCTGGACCCCTCCATT
Spermophilus_tridecemlineatus|1155 ---------GAGGCAGAGACCAAGATGCTGTCCCAACCATACTTGCTGGATCCCTCCATC
Danio_rerio|27878                  ---------GACTCTGAGACGAGACTTTTGCCCCAGACGTTTCTCCCAGATCCCAAATAT
Oryzias_latipes|22623              ---------GAAAGTGAGACACGCCTTCTGCCTCAGACCTTCCTGGCTGACCCCAGCAGG
Gasterosteus_aculeatus|7324        ---------GAAAGTGAGACACGCCTGCTGCCTCAGACCTTTTTGGGAGACCCCAGCAGG
Tetraodon_nigroviridis|2918        ---------GAGAGTGAGACGCGTCTTCTTCCTCAGACGTTCCTCGGGGACCCCAGCAGG
Fugu_rubripes|37364                ---------GAAAGTGAGACACGCCTTTTGCCACAGACATTCCTGGGAGACCCCAGCAGG
                                                                                               

Bombyx_mori|14079                  GTGTCGGGTCAGTACGCGCGTGAGGCCCGCGGTACTGAGGTGCGGGGGGCGGTGAGGGGC
Nematostella_vectensis|12314       ACAGTAGGGCAGTTTACCGAG---AAGGAAGGGGTGCAGGTCGTGGATTTTGTCAGGTAT
Branchiostoma_floridae|28207       ACGGTGGGGGAGATGACCAGA---CAGCAGGGCATCGAGTTACTAGACTTTGTCAGGTTT
Sorex_araneus|803                  ACGCTGGGGCAGTACGTGCAG---CCCCAGGGGGTGTCTGTCGTGGACTTCGTCCGGTTT
Xenopus_tropicalis|22987           ACCGTGGGGCAGTATTTGCAG---CCACGAGGAATAAATGTGCTGGACTTTATACGCTTT
Anolis_carolinensis|8161           TCCTTGGGACAGTATATTCAC---CCAAGAGGCGTATCTGTGCTGGACTTCGTGAGGTTT
Macropus_eugenii|4057              ACGTTGGGACAGTACGTAAAG---CCTCAGGGTGTGTCTGTGATAGATTTTTTGAGGTTT
Dasypus_novemcinctus|3623          ACATTGGGACAGTATGTGCAG---CCTCAGGGGGTGTCCGTAGTAGACTTTGTGCGGTTT
Vicugna_pacos|12248                ACACTGGGTCAGTATGTGCAG---CCCCAGGGAGTGTCTGTAGTAGACTTTGTGCGGTTT
Monodelphis_domestica|33031        ACCTTGGGACAGTATGTAAAG---CCCCAGGGTGTGTCGGTGATAGATTTCTTGCGATTT
Erinaceus_europaeus|4605           ------------------------------------------------------------
Dipodomys_ordii|7565               ACATTGGGACAATATGTGCAG---CCGCAAGGGGTGTCTGTAGTGGACTTTGTGCGGTTT
Choloepus_hoffmanni|2371           ACATTGGGTCAGTATGTGCAG---CCTCAGGGGGTATCTGTAGTAGATTTTGTGCGGTTT
Tupaia_belangeri|11603             ACGTTGGGACAGTATGTGCAG---CCCCAGGGAGTGTCTGTAGTAGACTTTGTGAGGTTT
Myotis_lucifugus|6026              ACACTGGGACAGTATGTGCAG---CCCCAGGGAGTGTCTGTGGTAGACTTTGTGCGGTTT
Ochotona_princeps|10887            ACGCTGGGACAGTATGTGCAG---CCACAGGGTGTGTCCATAGTGGACTTTGTGCGGTTT
Oryctolagus_cuniculus|20731        ACGCTGGGACAGTACGTGCAG---CCGCAGGGCGTCTCTGTAGTGGACTTTGTGCGCTTT
Echinops_telfairi|2743             ACGCTGGGACAGTATGTGCAG---CCCCAGGGGGTGTCTGTCGTGGACTTTGTGCGGTTT
Loxodonta_africana|9658            ACTTTGGGACAGTATGTGCAG---CCCCAGGGGGTGTCTGTAGTGGATTTTGTACGGTTT
Procavia_capensis|17205            ACTTTGGGACAGTATGTGCAG---CCCCAGGGTGTGTCTGTAGTGGACTTTGTGCGGTTT
Equus_caballus|23559               ACATTGGGACAGTATGTGGAG---CCCCACGGGGTGTCTGTGGTAGACTTTGTGCGGTTT
Pteropus_vampyrus|2243             ACGTTGGGACAGTATGTGCAG---CCCCAGGGGGTATCTGTAGTAGACTTTGTGCGATTT
Bos_taurus|21593                   ACACTGGGACAGTACGTGCAG---CCCCATGGGGTGTCCGTCGTAGACTTTGTGCGGTTT
Tursiops_truncatus|15356           ACACTGGGACAGTATGTGCAG---CCCCAAGGGGTGTCTGTAGTAGACTTCGTGCGGTTT
Canis_familiaris|1819              ACATTGGGACAGTATGTGCAG---CCTCAAGGGGTGTCCGTAGTAGACTTTGTGCGGTTT
Microcebus_murinus|4087            ACACTGGGACAGTATGTGCAG---CCCCAGGGGGTGTCTGTGATAGACTTCGTGCGGTTT
Callithrix_jacchus|33342           ACCTTGGGGCAGTATGTGCAG---CCTCAGGGTGTGTCAGTAGTAGACTTTGTGCGGTTT
Rhesus_macaque|7906                ACCTTGGGGCAGTATGTGCAG---CCTCAGGGGGTGTCGGTAGTAGACTTTGTGCGGTTT
Homo_sapiens|21911                 ACCTTGGGGCAGTATGTGCAG---CCTCAGGGGGTGTCGGTAGTAGACTTTGTGCGGTTT
Pongo_abelii|6638                  ACCTTGGGGCAGTATGTGCAG---CCTCAGGGGGTGTCGGTAGTAGACTTTGTGCGGTTT
Gorilla_gorilla|13920              ACCTTGGGGCAGTATGTGCAG---CCTCAGGGGGTGTCGGTAGTAGACTTTGTGCGGTTT
Pan_troglodytes|8842               ACCTTGGGGCAGTATGTGCAG---CCTCAGGGGGTGTCGGTAGTAGACTTTGTGCGGTTT
Otolemur_garnettii|12725           ACCCTGGGACAGTATGTGCAG---CCCCGGGGGGTGTCTGTGGTAGACTTTGTGCGGTTT
Spermophilus_tridecemlineatus|1155 ACATTGGGACAATATGTGCAG---CCCCATGGAGTTTCTGTAGTAGATTTTGTGCGGTTT
Danio_rerio|27878                  ACAGTGGCACAGTACCTGACT---CTTCAAGATGCCCGTGTGCTGGACTTCATACGCTTC
Oryzias_latipes|22623              ACTGTGGCGGAGTTCCTCAGG---GGTCAACAGGCTAAAGTGCTGGACTTTGTCAGATTT
Gasterosteus_aculeatus|7324        ACGGTTGCAGAGTTCCTCAGA---GGTCAACAGGCCCGAGTGCTGGACTTTATCCGATTC
Tetraodon_nigroviridis|2918        ACTGTGGCACAGTTCCTCAAA---GGTCAACAAGCCCGAGTGTTTGACTTTATCCGTTTT
Fugu_rubripes|37364                ACTGTGGCACAGTTCCTCAGA---GGTCAACAGGCCCGTGTGCTTGACTTTGTCCGTTTT
                                                                                               

Bombyx_mori|14079                  GCGGGGCGGGGCGCGTGCTGCGTGCTGCGGGACGGAGCGCGCGTGTGGGTCTGGTGCGCC
Nematostella_vectensis|12314       GAA---------------------------------------------------TGTGGT
Branchiostoma_floridae|28207       GAG---------------------------------------------------TGTGGA
Sorex_araneus|803                  GAG---------------------------------------------------TGTGGA
Xenopus_tropicalis|22987           GAG---------------------------------------------------TGTGGG
Anolis_carolinensis|8161           GAA---------------------------------------------------TGTGGA
Macropus_eugenii|4057              GAA---------------------------------------------------TGTGGA
Dasypus_novemcinctus|3623          GAA---------------------------------------------------TGTGGA
Vicugna_pacos|12248                GAA---------------------------------------------------TGTGGA
Monodelphis_domestica|33031        GAA---------------------------------------------------TGCGGA
Erinaceus_europaeus|4605           ------------------------------------------------------------
Dipodomys_ordii|7565               GAA---------------------------------------------------TGTGGA
Choloepus_hoffmanni|2371           GAG---------------------------------------------------TGTGGA
Tupaia_belangeri|11603             GAA---------------------------------------------------TGTGGA
Myotis_lucifugus|6026              GAA---------------------------------------------------TGTGGC
Ochotona_princeps|10887            GAG---------------------------------------------------TGTGGA
Oryctolagus_cuniculus|20731        GAA---------------------------------------------------TGTGGA
Echinops_telfairi|2743             GAG---------------------------------------------------TGTGGT
Loxodonta_africana|9658            GAA---------------------------------------------------TGTGGT
Procavia_capensis|17205            GAA---------------------------------------------------TGTGGT
Equus_caballus|23559               GAA---------------------------------------------------TGTGGA
Pteropus_vampyrus|2243             GAA---------------------------------------------------TGTGGA
Bos_taurus|21593                   GAG---------------------------------------------------TGTGGA
Tursiops_truncatus|15356           GAA---------------------------------------------------TGTGGA
Canis_familiaris|1819              GAA---------------------------------------------------TGTGGA
Microcebus_murinus|4087            GAA---------------------------------------------------TGTGGA
Callithrix_jacchus|33342           GAA---------------------------------------------------TGTGGA
Rhesus_macaque|7906                GAA---------------------------------------------------TGTGGA
Homo_sapiens|21911                 GAA---------------------------------------------------TGTGGA
Pongo_abelii|6638                  GAA---------------------------------------------------TGTGGA
Gorilla_gorilla|13920              GAA---------------------------------------------------TGTGGA
Pan_troglodytes|8842               GAA---------------------------------------------------TGTGGA
Otolemur_garnettii|12725           ------------------------------------------------------------
Spermophilus_tridecemlineatus|1155 GAA---------------------------------------------------TGTGGA
Danio_rerio|27878                  CAG---------------------------------------------------TGTGGA
Oryzias_latipes|22623              CAG---------------------------------------------------TGTGGT
Gasterosteus_aculeatus|7324        CAG---------------------------------------------------TGTGGC
Tetraodon_nigroviridis|2918        CAG---------------------------------------------------TGTGGA
Fugu_rubripes|37364                CAG---------------------------------------------------TGTGGA
                                                                                               

Bombyx_mori|14079                  GCCTCCGCCACCGGAGACGAACGGGAGGTCGCTAAGAACATGGCCGCCGTTGAACATACC
Nematostella_vectensis|12314       GCGAAG------------------------------------------------------
Branchiostoma_floridae|28207       GAAGTGGAAGAGTCG---------------------------------------------
Sorex_araneus|803                  GAAGGCGGAGAGGCGGCAGAGGCCGGC---------------------------------
Xenopus_tropicalis|22987           GAAGTTGCAGAATCAACAGAATCTAGT---------------------------------
Anolis_carolinensis|8161           GAAGATACAGAATCATTGGAGTCAGAA---------------------------------
Macropus_eugenii|4057              GAAGATTTAGGGGCAACAAAAACAGAA---------------------------------
Dasypus_novemcinctus|3623          GAAGGTGAAGAGGCTGAAGAGGTTGAA---------------------------------
Vicugna_pacos|12248                GAAGGTGACGAGGCAGCGGAGGCCGAG---------------------------------
Monodelphis_domestica|33031        GAAGATTTAAGAACAACAAAAACAGAA---------------------------------
Erinaceus_europaeus|4605           ------------------------------------------------------------
Dipodomys_ordii|7565               GAAAGTGAAGAGACAGTAGAAGCAGAT---------------------------------
Choloepus_hoffmanni|2371           GAAGGGGAAGAGGCAGCAGAGGCAGAA---------------------------------
Tupaia_belangeri|11603             GAAGGCGAAGAGGTGGCAGAGGCTGAG---------------------------------
Myotis_lucifugus|6026              GAAGAGGGAGAGGCAGCAGAGGCTGAA---------------------------------
Ochotona_princeps|10887            GAGGGCGAGGAGGTGGCGGAGGCTGAG---------------------------------
Oryctolagus_cuniculus|20731        GAA---GACGAGGTGGCAGAGGCAGAG---------------------------------
Echinops_telfairi|2743             GAAGGGGAAGAGGCAGTCGAGGCTGAG---------------------------------
Loxodonta_africana|9658            GAAAGCGAAGAGGCAGCGGAGCCTGAA---------------------------------
Procavia_capensis|17205            GAAAATGAAGAGGCAGCAGAAGCTGAA---------------------------------
Equus_caballus|23559               GAAGGCGAAGAGGCAGCAGAAGCTGAA---------------------------------
Pteropus_vampyrus|2243             GAAGGAGAAGAGGCAGCAGAGGCTGAA---------------------------------
Bos_taurus|21593                   GAAGGTGAAGACGCAGCAGACGCCGAA---------------------------------
Tursiops_truncatus|15356           GAAGGCAAAGAGGCAGCAGAGGCTGAA---------------------------------
Canis_familiaris|1819              GAAGGTGAAGAGGCAGCAGAAACCGAA---------------------------------
Microcebus_murinus|4087            GAAGGTGAAGAGGCAGCAGAGGCTGAA---------------------------------
Callithrix_jacchus|33342           GAAGGTGAAGAGGCAGCAGAAACTGAA---------------------------------
Rhesus_macaque|7906                GAAGGTGAAGAGGCAGCAGAAACTGAA---------------------------------
Homo_sapiens|21911                 GAAGGTGAAGAGGCAGCAGAAACTGAA---------------------------------
Pongo_abelii|6638                  GAAGGTGAAGAGGCAGCAGAAACTGAA---------------------------------
Gorilla_gorilla|13920              GAAGGTGAAGAGGCAGCAGAAACTGAA---------------------------------
Pan_troglodytes|8842               GAAGGTGAAGAGGCAGCAGAAACTGAA---------------------------------
Otolemur_garnettii|12725           ------------------------------------------------------------
Spermophilus_tridecemlineatus|1155 GAACTTGAAGAGGCAATAGAGGCTGAA---------------------------------
Danio_rerio|27878                  GAGAGCAGCAGTCAGGAG------------------------------------------
Oryzias_latipes|22623              GAGACCTCTGGTAAAGATCAAAAC------------------------------------
Gasterosteus_aculeatus|7324        GAGTCAGTCGATGACCAATTTCAAGTGCTTATTTTCAACCACAATCCTTCCTCTAAC---
Tetraodon_nigroviridis|2918        GAGACGCTAGATGAAAAGAAG---------------------------------------
Fugu_rubripes|37364                GAG---------------------------------------------------------
                                                                                               

Bombyx_mori|14079                  CTCGTCATGCAGGGTAAAGAAAAGTCCGACTTTTGGGCAGCCTTGGGCGATCGACGTCAT
Nematostella_vectensis|12314       ------------------------------------------------------------
Branchiostoma_floridae|28207       ------------------------------------------------------------
Sorex_araneus|803                  ------------------------------------------------------------
Xenopus_tropicalis|22987           ------------------------------------------------------------
Anolis_carolinensis|8161           ------------------------------------------------------------
Macropus_eugenii|4057              ------------------------------------------------------------
Dasypus_novemcinctus|3623          ------------------------------------------------------------
Vicugna_pacos|12248                ------------------------------------------------------------
Monodelphis_domestica|33031        ------------------------------------------------------------
Erinaceus_europaeus|4605           ------------------------------------------------------------
Dipodomys_ordii|7565               ------------------------------------------------------------
Choloepus_hoffmanni|2371           ------------------------------------------------------------
Tupaia_belangeri|11603             ------------------------------------------------------------
Myotis_lucifugus|6026              ------------------------------------------------------------
Ochotona_princeps|10887            ------------------------------------------------------------
Oryctolagus_cuniculus|20731        ------------------------------------------------------------
Echinops_telfairi|2743             ------------------------------------------------------------
Loxodonta_africana|9658            ------------------------------------------------------------
Procavia_capensis|17205            ------------------------------------------------------------
Equus_caballus|23559               ------------------------------------------------------------
Pteropus_vampyrus|2243             ------------------------------------------------------------
Bos_taurus|21593                   ------------------------------------------------------------
Tursiops_truncatus|15356           ------------------------------------------------------------
Canis_familiaris|1819              ------------------------------------------------------------
Microcebus_murinus|4087            ------------------------------------------------------------
Callithrix_jacchus|33342           ------------------------------------------------------------
Rhesus_macaque|7906                ------------------------------------------------------------
Homo_sapiens|21911                 ------------------------------------------------------------
Pongo_abelii|6638                  ------------------------------------------------------------
Gorilla_gorilla|13920              ------------------------------------------------------------
Pan_troglodytes|8842               ------------------------------------------------------------
Otolemur_garnettii|12725           ------------------------------------------------------------
Spermophilus_tridecemlineatus|1155 ------------------------------------------------------------
Danio_rerio|27878                  ------------------------------------------------------------
Oryzias_latipes|22623              ------------------------------------------------------------
Gasterosteus_aculeatus|7324        ------------------------------------------------------------
Tetraodon_nigroviridis|2918        ------------------------------------------------------------
Fugu_rubripes|37364                ------------------------------------------------------------
                                                                                               

Bombyx_mori|14079                  TTGTTAGTTCCGTCTGCAGTGAAAGAAATAGAGCGCCCCCTCCCGCCCCGCCTATTTTAC
Nematostella_vectensis|12314       ------------------------------------------------------------
Branchiostoma_floridae|28207       ------------------------------------------------------------
Sorex_araneus|803                  ------------------------------------------------------------
Xenopus_tropicalis|22987           ------------------------------------------------------------
Anolis_carolinensis|8161           ------------------------------------------------------------
Macropus_eugenii|4057              ------------------------------------------------------------
Dasypus_novemcinctus|3623          ------------------------------------------------------------
Vicugna_pacos|12248                ------------------------------------------------------------
Monodelphis_domestica|33031        ------------------------------------------------------------
Erinaceus_europaeus|4605           ------------------------------------------------------------
Dipodomys_ordii|7565               ------------------------------------------------------------
Choloepus_hoffmanni|2371           ------------------------------------------------------------
Tupaia_belangeri|11603             ------------------------------------------------------------
Myotis_lucifugus|6026              ------------------------------------------------------------
Ochotona_princeps|10887            ------------------------------------------------------------
Oryctolagus_cuniculus|20731        ------------------------------------------------------------
Echinops_telfairi|2743             ------------------------------------------------------------
Loxodonta_africana|9658            ------------------------------------------------------------
Procavia_capensis|17205            ------------------------------------------------------------
Equus_caballus|23559               ------------------------------------------------------------
Pteropus_vampyrus|2243             ------------------------------------------------------------
Bos_taurus|21593                   ------------------------------------------------------------
Tursiops_truncatus|15356           ------------------------------------------------------------
Canis_familiaris|1819              ------------------------------------------------------------
Microcebus_murinus|4087            ------------------------------------------------------------
Callithrix_jacchus|33342           ------------------------------------------------------------
Rhesus_macaque|7906                ------------------------------------------------------------
Homo_sapiens|21911                 ------------------------------------------------------------
Pongo_abelii|6638                  ------------------------------------------------------------
Gorilla_gorilla|13920              ------------------------------------------------------------
Pan_troglodytes|8842               ------------------------------------------------------------
Otolemur_garnettii|12725           ------------------------------------------------------------
Spermophilus_tridecemlineatus|1155 ------------------------------------------------------------
Danio_rerio|27878                  ------------------------------------------------------------
Oryzias_latipes|22623              ------------------------------------------------------------
Gasterosteus_aculeatus|7324        ------------------------------------------------------------
Tetraodon_nigroviridis|2918        ------------------------------------------------------------
Fugu_rubripes|37364                ------------------------------------------------------------
                                                                                               

Bombyx_mori|14079                  GTCTCCATAGGAGCACCAGGACAGTATTCGTGTAAGTAA
Nematostella_vectensis|12314       ------------------------------------TGA
Branchiostoma_floridae|28207       ------------------------------------TAA
Sorex_araneus|803                  ------------------------------------TAG
Xenopus_tropicalis|22987           ---------------------------------------
Anolis_carolinensis|8161           ------------------------------------TAG
Macropus_eugenii|4057              ------------------------------------TAA
Dasypus_novemcinctus|3623          ------------------------------------TAG
Vicugna_pacos|12248                ------------------------------------TAG
Monodelphis_domestica|33031        ------------------------------------TAG
Erinaceus_europaeus|4605           ---------------------------------------
Dipodomys_ordii|7565               ------------------------------------TAG
Choloepus_hoffmanni|2371           ------------------------------------TAG
Tupaia_belangeri|11603             ------------------------------------TAG
Myotis_lucifugus|6026              ------------------------------------TAG
Ochotona_princeps|10887            ------------------------------------TAG
Oryctolagus_cuniculus|20731        ---------------------------------------
Echinops_telfairi|2743             ------------------------------------TAG
Loxodonta_africana|9658            ------------------------------------TAG
Procavia_capensis|17205            ------------------------------------TAG
Equus_caballus|23559               ------------------------------------TAG
Pteropus_vampyrus|2243             ------------------------------------TAG
Bos_taurus|21593                   ------------------------------------TAG
Tursiops_truncatus|15356           ------------------------------------TAG
Canis_familiaris|1819              ------------------------------------TAG
Microcebus_murinus|4087            ------------------------------------TAG
Callithrix_jacchus|33342           ------------------------------------TAG
Rhesus_macaque|7906                ------------------------------------TAG
Homo_sapiens|21911                 ------------------------------------TAG
Pongo_abelii|6638                  ------------------------------------TAG
Gorilla_gorilla|13920              ------------------------------------TAG
Pan_troglodytes|8842               ------------------------------------TAG
Otolemur_garnettii|12725           ---------------------------------------
Spermophilus_tridecemlineatus|1155 ------------------------------------TAG
Danio_rerio|27878                  ------------------------------------TGA
Oryzias_latipes|22623              ------------------------------------TAA
Gasterosteus_aculeatus|7324        ---------------------------------------
Tetraodon_nigroviridis|2918        ------------------------------------TGA
Fugu_rubripes|37364                ---------------------------------------
                                                                          

multiple sequence alignment in CLUSTALW format


Bombyx_mori|3119                   ----------MIFQLIRRIHTSPA-----------------------------------Y
Nematostella_vectensis|19971       ------------------------------------------------------------
Branchiostoma_floridae|15086       --------------MPCPTGVTRC-----------------SAGVSSLARCLHTCPVLE-
Sorex_araneus|720                  MSLLRP---LRYC-LMARPGSC--------------------FPPPCP-----------A
Xenopus_tropicalis|21938           ------------------------------------------------------------
Anolis_carolinensis|12625          ------------------------------------------------------------
Macropus_eugenii|3692              ----RS---LRLF--------KHL-----GFR---------SRPVPLRSRPFHAGGVGPQ
Dasypus_novemcinctus|3191          MLQIQP---LRLF-FVARTGCRLA-----GPL---------LLQAPQPWHTFHAGTWLSV
Vicugna_pacos|11378                -----------------------A-----GPL---------LLQSPQPWHTFHAGPWLSS
Monodelphis_domestica|12937        MSFFRS---LRLF-RDLGCRSRPVRGCGRGAR---------IYPALSTTSSFFASSLSHL
Erinaceus_europaeus|3772           MSLLRS---LRSC-LPARSGSSPA-----GRL---------LSRPPP----FLAGAGLSS
Dipodomys_ordii|7111               MSLLRS---LQLS-LAARAASRQA-----GSL---------LPPTPQPWHTFHAGPCLS-
Choloepus_hoffmanni|2088           A----------------------------GPL---------LLQPPQPWHTFHAGTWLFV
Tupaia_belangeri|10030             MSLLRS---LRIC-LVVRSGSRPA-----RPL---------QS--LQPWHTFHSGPWMAS
Myotis_lucifugus|5429              MSLLRS---LRLC-LVARTGSCPA-----GPL---------PLQSPQPWHTFHAGHWLS-
Ochotona_princeps|9478             MSLLWS---LRLG-LVARTGSRAA-----GCS---------VFPAPQPRPTFHTGPLLSS
Oryctolagus_cuniculus|20005        MSLLRS---LRLC-LVARTGSRPA-----GCL---------VFQPAQPWHAVHTGPGLAS
Echinops_telfairi|2187             MLLLRS---LRLF-QVARPGSRPA-----GPG---------RREPPPSWPWFHSGPTPAA
Loxodonta_africana|17391           MLLLRS---LRLC-LVAWNGRPPA-----GPL---------LLQPPQPWNTFHVGPSLSD
Procavia_capensis|16094            MLLLRS---LRLC-LVAPIGSRAA-----GPL---------LLQPPQPWHAFHAGSWLSA
Equus_caballus|8494                MSLLRA---LRLC-LVARPRRCPE-----GPL---------LLQSPEPWHSFHAGRWLSS
Pteropus_vampyrus|2120             MSLLRS---LRLY-LAAQTRNCPA-----GAL---------LFQSLQPWHTFHAGPWLSS
Bos_taurus|21152                   MSLLRS---LRLC-LVARTGSCPLSALGPGPLLPSLQAGLPLLQSPQQWHTFHSGSWLS-
Tursiops_truncatus|14523           MSLLRSLRSLRLC-LVARAGSCPV-----GPL---------LLQSPQPWHTFHAGPWLSS
Canis_familiaris|23271             --LLRS---LLFF--PFRCLPPLA-----ASF---------TNQVIFTALLFHAGPWLWS
Microcebus_murinus|3475            MSLLRS---LSFC-LVSRTRSCLA-----GSL---------LLQSPQLWHTFHAGSWLSS
Callithrix_jacchus|25173           MWMLRS---LRVFLLVARTGSHPA-----GSL---------LRQSPQPPHTFHAGPCLSA
Rhesus_macaque|7308                MSLLRS---LRVF-LVARTGSHSA-----GSL---------LRQSPQPRHTLHAGPRLSA
Homo_sapiens|80826                 MSLLRS---LRVF-LVARTGSYPA-----GSL---------LRQSPQPRHTFYAGPRLSA
Pongo_abelii|20815                 MSLLRS---LRVF-LVARTGSHPA-----GSL---------LRQSPQPRHTFHAGPRLSA
Gorilla_gorilla|11351              MSLLRS---LRVF-LVARTGSHPA-----GSL---------LRQSPQPRHTFHAGPRLSA
Pan_troglodytes|14651              MSLLRS---LRVF-LVARTGSHPA-----GSL---------LRQSPQPRHTFHAGPRLSA
Otolemur_garnettii|10944           ------------------------------------------------------------
Spermophilus_tridecemlineatus|1037 MSLLRS---LRLF-LDARTVSLPA-----GSL---------RLQSPQPRHTFHAASWLSA
Danio_rerio|23314                  GRYRTEVAMYSLFRSVRSEVVKGC-------------------LTQHVQSLFTSCPSL--
Oryzias_latipes|23767              ---------MKMFKCAFRAASANAFKVNHGSL----------------QQSVHTGGQLF-
Gasterosteus_aculeatus|868         ----------MTR-DFAKVSVCQH------------------------VQSLHTGCQLL-
Tetraodon_nigroviridis|11323       MSL------GFLFRTAAKLGVCQH------------------------VQPLHTGCQLL-
Fugu_rubripes|7195                 MSLG-----FLAR-TVAKVSVCQH------------------------VQSLHTGCKLL-
                                                                                               

Bombyx_mori|3119                   KAAESSLLAKLRKKTGYTIANCKKALEMHNNDADKAETWLHEQAQAMGWAKATKLAGRTA
Nematostella_vectensis|19971       --MDKSLLGKLRKETGFGFSKCREALVLARNDYAAAEAWLHEQAEKEGWQKANKLQGRSA
Branchiostoma_floridae|15086       -GVTKANLSKLRKKTGFTFVNCRKALEKFENDLEQAEKWLKEQAQKEGWAKATKLQDRQT
Sorex_araneus|720                  AASSKELLVALRRKTGYSFVNCKKALETCGGDLQQXXXXXXXXXXXXXXXXXXXXXXXXX
Xenopus_tropicalis|21938           -AADKELLVKLRKRTGYSFINCKKALEQFSNDFKQAETWLHQQAQKEGWDKASKLQGRKT
Anolis_carolinensis|12625          --AAKELLVKLRKKTGYSYVNCKKALEKFDDDLKEAEIWLHEQAQKEGWSKASKLQGRKT
Macropus_eugenii|3692              AASSKEHLKKLRRKTGYSFTNCKKALETCGGDLAQAEAWLHKQAQKEGWSKAAKLQGRKT
Dasypus_novemcinctus|3191          SASSKELLMKLRRKTGHSFVNCKKALQACGEDLKQAESWLHEQAQKEGWSKAAKLHGRKT
Vicugna_pacos|11378                SASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAESWLHKQAQKEGWSKAAKLHGRKT
Monodelphis_domestica|12937        VVSSKEHLQKLRRKTGYSFTNCKKALENCGGDLTQAEAWLHKQAQKEGWSKATKLKGRKT
Erinaceus_europaeus|3772           STSSKEQLLKLRQKTGYSFVNCKKALETCGGDLRQAETWLHEQAQKEGWSKISKLQGRKT
Dipodomys_ordii|7111               -SSGKELLMKLRRRTGYSFVNCKKALETCDGDLKQAEMWLHKQAQKEGWSKAAKLHGRKT
Choloepus_hoffmanni|2088           SASSKELLMKLRRKTGYSFVNCKKALETCGEDLKQAESWLHKQAQKEGWSKVAKLHGRKT
Tupaia_belangeri|10030             SASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKHAQKEGWSKAAKLHGRKT
Myotis_lucifugus|5429              SASSKDLLMKLRRKTGYSFVNCKKALETCGGDLRQAESWLHEQAQKEGWGKAAKLHGRKT
Ochotona_princeps|9478             SASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAETWLQQQAQKEGWSKAAKLHGRKT
Oryctolagus_cuniculus|20005        SASSKELLMKLRRKTGYSFVNCKKALESCGGDLKQAETWLHKQAQKEGWSKAAKLHGRKT
Echinops_telfairi|2187             SPPSKELLVKLRRKTGYSFVNCKKALDTCGGDLKEAESWLHQEAQKEGWSKAIKLHGRKT
Loxodonta_africana|17391           SASSKELLMKLRRKTGYSFVNCKKALEACGGDLKEAESWLHKQAQNEGWSKAVKLQGRKT
Procavia_capensis|16094            SAYSKELLVKLRRKTGYSFVNCKKALETCGGDLKEAESWLHKQAQKEGWSKAVKLHGRKT
Equus_caballus|8494                SASSKELLMKLRRKTGYAFVNCKKALEACGGDLKKAESWLHKQAQKEGWSKAAKLHGRKT
Pteropus_vampyrus|2120             SVSSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAESWLHEQAQKEGWSKAAKLHGRKT
Bos_taurus|21152                   SASSKELLMKLRRKTGYSFINCKKALETCGGDLKQAESWLHKQAQKEGWSKAARLHGRKT
Tursiops_truncatus|14523           SASSKELLMKLRRRTGYSFVNCKKALETCGGDLKQAESWLHKQAQKEGWSKAARLHGRKT
Canis_familiaris|23271             SAPSKDALVKLRRRTGYSFVNCKKALEACGGDLKQAESWLHKQAQKEGWSRAAKLHGRKT
Microcebus_murinus|3475            SASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEVWLHKQAQQEGWSKAAKLHGRKT
Callithrix_jacchus|25173           SASSKELLMKLRRKTGYSFVNCKKALETCGEDLKQAEIWLHKQAQKEGWSKAAKLQGRKT
Rhesus_macaque|7308                SASSKELLMKLRRNTGYSFVNCKKALETCGGDLKQAEIWLHKQAQKEGWSKAAKLQGRKT
Homo_sapiens|80826                 SASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKT
Pongo_abelii|20815                 SASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKT
Gorilla_gorilla|11351              SASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKT
Pan_troglodytes|14651              SASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKT
Otolemur_garnettii|10944           -----------------------------------AEIWLHKQAQKEGWSKAAKLQGRKT
Spermophilus_tridecemlineatus|1037 SSSSKELLMKLRQKTGYSFVNCKKALETCGGDLKKAEIWLHKQAQKEGWSKATKLSGRKT
Danio_rerio|23314                  -AADKALLLQLRKSTGYTFVNCKKALEKCNNDITQAESWLHGQAKKEGWSKATKLEGRKA
Oryzias_latipes|23767              -AADKALLMKLRKSTGYTFINCKKALEMFDNDPAQAESWLHEQAQKEGWSKANKLEGRKA
Gasterosteus_aculeatus|868         -AAEKALLMKLRKTTGYTFINCKKALERFDNDITQAETWLHAEAQKEGWSRASKLEGRKA
Tetraodon_nigroviridis|11323       -AAEKALLMKLRKNTGYTFTNCKKALEKFDNDLTQAETWLHEQAQKEGWSKANKLEGRKT
Fugu_rubripes|7195                 -AAEKALLMKLRKNTGYTFTNCKKALEKFDNDVTQAETWLHEQAQKEGWTKANKLEGRKT
                                                                                               

Bombyx_mori|3119                   LQGLVAVK---FDKNHGALVELNCETDFVAKNDKFQKMIEDAAIASF-KFAHTKLQAKGP
Nematostella_vectensis|19971       TEGLIGVIVNHSDMNLGAMVEVNCETDFVARNENFVDLVNTVTSTTL-AYRRGIIQRNQK
Branchiostoma_floridae|15086       AQGLVGVA---QEGTMATMVEVNCETDFVARNPKFRQLVTQVAMATL-GDVKAHPQWTLG
Sorex_araneus|720                  XX--------------------XXXXXXXXXXXXXXXXLVNVALGTM-SHRQSSNDQIST
Xenopus_tropicalis|21938           TEGLVGLL---QDGNTSVMVEVNCETDFVARNSKFQQLVQQVAVSTL-RHCQSHQENMSS
Anolis_carolinensis|12625          KEGLIGLL---QEGNSAVMVEVNCETDFVARNARFQHLVQQAAIGTM-HHYQGTMNQLNT
Macropus_eugenii|3692              KEGLIGLL---REGNSAVMVEXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXX
Dasypus_novemcinctus|3191          RQGLIGLL---QEGNTTVLVEXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXX
Vicugna_pacos|11378                KEGLIGLL---QEGNTSVLVEXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXX
Monodelphis_domestica|12937        KEGLIGLL---QEGNSAVMVEVNCETDFVSRNVKFQQLVQQVALGTM-LYCQSLREQLSS
Erinaceus_europaeus|3772           KEGLIGLL---QEENAAVLVEVNCETDFVSRNSNFQHLVQQVALGAM-LHCQSLTEQLST
Dipodomys_ordii|7111               KEGLIGLL---HEGNTAVLVEVNCETDFVSRNLKFQQLVQKVALGTM-LHCKNLKDQLST
Choloepus_hoffmanni|2088           KEGLIGLL---QEGNTTVLVEVNCETDFVSRNLKFQQLVHQVALGTM-LHCQSLKDELST
Tupaia_belangeri|10030             KEGLIGLL---LEGNTTVLVEVNCETDFVSRNLKFQQLVQQVALGTM-LHCQSLKDQLST
Myotis_lucifugus|5429              KEGLIGLL---QEGNSTVLVEVNCETDFVARNLKFQQLVQQVALGTM-LXXXXXXXXXXX
Ochotona_princeps|9478             REGLIGLL---QEGNATVLVEVNCETDFVSRNVKFQQLVQQVALGTM-LHCQSQQDQLST
Oryctolagus_cuniculus|20005        REGLIGLL---QEGNAAVLVEVNCETDFVSRNLKFQQLVQQVALGAM-LHCRSLEEQPST
Echinops_telfairi|2187             KEGLIGLL---QEGNTAVLVEVNCETDFVSRNSKFQQLVQQVAVGTL-LHCQSLKEQLPT
Loxodonta_africana|17391           KEGLIGLL---QEGNTTVLVEVNCETDFVSRNSKFQQLVQQVAVGTL-LHCQNLKDQLST
Procavia_capensis|16094            KEGLVGLL---QEGNTSVLVEVNCETDFVSRNSKFQQLVQQVAVGTL-LHCQSLKDQLST
Equus_caballus|8494                KEGLIGLL---QEGNTTVLVEVNCETDFVSRNLKFQQLVQQVALGTM-LHCQSLKDQLSS
Pteropus_vampyrus|2120             KEGLIGLL---QEGSTTVLVEVNCETDFVSRNLKFQQLVQQVALGTI-LHCQSLKSQLST
Bos_taurus|21152                   KEGLIGLL---QEGDTTVLVEVNCETDFVSRNLKFQQLVQQVALGTL-LHCQNLKDQLST
Tursiops_truncatus|14523           KEGLIGLL---QEGNTTVLVEVNCETDFVSRNLKFQQLVQQVALGTL-LHCQSLKDQLST
Canis_familiaris|23271             KEGLIGLL---QDGNATVLVEVNCETDFVSRNLKFQQLVQQVALGTL-LHCQNLKDQLST
Microcebus_murinus|3475            KEGLIGLL---QEGNVTVLVEVNCETDFVSKNLRFQQLVQQVALGTM-LHCQSLKDQVST
Callithrix_jacchus|25173           KEGLIGLL---QEGNITVLVEVNCETDFVSRNLKFQQLVQQVALGTM-MHCQNLKDQLST
Rhesus_macaque|7308                KEGLIGLL---QEGNTTVLVEVNCETDFVSRNLKFQQLVQQVALGTM-MYCQSLKDQLST
Homo_sapiens|80826                 KEGLIGLL---QEGNTTVLVEVNCETDFVSRNLKFQLLVQQVALGTM-MHCQTLKDQPSA
Pongo_abelii|20815                 KEGLIGLL---QEGNTTVLVEVNCETDFVSRNLKFQQLVQQVALGTM-MHCQTLKDQPST
Gorilla_gorilla|11351              KEGLIGLL---QEGNTTVLVEVNCETDFVSRNLKFQLLVQQVALGTM-MHCQTLKDQPST
Pan_troglodytes|14651              KEGLIGLL---QEGNTTVLVEVNCETDFVSRNLKFQLLVQQVALGTM-MHCQTLKDQPST
Otolemur_garnettii|10944           KEGLIGLL---QEGNATVLVEVNCETDFVSRNLRFQQLVQQVALGTM-LHCQNLKEQVST
Spermophilus_tridecemlineatus|1037 KEGLIGLL---QEGNTTVLVEVNCETDFVSRNLKFQQLVQQVALGTM-LHCRSLKDQLST
Danio_rerio|23314                  KEGLIGLM---MHDNAAVMVEVNCETDFVARNEKFQQLVKDVALSVM-AHQ--STSKKTG
Oryzias_latipes|23767              KEGLIGVF---VGDAAAVMVEVNCETDFVARNDKFQQLVKDVTFATLDHHLQSRNQSKSG
Gasterosteus_aculeatus|868         KEGLVGLF---IQDTAAVMVEVNCETDFVARNDKFQQLVKDVAFATL-AHHRNKTQSKTG
Tetraodon_nigroviridis|11323       KEGLIGLF---IGDNEAVMVEVNCETDFVARNEKFQQLVKDVAMATL-AHR--PKKGQAG
Fugu_rubripes|7195                 KEGLVGLF---IGNNEAVMVEVNCETDFVARNEKFQQLVKNVAFASL-AHRQKKDQA--G
                                                                                               

Bombyx_mori|3119                   ITKGVYIVDSGSRGVWAWI-------GPQATGPGKRGALAAARGLARAKRHTGAVCVTTA
Nematostella_vectensis|19971       LNMFGDQVTHLR--------------EFILTHELSNLRVEHNNPDSMLLSDMVAKVIGKL
Branchiostoma_floridae|15086       WLK-----------------------ALHTGEELKQLQIGDTT-----LGDLTALTIGTL
Sorex_araneus|720                  YSGXXXXXXXXXXXXXXXXXXXXX--GFLNSSELSELPAGPGREGS--LKDQLTLAIGKL
Xenopus_tropicalis|21938           YVK-----------------------GFLSGEELLQMKA---EESL--LKDQLALAIGKL
Anolis_carolinensis|12625          YAK-----------------------CLLKSNELSQLKIGPD-GSL--LSDQLALAIGKL
Macropus_eugenii|3692              XXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXKL
Dasypus_novemcinctus|3191          XXXXXXXXXXXXXXXXXXXXXXXX--GFLNSSELCGLRAGPDREGC--LKDQLALAIGKL
Vicugna_pacos|11378                XXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXKL
Monodelphis_domestica|12937        YRK-----------------------GFLETAELSQLRAGPDREDS--LKDQLTLFIGKL
Erinaceus_europaeus|3772           YRK-----------------------GFLSSSELSELPAGPEHEGF--LKDQLALAV---
Dipodomys_ordii|7111               YSKXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXKL
Choloepus_hoffmanni|2088           YSK-----------------------XXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXX
Tupaia_belangeri|10030             YSKXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXKL
Myotis_lucifugus|5429              XXXXXXXXXXXXXXXXXXXXXXXX--GFLNSSELSELPFGPERKGS--LKDQLALAIEKV
Ochotona_princeps|9478             YRKXXXXXXXXXXXXXXXXXXXXX--GFLDSKALSGLPTGPDQEGF--LKDQLALAIGKL
Oryctolagus_cuniculus|20005        YSKVSLGSAPAPGLWAPLCPLVHQ--GFLDSSELSGLPAGPDREGC--LKDQLALAIGKL
Echinops_telfairi|2187             YSK-----------------------GFLNSSELSELRAGPDREGS--LKDQLALAIGNL
Loxodonta_africana|17391           YSK-----------------------GFLNSTELSELPAGPDREGS--LKDQLALAIGNL
Procavia_capensis|16094            YSKVWLNTVAANGK------------GFLNSSELSELQAGPDREGS--LKDQLALAIGNL
Equus_caballus|8494                YSK-----------------------GFLNSSELSELPAGPETEGF--LKDQLALAIGKL
Pteropus_vampyrus|2120             YSK-----------------------GFLNSSELSELPAGPEREGC--LKDQLALAIGKL
Bos_taurus|21152                   YSK-----------------------GFLNSSELSELPAGPEREGS--LKDQLALAIGKL
Tursiops_truncatus|14523           YSK-----------------------GFLNSSELSELPAGREREGC--LRDQLALAIGKL
Canis_familiaris|23271             YSK-----------------------GFLNSSELSELPAGPEKEGC--LKDQLALAIGKL
Microcebus_murinus|3475            YSK-----------------------GFLNSSELSGLPAGLGREGS--LKDQLALAIGKL
Callithrix_jacchus|25173           YSK-----------------------GFLNSSELSRLPAGPDREGS--LKDHLALAIGKL
Rhesus_macaque|7308                YSKVRWLTPVIPALWEAKAGGSLKLGGFLNSSELSGLPAGPDRDGS--LKDQLALAIGKL
Homo_sapiens|80826                 YSK-----------------------GFLNSSELSGLPAGPDREGS--LKDQLALAIGKL
Pongo_abelii|20815                 YSK-----------------------GFLNSSELSGLPAGPDREGS--LKDQLALAIGKL
Gorilla_gorilla|11351              YSK-----------------------GFLNSSELSGLPAGPDREGS--LKDQLALAIGKL
Pan_troglodytes|14651              YSKVQWLTPVNLALWEAEAGGSLE--GFLNSSELSGLPAGPDREGS--LKDQLALAIGKL
Otolemur_garnettii|10944           YSKXXXXXXXXXXXXXXXXXXXXX--GFLNSSELSGLPAGPDREGS--LKDHLALAIGKL
Spermophilus_tridecemlineatus|1037 YSKXXXXXXXXXXXXXXXXXXXXX--GFLNSSELSGLPAGPDRERS--LKDQLALAIGKL
Danio_rerio|23314                  FIK-----------------------SVLSSEDMSKLNAP--DGPS--LADQLALTIGRL
Oryzias_latipes|23767              YVK-----------------------NLLAGDELSRLRMG--EGAA--LADSVALTIGRL
Gasterosteus_aculeatus|868         YVK-----------------------SILAGDELNKLCVE--EGAS--LSDRVALTIGRL
Tetraodon_nigroviridis|11323       YVK-----------------------NFLSNEDLNKLSL--DDGVS--LADQVALTIGRL
Fugu_rubripes|7195                 YVK-----------------------NFLSTEDLSKLSTA--DGVS--LADQVALAIGRL
                                                                                               

Bombyx_mori|3119                   GREPLEFASLFRNWRWCDARRDIRVRAARSATTKLDAVNLATNAWLAAEAQLPDDGSGSL
Nematostella_vectensis|19971       G----------------------------------ENIKLGKAITITT------------
Branchiostoma_floridae|15086       G----------------------------------ENIQIRRAMYYSV------------
Sorex_araneus|720                  G----------------------------------ENMTLKRAAWVSV------------
Xenopus_tropicalis|21938           G----------------------------------ENMTMKRAAWVKT------------
Anolis_carolinensis|12625          G----------------------------------ENMVIKRAVWVSV------------
Macropus_eugenii|3692              G----------------------------------ENLTLKRAAWVTV------------
Dasypus_novemcinctus|3191          G----------------------------------ENMTLKRAAWVKV------------
Vicugna_pacos|11378                G----------------------------------ENMTLKRAAWVKV------------
Monodelphis_domestica|12937        G----------------------------------ENLTLKRAAWVTV------------
Erinaceus_europaeus|3772           ------------------------------------------------------------
Dipodomys_ordii|7111               G----------------------------------ENMTLKRAAWVKV------------
Choloepus_hoffmanni|2088           X----------------------------------XXXXXXXXXXXXX------------
Tupaia_belangeri|10030             G----------------------------------ENMILKRAAWVKV------------
Myotis_lucifugus|5429              R----------------------------------ENMTLKRAAWVKV------------
Ochotona_princeps|9478             G----------------------------------ENMILKRAAWVKV------------
Oryctolagus_cuniculus|20005        G----------------------------------ENMTLKRAAWVKV------------
Echinops_telfairi|2187             G----------------------------------ENMTLKRAAWVKV------------
Loxodonta_africana|17391           G----------------------------------ENMTLKRAAWVKV------------
Procavia_capensis|16094            G----------------------------------ENMTLKRAAWVKV------------
Equus_caballus|8494                G----------------------------------ENMSLKRAAWVKV------------
Pteropus_vampyrus|2120             G----------------------------------ENMILKRAAWVKV------------
Bos_taurus|21152                   G----------------------------------ENMILKRAAWVKV------------
Tursiops_truncatus|14523           G----------------------------------ENMILKRAAWVKV------------
Canis_familiaris|23271             G----------------------------------ENMTLKRAAWVKV------------
Microcebus_murinus|3475            G----------------------------------ENLTLKRAAWVKV------------
Callithrix_jacchus|25173           G----------------------------------ENMTLKRAAWVKV------------
Rhesus_macaque|7308                G----------------------------------ENMTLKRAAWVKV------------
Homo_sapiens|80826                 G----------------------------------ENMILKRAAWVKV------------
Pongo_abelii|20815                 G----------------------------------ENMILKRAAWVKV------------
Gorilla_gorilla|11351              G----------------------------------ENMILKRAAWVKV------------
Pan_troglodytes|14651              G----------------------------------ENMILKRAAWVKV------------
Otolemur_garnettii|10944           G----------------------------------ENMTLRRAAWVKV------------
Spermophilus_tridecemlineatus|1037 G----------------------------------ENMTLKRAAWVKV------------
Danio_rerio|23314                  G----------------------------------ENIAMRRAVSLSV------------
Oryzias_latipes|23767              G----------------------------------ENMSVKRAVMVGV------------
Gasterosteus_aculeatus|868         G----------------------------------ENLSVRRAVTVGV------------
Tetraodon_nigroviridis|11323       G----------------------------------ENMSVKRAVTVGV------------
Fugu_rubripes|7195                 G----------------------------------ENMSLKRAVALGV------------
                                                                                               

Bombyx_mori|3119                   RVWRVRRCGVDEDAEKEADGALAEVERPQAAAFYDRDCYIVLYTYHSPNGDQTMIYYWMG
Nematostella_vectensis|19971       ---------------------------D--SDNVIGSYVHGPYV---TKVH-QCSFGKYG
Branchiostoma_floridae|15086       ---------------------------PPIPTKHVGVYVHAPVAGTTGGQSGSCALGKYG
Sorex_araneus|720                  ---------------------------P--AGLHVGAYVHGAVQ--GPAPH-SPLLGKYG
Xenopus_tropicalis|21938           ---------------------------P--SDIFIGSYMHGILVADVPSLS-NITFGKYG
Anolis_carolinensis|12625          ---------------------------P--ENNFIGSYVHGAPPDGNPLLS-HIMFGKYG
Macropus_eugenii|3692              ---------------------------P--NGFYIGSYVHGAVH--SPSLG-NMVLGKYG
Dasypus_novemcinctus|3191          ---------------------------P--SGFYVGSYVHGATH--SPLLH-NLVLGKYG
Vicugna_pacos|11378                ---------------------------P--AGFYVGSYVHGAMH--SPSLH-NLVLGKYG
Monodelphis_domestica|12937        ---------------------------P--NGFYIGSYVHGAMH--SPSLG-NMVLGKYG
Erinaceus_europaeus|3772           ------------------------------------------------------------
Dipodomys_ordii|7111               ---------------------------P--SGFYVGSYVHGTMH--SPSLH-NLVLGKYG
Choloepus_hoffmanni|2088           ------------------------------------------------------------
Tupaia_belangeri|10030             ---------------------------P--SGFYVGSYVHGVMH--SPLLH-NLVLGKYG
Myotis_lucifugus|5429              ---------------------------P--NGFYVGSYVHGTMH--SPSLH-NLVLGKYG
Ochotona_princeps|9478             ---------------------------P--SGFYVGSYVHGAIH--SPSLH-NLVLGKYG
Oryctolagus_cuniculus|20005        ---------------------------P--SGFYIGSYVHGAVH--SPSLH-SLVLGKYG
Echinops_telfairi|2187             ---------------------------P--SGFYVGSYIHGASH--SPSLH-NLVFGKYG
Loxodonta_africana|17391           ---------------------------P--SGFYVGSYVHGAMH--SPSFH-NLVLGKYG
Procavia_capensis|16094            ---------------------------P--SGFWVGSYVHGAMH--GPSLH-NLVLGKYG
Equus_caballus|8494                ---------------------------P--AGFFVGSYVHGAMH--SPSLH-NLVLGKYG
Pteropus_vampyrus|2120             ---------------------------P--AGFYVGSYVHGATH--SPSLH-NLVLGKYG
Bos_taurus|21152                   ---------------------------P--AGFYVGSYVHGAMH--SPSLH-NLVLGKYG
Tursiops_truncatus|14523           ---------------------------P--AGFYVGSYVHGAMH--SPSLH-NLVLGKYG
Canis_familiaris|23271             ---------------------------P--AGFYVGSYVHGAMH--SSSLH-NLELGKYG
Microcebus_murinus|3475            ---------------------------P--SGFYVGSYVHGGMH--TPSLH-NLGLGKYG
Callithrix_jacchus|25173           ---------------------------P--SGFYVGSYVHGVMQ--SPSLH-NLVLGKYG
Rhesus_macaque|7308                ---------------------------P--SGFYVGSYVHGAMQ--SPSLH-NLVLGKYG
Homo_sapiens|80826                 ---------------------------P--SGFYVGSYVHGAMQ--SPSLH-KLVLGKYG
Pongo_abelii|20815                 ---------------------------P--SGFYVGSYVHGAMQ--SPSLH-NLALGKYG
Gorilla_gorilla|11351              ---------------------------P--SGFYVGSYVHGAMQ--SPSLH-KLVLGKYG
Pan_troglodytes|14651              ---------------------------P--SGFYVGSYVHGAMQ--SPSLH-KLVLGKYG
Otolemur_garnettii|10944           ---------------------------P--SGFYVGSYVHGTMH--SPSLH-NLVLGKYA
Spermophilus_tridecemlineatus|1037 ---------------------------P--SGFYVGSYVHGAMH--SPSLH-NLVLGKYG
Danio_rerio|23314                  ---------------------------P--SDWHIGSYIHGTVA----GQV-GIEMGRYG
Oryzias_latipes|23767              ---------------------------P--AEWRIGSYVHGNVG----SQQ-EVAMGRYG
Gasterosteus_aculeatus|868         ---------------------------P--AEWHIGSYVHGGVH----GQT-EVAMGRYA
Tetraodon_nigroviridis|11323       ---------------------------P--AEWRIGSYVHGGVG----TQP-ELAMGRYG
Fugu_rubripes|7195                 ---------------------------P--AGWHIGSYVHGDVG----TQT-ELAMGRYG
                                                                                               

Bombyx_mori|3119                   GSAPNDLRNL--GAKEAKDLYIKLGRLPVQAWVYQGKEPAHFLQIFKGRMITYVGSATD-
Nematostella_vectensis|19971       AMVAVKPIKKGIDTSSLALLANKLAQHVV------GMNPKV------------IGQGGEA
Branchiostoma_floridae|15086       ALVAFRRKNTEFQNFNAAELGRRLGQHVV------GMSPLT------------VGEMPEV
Sorex_araneus|720                  ALVVCEAAEP---KANLEDIGRRLGQHVV------GMAPLS------------VGSLDD-
Xenopus_tropicalis|21938           ALVICKDSDSN-PKSNISEVGRRLGQHVV------GMNPLS------------VGSLED-
Anolis_carolinensis|12625          ALVICSPSEQC-PKSNFPELGWRLGQHVV------GMAPLS------------VGSMED-
Macropus_eugenii|3692              ALVICQTSEE---NSNLEDLGRRLGQHVV------GMAPLS------------VGSMED-
Dasypus_novemcinctus|3191          AVVVCETSEQ---KANLEDLGRRLGQHVV------GMAPLS------------VGSLDD-
Vicugna_pacos|11378                ALVVCETSER---KANLEDLGRRLGQHVV------GMAPLS------------VGSLDD-
Monodelphis_domestica|12937        ALVICQTTEK---KQNLEDLGRRLGQHVV------GMAPLS------------VGSMDD-
Erinaceus_europaeus|3772           ------------------------------------------------------------
Dipodomys_ordii|7111               ALVICETSVR---KVNLEDLGRRLGQHVV------GMAPLS------------VGSLDD-
Choloepus_hoffmanni|2088           ---------------------XXXXQHVV------GMAPLS------------VGSLDD-
Tupaia_belangeri|10030             ALVICETSER---KANLEDLGRRLGQHVV------GMAPLS------------VGSLDD-
Myotis_lucifugus|5429              ALVICEISEW---KANLEELGRRLGQHVV------GMAPLS------------VGSLDD-
Ochotona_princeps|9478             ALVICETAEQ---PANLEDLGRHLGQHVV------GMAPLS------------VGSLDD-
Oryctolagus_cuniculus|20005        ALVVCETSEQ---NANLEDLGRRLGQHVV------GMAPLS------------VGSLDD-
Echinops_telfairi|2187             ALVVCETSER---KANLEDLGRRLGQHVV------GMAPLS------------VGSLDD-
Loxodonta_africana|17391           ALVVCETSER---KANLEDLGRRLGQHVV------GMAPLS------------VGSLDD-
Procavia_capensis|16094            ALVICETSEQ---KANLEDLGRRLGQHVV------GMAPLS------------VGSLDD-
Equus_caballus|8494                ALVVCETSEQ---RADLEDLGRRLGQHVV------GMAPLS------------VGSLDD-
Pteropus_vampyrus|2120             ALVICETSEQ---TANLEDLGRRLGQHVV------GMAPLS------------VGSLDD-
Bos_taurus|21152                   ALVICETSEL---KANLADLGRRLGQHVV------GMAPLS------------VGSLDD-
Tursiops_truncatus|14523           ALVICETSEQ---KANLEDLGRRLGQHVV------GMAPLS------------VGSLDD-
Canis_familiaris|23271             ALVVCETSER---KASLEDLGRRLGQHVV------GMAPLS------------VGSLDD-
Microcebus_murinus|3475            ALVVCETSEQ---KANLEDLGRRLGQHVV------GMAPLS------------VGSLDD-
Callithrix_jacchus|25173           ALVICETSEQ---NANLEDIGRRLGQHVV------GMAPLS------------VGSLDD-
Rhesus_macaque|7308                ALVICETSEQ---KTNLEDIGRRLGQHVV------GMAPLS------------VGSLDD-
Homo_sapiens|80826                 ALVICETSEQ---KTNLEDVGRRLGQHVV------GMAPLS------------VGSLDD-
Pongo_abelii|20815                 ALVICETSEQ---KTNLEDVGRRLGQHVV------GMAPLS------------VGSLDD-
Gorilla_gorilla|11351              ALVICETSEQ---KTNLEDVGRRLGQHVV------GMAPLS------------VGSLDD-
Pan_troglodytes|14651              ALVICETSEQ---KTNLEDVGRRLGQHVV------GMAPLT------------VGSLDD-
Otolemur_garnettii|10944           ALVVCETTEQ---KAKLEDLGRRLGQHVV------GMAPLS------------VGSLDD-
Spermophilus_tridecemlineatus|1037 ALVICETSEQ---KANLEDLGRRLGQHVV------GMAPLS------------VGSLDD-
Danio_rerio|23314                  SLVVFQGEP----KEGTYALGRKLAQHVM------GEAPVS------------LGNMDD-
Oryzias_latipes|23767              ALVIFQGGK----EGEQDMLGRKLGQHIV------GEAPLS------------LGNMDD-
Gasterosteus_aculeatus|868         ALVVFQGGE----KEQWDVLGRKLGQHIV------GEAPVS------------LGNMDD-
Tetraodon_nigroviridis|11323       ALVIFEGGK----KGEEDVLGRQLGRHVV------GEAPQS------------LGNMDD-
Fugu_rubripes|7195                 ALVVFEGGK----EGEEEVLGRKLGRHVV------GEAPES------------LGNMDD-
                                                                                               

Bombyx_mori|3119                   YDPSG------------------R---RVIPPSRVL--ILVSGQYAREARGTEVRGAVRG
Nematostella_vectensis|19971       DEKGG------------------ESEA-LLDQEYLLDGSLTVGQFTE-KEGVQVVDFVRY
Branchiostoma_floridae|15086       REEEGEKKDGDKQDEEERSTDSDEDETQMLRQTFLLDPTMTVGEMTR-QQGIELLDFVRF
Sorex_araneus|720                  -VPGG------------------DSETRMLSQPYLLDPSITLGQYVQ-PQGVSVVDFVRF
Xenopus_tropicalis|21938           -ESSG------------------ETETKMLAQSFLLEPSLTVGQYLQ-PRGINVLDFIRF
Anolis_carolinensis|12625          -EPGG------------------DSETKMLPQPFLLDPTISLGQYIH-PRGVSVLDFVRF
Macropus_eugenii|3692              -EPGG------------------EEETKMLAQPYLLNPSITLGQYVK-PQGVSVIDFLRF
Dasypus_novemcinctus|3191          -EPGG------------------EAETKMLSQPYLLDPSITLGQYVQ-PQGVSVVDFVRF
Vicugna_pacos|11378                -EPGG------------------EAETKMLSQPYLLDPSITLGQYVQ-PQGVSVVDFVRF
Monodelphis_domestica|12937        -EPGG------------------EEETKMLAQPYLLDPSITLGQYVK-PQGVSVIDFLRF
Erinaceus_europaeus|3772           ------------------------------------------------------------
Dipodomys_ordii|7111               -EPGG------------------ESETKMLSQPYLLDPSITLGQYVQ-PQGVSVVDFVRF
Choloepus_hoffmanni|2088           -EPGG------------------DAETKMLSQPYLLDPSITLGQYVQ-PQGVSVVDFVRF
Tupaia_belangeri|10030             -EPGG------------------EAETKMLSQPYLLDPSVTLGQYVQ-PQGVSVVDFVRF
Myotis_lucifugus|5429              -EPGG------------------ETETKMLSQPYLLDPSITLGQYVQ-PQGVSVVDFVRF
Ochotona_princeps|9478             -EPGG------------------EAETKMLSQPYLLDPSITLGQYVQ-PQGVSIVDFVRF
Oryctolagus_cuniculus|20005        -EPGG------------------EAETKMLSQPYLLDPSITLGQYVQ-PQGVSVVDFVRF
Echinops_telfairi|2187             -EPGG------------------EAETKMLSQPYLLDPSITLGQYVQ-PQGVSVVDFVRF
Loxodonta_africana|17391           -EPGG------------------EMETKMLSQPYLLDPSITLGQYVQ-PQGVSVVDFVRF
Procavia_capensis|16094            -EPGG------------------EMETRMLCQPYLLDPSITLGQYVQ-PQGVSVVDFVRF
Equus_caballus|8494                -EPGG------------------EAETKMLSQPYLLDPSITLGQYVE-PHGVSVVDFVRF
Pteropus_vampyrus|2120             -EPGG------------------EAETKMLSQPYLLDPSITLGQYVQ-PQGVSVVDFVRF
Bos_taurus|21152                   -EPGG------------------EAETKMLSQPYLLDPSITLGQYVQ-PHGVSVVDFVRF
Tursiops_truncatus|14523           -EPGG------------------EAETKMLSQPYLLDPSITLGQYVQ-PQGVSVVDFVRF
Canis_familiaris|23271             -EPGG------------------EAETKMLSQPYLLDPSITLGQYVQ-PQGVSVVDFVRF
Microcebus_murinus|3475            -EPGG------------------EAETKMLSQPYLLDPSITLGQYVQ-PQGVSVIDFVRF
Callithrix_jacchus|25173           -EPGG------------------EAETKMLSQPYLLDPSITLGQYVQ-PQGVSVVDFVRF
Rhesus_macaque|7308                -EPGG------------------EAETKMLSQPYLLDPSITLGQYVQ-PQGVSVVDFVRF
Homo_sapiens|80826                 -EPGG------------------EAETKMLSQPYLLDPSITLGQYVQ-PQGVSVVDFVRF
Pongo_abelii|20815                 -EPGG------------------EAETKMLSQPYLLDPSITLGQYVQ-PQGVSVVDFVRF
Gorilla_gorilla|11351              -EPGG------------------EAETKMLSQPYLLDPSITLGQYVQ-PQGVSVVDFVRF
Pan_troglodytes|14651              -EPGG------------------EAETKMLSQPYLLDPSITLGQYVQ-PQGVSVVDFVRF
Otolemur_garnettii|10944           -EPGG------------------EAETKMLSQPYLLDPSITLGQYVQ-PRGVSVVDFVRF
Spermophilus_tridecemlineatus|1037 -EPGG------------------EAETKMLSQPYLLDPSITLGQYVQ-PHGVSVVDFVRF
Danio_rerio|23314                  -LSCG------------------DSETRLLPQTFLPDPKYTVAQYLT-LQDARVLDFIRF
Oryzias_latipes|23767              -LPCG------------------ESETRLLPQTFLADPSRTVAEFLR-GQQAKVLDFVRF
Gasterosteus_aculeatus|868         -LPCG------------------ESETRLLPQTFLGDPSRTVAEFLR-GQQARVLDFIRF
Tetraodon_nigroviridis|11323       -LPCG------------------ESETRLLPQTFLGDPSRTVAQFLK-GQQARVFDFIRF
Fugu_rubripes|7195                 -LPCG------------------ESETRLLPQTFLGDPSRTVAQFLR-GQQARVLDFVRF
                                                                                               

Bombyx_mori|3119                   AGRGACCVLRDGARVWVWCAASATGDEREVAKNMAAVEHTLVMQGKEKSDFWAALGDRRH
Nematostella_vectensis|19971       E-----------------CGAK--------------------------------------
Branchiostoma_floridae|15086       E-----------------CGEVEES-----------------------------------
Sorex_araneus|720                  E-----------------CGEGGEAAEAG-------------------------------
Xenopus_tropicalis|21938           E-----------------CGEVAESTESS-------------------------------
Anolis_carolinensis|12625          E-----------------CGEDTESLESE-------------------------------
Macropus_eugenii|3692              E-----------------CGEDLGATKTE-------------------------------
Dasypus_novemcinctus|3191          E-----------------CGEGEEAEEVE-------------------------------
Vicugna_pacos|11378                E-----------------CGEGDEAAEAE-------------------------------
Monodelphis_domestica|12937        E-----------------CGEDLRTTKTE-------------------------------
Erinaceus_europaeus|3772           ------------------------------------------------------------
Dipodomys_ordii|7111               E-----------------CGESEETVEAD-------------------------------
Choloepus_hoffmanni|2088           E-----------------CGEGEEAAEAE-------------------------------
Tupaia_belangeri|10030             E-----------------CGEGEEVAEAE-------------------------------
Myotis_lucifugus|5429              E-----------------CGEEGEAAEAE-------------------------------
Ochotona_princeps|9478             E-----------------CGEGEEVAEAE-------------------------------
Oryctolagus_cuniculus|20005        E-----------------CGE-DEVAEAE-------------------------------
Echinops_telfairi|2187             E-----------------CGEGEEAVEAE-------------------------------
Loxodonta_africana|17391           E-----------------CGESEEAAEPE-------------------------------
Procavia_capensis|16094            E-----------------CGENEEAAEAE-------------------------------
Equus_caballus|8494                E-----------------CGEGEEAAEAE-------------------------------
Pteropus_vampyrus|2120             E-----------------CGEGEEAAEAE-------------------------------
Bos_taurus|21152                   E-----------------CGEGEDAADAE-------------------------------
Tursiops_truncatus|14523           E-----------------CGEGKEAAEAE-------------------------------
Canis_familiaris|23271             E-----------------CGEGEEAAETE-------------------------------
Microcebus_murinus|3475            E-----------------CGEGEEAAEAE-------------------------------
Callithrix_jacchus|25173           E-----------------CGEGEEAAETE-------------------------------
Rhesus_macaque|7308                E-----------------CGEGEEAAETE-------------------------------
Homo_sapiens|80826                 E-----------------CGEGEEAAETE-------------------------------
Pongo_abelii|20815                 E-----------------CGEGEEAAETE-------------------------------
Gorilla_gorilla|11351              E-----------------CGEGEEAAETE-------------------------------
Pan_troglodytes|14651              E-----------------CGEGEEAAETE-------------------------------
Otolemur_garnettii|10944           ------------------------------------------------------------
Spermophilus_tridecemlineatus|1037 E-----------------CGELEEAIEAE-------------------------------
Danio_rerio|23314                  Q-----------------CGESSSQE----------------------------------
Oryzias_latipes|23767              Q-----------------CGETSGKDQN--------------------------------
Gasterosteus_aculeatus|868         Q-----------------CGESVDDQFQVLIFNHNPSSN---------------------
Tetraodon_nigroviridis|11323       Q-----------------CGETLDEKK---------------------------------
Fugu_rubripes|7195                 Q-----------------CGE---------------------------------------
                                                                                               

Bombyx_mori|3119                   LLVPSAVKEIERPLPPRLFYVSIGAPGQYSCK
Nematostella_vectensis|19971       --------------------------------
Branchiostoma_floridae|15086       --------------------------------
Sorex_araneus|720                  --------------------------------
Xenopus_tropicalis|21938           --------------------------------
Anolis_carolinensis|12625          --------------------------------
Macropus_eugenii|3692              --------------------------------
Dasypus_novemcinctus|3191          --------------------------------
Vicugna_pacos|11378                --------------------------------
Monodelphis_domestica|12937        --------------------------------
Erinaceus_europaeus|3772           --------------------------------
Dipodomys_ordii|7111               --------------------------------
Choloepus_hoffmanni|2088           --------------------------------
Tupaia_belangeri|10030             --------------------------------
Myotis_lucifugus|5429              --------------------------------
Ochotona_princeps|9478             --------------------------------
Oryctolagus_cuniculus|20005        --------------------------------
Echinops_telfairi|2187             --------------------------------
Loxodonta_africana|17391           --------------------------------
Procavia_capensis|16094            --------------------------------
Equus_caballus|8494                --------------------------------
Pteropus_vampyrus|2120             --------------------------------
Bos_taurus|21152                   --------------------------------
Tursiops_truncatus|14523           --------------------------------
Canis_familiaris|23271             --------------------------------
Microcebus_murinus|3475            --------------------------------
Callithrix_jacchus|25173           --------------------------------
Rhesus_macaque|7308                --------------------------------
Homo_sapiens|80826                 --------------------------------
Pongo_abelii|20815                 --------------------------------
Gorilla_gorilla|11351              --------------------------------
Pan_troglodytes|14651              --------------------------------
Otolemur_garnettii|10944           --------------------------------
Spermophilus_tridecemlineatus|1037 --------------------------------
Danio_rerio|23314                  --------------------------------
Oryzias_latipes|23767              --------------------------------
Gasterosteus_aculeatus|868         --------------------------------
Tetraodon_nigroviridis|11323       --------------------------------
Fugu_rubripes|7195                 --------------------------------