Orthologs Set ID: EOG4006CS


Orthology Database
OrthoDB4
Gene Symbol(s)
OR4C5,OR4C6,OR4C13

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Bos taurus 27626 384, 1112
Bos taurus 28568 1097, 1113
Bos taurus 29294 1079
Bos taurus 29733 1107
Bos taurus 6619 1105
Bos taurus 6622 1070
Bos taurus 6624 1112
Bos taurus 6627 1105, 1130
Callithrix jacchus 41201 139, 168
Callithrix jacchus 41203 1105, 1134
Callithrix jacchus 41212
Canis familiaris 28666 498, 1038
Canis familiaris 28898 498, 1100
Canis familiaris 8352 1089
Canis familiaris 8363 1099
Canis familiaris 8369 1066
Canis familiaris 8394 1088
Canis familiaris 8407
Canis familiaris 8419
Canis familiaris 8420 1105
Canis familiaris 8421 1114
Canis familiaris 8422 155, 169
Canis familiaris 8432
Canis familiaris 8433 1105
Cavia porcellus 21650
Cavia porcellus 23431
Cavia porcellus 7144 768
Choloepus hoffmanni 10987
Choloepus hoffmanni 258 1104
Choloepus hoffmanni 440
Choloepus hoffmanni 6189
Choloepus hoffmanni 6218 115, 138, 174, 830
Dasypus novemcinctus 13523 174, 225, 231, 393, 504, 978
Dasypus novemcinctus 15676 830
Dasypus novemcinctus 3289 830, 1109
Dasypus novemcinctus 5504 166, 830
Dasypus novemcinctus 6644 117, 131, 141, 169, 177, 830, 990, 1016, 1119
Dasypus novemcinctus 6826 856, 1096, 1104
Dasypus novemcinctus 6897 830, 1069, 1110
Echinops telfairi 10565 33, 64, 98, 117, 120, 141, 147, 169, 178, 830, 1119
Echinops telfairi 11116 22, 33, 45, 57, 70, 94, 114, 125, 141, 147, 166, 830, 1119
Echinops telfairi 11654 830
Echinops telfairi 4282
Echinops telfairi 7364
Equus caballus 5245
Equus caballus 5271
Equus caballus 5278
Erinaceus europaeus 13540
Erinaceus europaeus 2413
Erinaceus europaeus 4256 1110
Erinaceus europaeus 4844 1065
Erinaceus europaeus 4881
Felis catus 1160
Felis catus 31463
Felis catus 6205
Felis catus 6208
Homo sapiens 17605
Homo sapiens 17635
Homo sapiens 17636
Homo sapiens 17643
Homo sapiens 17660
Loxodonta africana 10342
Loxodonta africana 10347
Loxodonta africana 10356
Loxodonta africana 10357
Loxodonta africana 10358
Loxodonta africana 10359 1105
Loxodonta africana 10360
Loxodonta africana 10361
Loxodonta africana 10841 930, 1087
Loxodonta africana 15374 348, 1099
Loxodonta africana 23520
Loxodonta africana 23521
Loxodonta africana 7347 411, 747, 933
Loxodonta africana 7429
Loxodonta africana 8250
Loxodonta africana 8254
Macropus eugenii 10461
Macropus eugenii 12245
Microcebus murinus 10664
Microcebus murinus 2797
Microcebus murinus 3048
Microcebus murinus 5059
Microcebus murinus 9568 830
Monodelphis domestica 24684
Monodelphis domestica 24687
Monodelphis domestica 24688
Monodelphis domestica 24689
Monodelphis domestica 24691
Mus musculus 22846
Mus musculus 22888
Mus musculus 22917
Mus musculus 22921
Mus musculus 22922
Mus musculus 22924
Mus musculus 22928
Mus musculus 22929
Ochotona princeps 11681
Ochotona princeps 15463 364
Ornithorhynchus anatinus 16857
Ornithorhynchus anatinus 16862
Ornithorhynchus anatinus 16863
Ornithorhynchus anatinus 16865
Oryctolagus cuniculus 1850
Oryctolagus cuniculus 1852
Oryctolagus cuniculus 1853
Oryctolagus cuniculus 1854
Oryctolagus cuniculus 1855
Oryctolagus cuniculus 1856 1088
Otolemur garnettii 13491 27, 117, 125, 144, 150, 166, 831
Otolemur garnettii 13504
Otolemur garnettii 1429
Pan troglodytes 6828 603, 856
Pan troglodytes 6844
Pan troglodytes 8167
Procavia capensis 11271 1110
Procavia capensis 16277 950
Procavia capensis 7897 1107
Procavia capensis 8766 1107
Rattus norvegicus 22366
Rattus norvegicus 22372
Rattus norvegicus 22374
Rattus norvegicus 22406
Rattus norvegicus 22431
Rattus norvegicus 22432
Rattus norvegicus 22434 1090
Rattus norvegicus 22435
Rhesus macaque 12555 1088
Sorex araneus 6771 6, 21, 96, 126, 169, 830
Spermophilus tridecemlineatus 10360 33, 72, 105, 108, 129, 166, 830
Spermophilus tridecemlineatus 12911 816, 906
Spermophilus tridecemlineatus 2389
Sus scrofa 11395
Sus scrofa 11396
Sus scrofa 11399 1105
Sus scrofa 11400
Sus scrofa 11406
Sus scrofa 11409
Sus scrofa 11413
Sus scrofa 11414
Sus scrofa 11415
Sus scrofa 11416 1088
Sus scrofa 11423
Sus scrofa 9826
Sus scrofa 9827
Tupaia belangeri 13856
Vicugna pacos 1925 111, 123, 168, 414, 830, 1116
Vicugna pacos 1942

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Bos taurus 6619 ENSBTAT00000053310 ENSBTAG00000031032 IPI00908087.1 bosTau4
Bos taurus 6622 ENSBTAT00000054990 515666 ENSBTAG00000016090 IPI00690154.3 bosTau4
Bos taurus 6624 ENSBTAT00000054703 ENSBTAG00000030909 IPI00691264.4 bosTau4
Bos taurus 6627 ENSBTAT00000057365 ENSBTAG00000039821 IPI00904081.1 bosTau4
Bos taurus 27626 ENSBTAT00000055053 ENSBTAG00000038166 IPI00707771.3 bosTau4
Bos taurus 28568 ENSBTAT00000053515 509515 ENSBTAG00000016405 IPI00904316.1 bosTau4
Bos taurus 29294 ENSBTAT00000056090 781264 ENSBTAG00000040008 LOC781264 bosTau4
Bos taurus 29733 ENSBTAT00000035247 786467 ENSBTAG00000013156 LOC786467 bosTau4
Callithrix jacchus 41201 ENSCJAT00000017845 100397800 ENSCJAG00000009222 OR4C5 calJac3
Callithrix jacchus 41203 ENSCJAT00000062377 100398156 ENSCJAG00000009219 OR4C46 calJac3
Callithrix jacchus 41212 ENSCJAT00000017828 100398500 ENSCJAG00000009216 OR4C13 calJac3
Canis familiaris 28666 ENSCAFT00000039486 ENSCAFG00000028481 canFam2
Canis familiaris 28898 ENSCAFT00000023211 ENSCAFG00000032671 canFam2
Canis familiaris 8352 ENSCAFT00000039804 483566 ENSCAFG00000025561 canFam2
Canis familiaris 8363 ENSCAFT00000023645 483573 ENSCAFG00000014894 canFam2
Canis familiaris 8369 ENSCAFT00000039553 ENSCAFG00000025448 canFam2
Canis familiaris 8394 ENSCAFT00000038845 491531 ENSCAFG00000025068 canFam2
Canis familiaris 8407 ENSCAFT00000013050 491531 ENSCAFG00000008217 LOC491531 canFam2
Canis familiaris 8419 ENSCAFT00000037948 483595 ENSCAFG00000024604 OR08D06 canFam2
Canis familiaris 8420 ENSCAFT00000013076 483596 ENSCAFG00000008239 canFam2
Canis familiaris 8421 ENSCAFT00000013079 ENSCAFG00000032047 canFam2
Canis familiaris 8422 ENSCAFT00000039649 ENSCAFG00000008241 OR4C5 canFam2
Canis familiaris 8432 ENSCAFT00000037940 611068 ENSCAFG00000024597 canFam2
Canis familiaris 8433 ENSCAFT00000039046 483603 ENSCAFG00000025185 canFam2
Cavia porcellus 7144 ENSCPOT00000011881 100714341 ENSCPOG00000011766 OR4C12 cavPor3
Cavia porcellus 23431 ENSCPOT00000015844 100726090 ENSCPOG00000015689 OR4C5 cavPor3
Cavia porcellus 21650 ENSCPOT00000010261 100731914 ENSCPOG00000010168 cavPor3
Choloepus hoffmanni 10987 ENSCHOT00000010982 ENSCHOG00000010959 choHof1
Choloepus hoffmanni 6218 ENSCHOT00000006210 ENSCHOG00000006202 OR4C5 choHof1
Choloepus hoffmanni 6189 ENSCHOT00000006185 ENSCHOG00000006173 choHof1
Choloepus hoffmanni 258 ENSCHOT00000000259 ENSCHOG00000000257 choHof1
Choloepus hoffmanni 440 ENSCHOT00000000440 ENSCHOG00000000438 choHof1
Dasypus novemcinctus 3289 ENSDNOT00000002826 ENSDNOG00000002826 dasNov2
Dasypus novemcinctus 6826 ENSDNOT00000009942 101442327 ENSDNOG00000009945 dasNov2
Dasypus novemcinctus 6644 ENSDNOT00000018323 ENSDNOG00000018322 dasNov2
Dasypus novemcinctus 5504 ENSDNOT00000001735 ENSDNOG00000001735 dasNov2
Dasypus novemcinctus 6897 ENSDNOT00000013153 ENSDNOG00000038876 dasNov2
Dasypus novemcinctus 13523 ENSDNOT00000009192 ENSDNOG00000009199 dasNov2
Dasypus novemcinctus 15676 ENSDNOT00000004594 ENSDNOG00000043455 dasNov2
Echinops telfairi 11654 ENSETET00000011350 ENSETEG00000011351 TENREC
Echinops telfairi 11116 ENSETET00000010820 ENSETEG00000010818 TENREC
Echinops telfairi 7364 ENSETET00000007184 ENSETEG00000007185 TENREC
Echinops telfairi 10565 ENSETET00000010281 ENSETEG00000010280 TENREC
Echinops telfairi 4282 ENSETET00000004191 ENSETEG00000004192 TENREC
Equus caballus 5245 ENSECAT00000006668 ENSECAG00000006557 OR4C5 equCab2
Equus caballus 5271 ENSECAT00000007320 ENSECAG00000007333 equCab2
Equus caballus 5278 ENSECAT00000007629 100064956 ENSECAG00000007567 LOC100064956 equCab2
Erinaceus europaeus 4844 ENSEEUT00000004338 103109991 ENSEEUG00000004365 eriEur1
Erinaceus europaeus 4881 ENSEEUT00000004368 ENSEEUG00000004398 eriEur1
Erinaceus europaeus 4256 ENSEEUT00000003807 103116480 ENSEEUG00000003831 eriEur1
Erinaceus europaeus 2413 ENSEEUT00000002153 ENSEEUG00000002162 eriEur1
Erinaceus europaeus 13540 ENSEEUT00000012181 ENSEEUG00000012209 eriEur1
Felis catus 31463 ENSFCAT00000005394 ENSFCAG00000005393 felCat3
Felis catus 1160 ENSFCAT00000007996 101087869 ENSFCAG00000030074 felCat3
Felis catus 6205 ENSFCAT00000009674 101099655 ENSFCAG00000027310 LOC101099655 felCat3
Felis catus 6208 ENSFCAT00000004256 101091898 ENSFCAG00000004255 felCat3
Homo sapiens 17605 ENST00000319813 ENSG00000176540 OR4C5 hg19,GRCh37
Homo sapiens 17635 ENST00000328302, NM_001001955 283092 ENSG00000178306 OR4C13 hg19,GRCh37
Homo sapiens 17636 ENST00000335238 283093 ENSG00000221954 OR4C12 hg19,GRCh37
Homo sapiens 17643 ENST00000328188 119749 ENSG00000185926 OR4C46 hg19,GRCh37
Homo sapiens 17660 ENST00000314259 219432 ENSG00000181903 OR4C6 hg19,GRCh37
Loxodonta africana 23520 ENSLAFT00000036485 100665673 ENSLAFG00000026605 loxAfr3
Loxodonta africana 23521 ENSLAFT00000037196 100665956 ENSLAFG00000027614 loxAfr3
Loxodonta africana 15374 ENSLAFT00000035680 ENSLAFG00000025962 loxAfr3
Loxodonta africana 10841 ENSLAFT00000034083 ENSLAFG00000031368 loxAfr3
Loxodonta africana 10361 ENSLAFT00000004577 ENSLAFG00000004576 OR4C5 loxAfr3
Loxodonta africana 10342 ENSLAFT00000027926 100670718 ENSLAFG00000027583 loxAfr3
Loxodonta africana 10347 ENSLAFT00000030733 ENSLAFG00000031747 loxAfr3
Loxodonta africana 10356 ENSLAFT00000033076 100677559 ENSLAFG00000027987 loxAfr3
Loxodonta africana 10357 ENSLAFT00000003302 100668455 ENSLAFG00000030708 loxAfr3
Loxodonta africana 10358 ENSLAFT00000033389 100653564 ENSLAFG00000031778 loxAfr3
Loxodonta africana 10359 ENSLAFT00000034709 100654420 ENSLAFG00000030712 loxAfr3
Loxodonta africana 10360 ENSLAFT00000035111 100668731 ENSLAFG00000028538 OR4C12 loxAfr3
Loxodonta africana 7429 ENSLAFT00000033273 100664423 ENSLAFG00000026570 loxAfr3
Loxodonta africana 8250 ENSLAFT00000031526 100672775 ENSLAFG00000030945 loxAfr3
Loxodonta africana 8254 ENSLAFT00000033209 ENSLAFG00000027268 loxAfr3
Loxodonta africana 7347 ENSLAFT00000027694 ENSLAFG00000025593 loxAfr3
Macropus eugenii 10461 ENSMEUT00000010459 ENSMEUG00000010433 OR4C5 Meug_1.0
Macropus eugenii 12245 ENSMEUT00000012233 ENSMEUG00000012212 Meug_1.0
Microcebus murinus 9568 ENSMICT00000008902 ENSMICG00000008909 micMur1
Microcebus murinus 10664 ENSMICT00000009931 ENSMICG00000009938 micMur1
Microcebus murinus 5059 ENSMICT00000004713 ENSMICG00000004719 micMur1
Microcebus murinus 2797 ENSMICT00000002604 ENSMICG00000002607 micMur1
Microcebus murinus 3048 ENSMICT00000002837 ENSMICG00000002841 micMur1
Monodelphis domestica 24684 ENSMODT00000025329 100018829 ENSMODG00000019947 LOC100018829 monDom5
Monodelphis domestica 24687 ENSMODT00000025331 100018896 ENSMODG00000019949 LOC100018896 monDom5
Monodelphis domestica 24688 ENSMODT00000025333 100018962 ENSMODG00000019951 monDom5
Monodelphis domestica 24689 ENSMODT00000025335 100019025 ENSMODG00000019953 monDom5
Monodelphis domestica 24691 ENSMODT00000025340 100617345 ENSMODG00000019958 LOC100617345 monDom5
Mus musculus 22846 ENSMUST00000090700, NM_146772 258768 ENSMUSG00000068808 Olfr1189 mm9
Mus musculus 22888 ENSMUST00000099787, NM_146789 258785 ENSMUSG00000075094 Olfr1230 mm9
Mus musculus 22917 ENSMUST00000057369 258979 ENSMUSG00000045148 Olfr1255 mm9
Mus musculus 22921 ENSMUST00000099762, NM_010990 18347 ENSMUSG00000075072 Olfr48 mm9
Mus musculus 22922 ENSMUST00000111519 258984 ENSMUSG00000049057 mm9
Mus musculus 22924 ENSMUST00000102609 258980 ENSMUSG00000049149 mm9
Mus musculus 22928 ENSMUST00000090695, NM_146341 258338 ENSMUSG00000068806 Olfr1259 mm9
Mus musculus 22929 ENSMUST00000111512 258983 ENSMUSG00000042894 mm9
Ochotona princeps 11681 ENSOPRT00000002840 ENSOPRG00000002858 OR4C12 OchPri2.0
Ochotona princeps 15463 ENSOPRT00000016194 101519192 ENSOPRG00000016206 OR4C6 OchPri2.0
Ornithorhynchus anatinus 16857 ENSOANT00000012606 100682085 ENSOANG00000007916 OR4C12 ornAna1
Ornithorhynchus anatinus 16862 ENSOANT00000012614 ENSOANG00000007920 ornAna1
Ornithorhynchus anatinus 16863 ENSOANT00000030892 100083090 ENSOANG00000021292 ornAna1
Ornithorhynchus anatinus 16865 ENSOANT00000012615 100083109 ENSOANG00000007921 ornAna1
Oryctolagus cuniculus 1850 ENSOCUT00000022033 100349811 ENSOCUG00000026924 LOC100349811 oryCun2.0
Oryctolagus cuniculus 1852 ENSOCUT00000029995 100350547 ENSOCUG00000024711 LOC100350547 oryCun2.0
Oryctolagus cuniculus 1853 ENSOCUT00000002044 100357889 ENSOCUG00000026679 LOC100357889 oryCun2.0
Oryctolagus cuniculus 1854 ENSOCUT00000008122 100350801 ENSOCUG00000008122 LOC100350801 oryCun2.0
Oryctolagus cuniculus 1855 ENSOCUT00000005266 100358146 ENSOCUG00000005268 LOC100358146 oryCun2.0
Oryctolagus cuniculus 1856 ENSOCUT00000025195 100358408 ENSOCUG00000025203 oryCun2.0
Otolemur garnettii 1429 ENSOGAT00000001377 100945401 ENSOGAG00000001376 LOC100945401 otoGar1
Otolemur garnettii 13491 ENSOGAT00000012969 100945082 ENSOGAG00000012967 OR4C5 otoGar1
Otolemur garnettii 13504 ENSOGAT00000012979 ENSOGAG00000012979 OR4C6 otoGar1
Pan troglodytes 6828 ENSPTRT00000006741 ENSPTRG00000003583 OR4C5 panTro2
Pan troglodytes 6844 ENSPTRT00000006779 466885 ENSPTRG00000003595 LOC466885 panTro2
Pan troglodytes 8167 ENSPTRT00000006789 466887 ENSPTRG00000003605 LOC466887 panTro2
Procavia capensis 7897 ENSPCAT00000007875 ENSPCAG00000018839 proCap1
Procavia capensis 8766 ENSPCAT00000018902 ENSPCAG00000018890 OR4C12 proCap1
Procavia capensis 11271 ENSPCAT00000018856 ENSPCAG00000018765 proCap1
Procavia capensis 16277 ENSPCAT00000015323 ENSPCAG00000015383 proCap1
Rattus norvegicus 22366 ENSRNOT00000049678 404835 ENSRNOG00000030898 Olr646 rn4
Rattus norvegicus 22372 ENSRNOT00000041197 404830 ENSRNOG00000029832 Olr653 rn4
Rattus norvegicus 22374 ENSRNOT00000047251 295862 ENSRNOG00000033721 Olr655 rn4
Rattus norvegicus 22406 ENSRNOT00000008384 404821 ENSRNOG00000006408 Olr693 rn4
Rattus norvegicus 22431 ENSRNOT00000008690 295914 ENSRNOG00000006654 Olr721 rn4
Rattus norvegicus 22432 ENSRNOT00000008715 366114 ENSRNOG00000006669 Olr722 rn4
Rattus norvegicus 22434 ENSRNOT00000008750 366115 ENSRNOG00000006706 Olr724 rn4
Rattus norvegicus 22435 ENSRNOT00000008762 311180 ENSRNOG00000006716 Olr725 rn4
Rhesus macaque 12555 ENSMMUT00000044176 709987 ENSMMUG00000000371 rheMac2
Sorex araneus 6771 ENSSART00000006622 ENSSARG00000006640 OR4C5 sorAra1
Spermophilus tridecemlineatus 2389 ENSSTOT00000002389 speTri1
Spermophilus tridecemlineatus 10360 ENSSTOT00000010361 speTri1
Spermophilus tridecemlineatus 12911 ENSSTOT00000012912 speTri1
Sus scrofa 11395 ENSSSCT00000015863 susScr2
Sus scrofa 11396 ENSSSCT00000015864 100520069 ENSSSCG00000020684 LOC100520069 susScr2
Sus scrofa 11399 ENSSSCT00000015867 susScr2
Sus scrofa 11400 ENSSSCT00000015868 susScr2
Sus scrofa 11406 ENSSSCT00000015874 susScr2
Sus scrofa 11409 ENSSSCT00000015877 susScr2
Sus scrofa 11413 ENSSSCT00000015881 100517579 ENSSSCG00000021435 LOC100517579 susScr2
Sus scrofa 11414 ENSSSCT00000015882 100517754 ENSSSCG00000014532 LOC100517754 susScr2
Sus scrofa 11415 ENSSSCT00000015883 susScr2
Sus scrofa 11416 ENSSSCT00000015884 100517215 ENSSSCG00000022752 susScr2
Sus scrofa 11423 ENSSSCT00000015891 100526160 ENSSSCG00000024147 LOC100526160 susScr2
Sus scrofa 9826 ENSSSCT00000014424 susScr2
Sus scrofa 9827 ENSSSCT00000014425 susScr2
Tupaia belangeri 13856 ENSTBET00000013857 ENSTBEG00000013875 OR4C6 tupBel1
Vicugna pacos 1925 ENSVPAT00000001382 ENSVPAG00000001382 OR4C5 vicPac1
Vicugna pacos 1942 ENSVPAT00000001383 ENSVPAG00000001383 vicPac1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Bos taurus 1601 ENSBTAP00000047724 ENSBTAG00000038166 IPI00707771.3 bosTau4
Bos taurus 1907 ENSBTAP00000047873 786467 ENSBTAG00000013156 LOC786467 bosTau4
Bos taurus 2072 ENSBTAP00000049900 509515 ENSBTAG00000016405 IPI00904316.1 bosTau4
Bos taurus 3111 ENSBTAP00000052574 781264 ENSBTAG00000040008 LOC781264 bosTau4
Bos taurus 18699 ENSBTAP00000051603 ENSBTAG00000031032 IPI00908087.1 bosTau4
Bos taurus 18706 ENSBTAP00000049670 515666 ENSBTAG00000016090 IPI00690154.3 bosTau4
Bos taurus 18708 ENSBTAP00000051133 ENSBTAG00000030909 IPI00691264.4 bosTau4
Bos taurus 18713 ENSBTAP00000048629 ENSBTAG00000039821 IPI00904081.1 bosTau4
Callithrix jacchus 32658 ENSCJAP00000016876 100397800 ENSCJAG00000009222 OR4C5 calJac3
Callithrix jacchus 32659 ENSCJAP00000046977 100398156 ENSCJAG00000009219 OR4C46 calJac3
Callithrix jacchus 32668 ENSCJAP00000016860 100398500 ENSCJAG00000009216 OR4C13 calJac3
Canis familiaris 25272 ENSCAFP00000035787 canFam2
Canis familiaris 3371 ENSCAFP00000034845 483603 ENSCAFG00000025185 canFam2
Canis familiaris 1255 ENSCAFP00000035424 ENSCAFG00000025448 canFam2
Canis familiaris 4423 ENSCAFP00000034614 491531 ENSCAFG00000025068 canFam2
Canis familiaris 1093 ENSCAFP00000021951 483573 ENSCAFG00000014894 canFam2
Canis familiaris 327 ENSCAFP00000035704 483566 ENSCAFG00000025561 canFam2
Canis familiaris 361 ENSCAFP00000012099 483596 ENSCAFG00000008239 canFam2
Canis familiaris 851 ENSCAFP00000012102 ENSCAFG00000032047 canFam2
Canis familiaris 904 ENSCAFP00000035531 ENSCAFG00000008241 OR4C5 canFam2
Canis familiaris 8914 ENSCAFP00000012074 491531 ENSCAFG00000008217 LOC491531 canFam2
Canis familiaris 8954 ENSCAFP00000033601 483595 ENSCAFG00000024604 OR08D06 canFam2
Canis familiaris 8998 ENSCAFP00000033591 611068 ENSCAFG00000024597 canFam2
Canis familiaris 10031 ENSCAFP00000035347 canFam2
Cavia porcellus 5546 ENSCPOP00000010582 100714341 ENSCPOG00000011766 OR4C12 cavPor3
Cavia porcellus 17088 ENSCPOP00000014547 100731914 ENSCPOG00000010168 cavPor3
Cavia porcellus 18544 ENSCPOP00000014147 100726090 ENSCPOG00000015689 OR4C5 cavPor3
Choloepus hoffmanni 5461 ENSCHOP00000005455 ENSCHOG00000006173 choHof1
Choloepus hoffmanni 5486 ENSCHOP00000005476 ENSCHOG00000006202 OR4C5 choHof1
Choloepus hoffmanni 222 ENSCHOP00000000223 ENSCHOG00000000257 choHof1
Choloepus hoffmanni 389 ENSCHOP00000000389 ENSCHOG00000000438 choHof1
Choloepus hoffmanni 9704 ENSCHOP00000009698 ENSCHOG00000010959 choHof1
Dasypus novemcinctus 11961 ENSDNOP00000017471 ENSDNOG00000009199 dasNov2
Dasypus novemcinctus 6033 ENSDNOP00000007702 101442327 ENSDNOG00000009945 dasNov2
Dasypus novemcinctus 6096 ENSDNOP00000010199 ENSDNOG00000038876 dasNov2
Dasypus novemcinctus 5871 ENSDNOP00000014221 ENSDNOG00000018322 dasNov2
Dasypus novemcinctus 4872 ENSDNOP00000001340 ENSDNOG00000001735 dasNov2
Dasypus novemcinctus 2903 ENSDNOP00000016506 ENSDNOG00000002826 dasNov2
Dasypus novemcinctus 13854 ENSDNOP00000003547 ENSDNOG00000043455 dasNov2
Echinops telfairi 3435 ENSETEP00000003439 ENSETEG00000004192 TENREC
Echinops telfairi 8335 ENSETEP00000008348 ENSETEG00000010280 TENREC
Echinops telfairi 8774 ENSETEP00000008789 ENSETEG00000010818 TENREC
Echinops telfairi 9190 ENSETEP00000009203 ENSETEG00000011351 TENREC
Echinops telfairi 5825 ENSETEP00000005832 ENSETEG00000007185 TENREC
Equus caballus 4812 ENSECAP00000004758 ENSECAG00000006557 OR4C5 equCab2
Equus caballus 5487 ENSECAP00000005322 ENSECAG00000007333 equCab2
Equus caballus 5700 ENSECAP00000005603 100064956 ENSECAG00000007567 LOC100064956 equCab2
Erinaceus europaeus 3494 ENSEEUP00000003471 103116480 ENSEEUG00000003831 eriEur1
Erinaceus europaeus 3972 ENSEEUP00000003946 103109991 ENSEEUG00000004365 eriEur1
Erinaceus europaeus 4004 ENSEEUP00000003973 ENSEEUG00000004398 eriEur1
Erinaceus europaeus 1970 ENSEEUP00000001961 ENSEEUG00000002162 eriEur1
Erinaceus europaeus 11142 ENSEEUP00000011111 ENSEEUG00000012209 eriEur1
Felis catus 7936 ENSFCAP00000008969 101099655 ENSFCAG00000027310 LOC101099655 felCat3
Felis catus 7080 ENSFCAP00000007406 101087869 ENSFCAG00000030074 LOC101087869 felCat3
Felis catus 4858 ENSFCAP00000004998 ENSFCAG00000005393 felCat3
Felis catus 4991 ENSFCAP00000003922 101091898 ENSFCAG00000004255 felCat3
Homo sapiens 10675 ENSP00000334418 283093 ENSG00000221954 OR4C12 hg19,GRCh37
Homo sapiens 10681 ENSP00000329056 119749 ENSG00000185926 OR4C46 hg19,GRCh37
Homo sapiens 10775 ENSP00000324769 219432 ENSG00000181903 OR4C6 hg19,GRCh37
Homo sapiens 37106 ENSP00000321338 ENSG00000176540 OR4C5 hg19,GRCh37
Homo sapiens 39125 ENSP00000367700 hg19,GRCh37
Loxodonta africana 25373 ENSLAFP00000018220 100665673 ENSLAFG00000026605 loxAfr3
Loxodonta africana 25375 ENSLAFP00000025512 100665956 ENSLAFG00000027614 loxAfr3
Loxodonta africana 23767 ENSLAFP00000022114 100670718 ENSLAFG00000027583 loxAfr3
Loxodonta africana 23808 ENSLAFP00000021024 ENSLAFG00000031747 loxAfr3
Loxodonta africana 23886 ENSLAFP00000021781 100677559 ENSLAFG00000027987 loxAfr3
Loxodonta africana 23889 ENSLAFP00000022064 100668455 ENSLAFG00000030708 loxAfr3
Loxodonta africana 23895 ENSLAFP00000027173 100653564 ENSLAFG00000031778 loxAfr3
Loxodonta africana 23908 ENSLAFP00000028278 100668731 ENSLAFG00000028538 OR4C12 loxAfr3
Loxodonta africana 23917 ENSLAFP00000003820 ENSLAFG00000004576 OR4C5 loxAfr3
Loxodonta africana 24428 ENSLAFP00000027702 100672775 ENSLAFG00000030945 loxAfr3
Loxodonta africana 24432 ENSLAFP00000020542 ENSLAFG00000027268 loxAfr3
Loxodonta africana 24556 ENSLAFP00000022034 100664423 ENSLAFG00000026570 loxAfr3
Loxodonta africana 18052 ENSLAFP00000022270 ENSLAFG00000025962 loxAfr3
Loxodonta africana 18776 ENSLAFP00000023119 ENSLAFG00000025593 loxAfr3
Loxodonta africana 808 ENSLAFP00000024441 100654420 ENSLAFG00000030712 loxAfr3
Loxodonta africana 951 ENSLAFP00000027138 ENSLAFG00000031368 loxAfr3
Macropus eugenii 11133 ENSMEUP00000011119 ENSMEUG00000012212 Meug_1.0
Macropus eugenii 9520 ENSMEUP00000009515 ENSMEUG00000010433 OR4C5 Meug_1.0
Microcebus murinus 8112 ENSMICP00000008107 ENSMICG00000008909 micMur1
Microcebus murinus 9050 ENSMICP00000009045 ENSMICG00000009938 micMur1
Microcebus murinus 4300 ENSMICP00000004295 ENSMICG00000004719 micMur1
Microcebus murinus 2378 ENSMICP00000002376 ENSMICG00000002607 micMur1
Microcebus murinus 2587 ENSMICP00000002584 ENSMICG00000002841 micMur1
Monodelphis domestica 14044 ENSMODP00000024888 100018829 ENSMODG00000019947 LOC100018829 monDom5
Monodelphis domestica 14053 ENSMODP00000024889 100018896 ENSMODG00000019949 LOC100018896 monDom5
Monodelphis domestica 14059 ENSMODP00000024891 100018962 ENSMODG00000019951 monDom5
Monodelphis domestica 14062 ENSMODP00000024893 100019025 ENSMODG00000019953 monDom5
Monodelphis domestica 14073 ENSMODP00000024898 100617345 ENSMODG00000019958 LOC100617345 monDom5
Mus musculus 13070 ENSMUSP00000107144 258984 ENSMUSG00000049057 mm9
Mus musculus 25089 ENSMUSP00000097350 18347 ENSMUSG00000075072 Olfr48 mm9
Mus musculus 25090 ENSMUSP00000060602 258979 ENSMUSG00000045148 Olfr1255 mm9
Mus musculus 25916 ENSMUSP00000088201 258768 ENSMUSG00000068808 Olfr1189 mm9
Mus musculus 34387 ENSMUSP00000107137 258983 ENSMUSG00000042894 mm9
Mus musculus 36987 ENSMUSP00000088194 258338 ENSMUSG00000068806 Olfr1259 mm9
Mus musculus 36989 ENSMUSP00000097375 258785 ENSMUSG00000075094 Olfr1230 mm9
Mus musculus 11744 ENSMUSP00000099669 258980 ENSMUSG00000049149 mm9
Ochotona princeps 10193 ENSOPRP00000002613 ENSOPRG00000002858 OR4C12 OchPri2.0
Ochotona princeps 13479 ENSOPRP00000014795 101519192 ENSOPRG00000016206 OR4C6 OchPri2.0
Ornithorhynchus anatinus 12697 ENSOANP00000012604 100682085 ENSOANG00000007916 OR4C12 ornAna1
Ornithorhynchus anatinus 12701 ENSOANP00000012612 ENSOANG00000007920 ornAna1
Ornithorhynchus anatinus 12702 ENSOANP00000027092 100083090 ENSOANG00000021292 ornAna1
Ornithorhynchus anatinus 12703 ENSOANP00000012613 100083109 ENSOANG00000007921 ornAna1
Oryctolagus cuniculus 13484 ENSOCUP00000004565 100358146 ENSOCUG00000005268 LOC100358146 oryCun2.0
Oryctolagus cuniculus 13485 ENSOCUP00000007021 100350801 ENSOCUG00000008122 LOC100350801 oryCun2.0
Oryctolagus cuniculus 13486 ENSOCUP00000001765 100357889 ENSOCUG00000026679 LOC100357889 oryCun2.0
Oryctolagus cuniculus 13487 ENSOCUP00000017881 100350547 ENSOCUG00000024711 LOC100350547 oryCun2.0
Oryctolagus cuniculus 13489 ENSOCUP00000024797 100349811 ENSOCUG00000026924 LOC100349811 oryCun2.0
Oryctolagus cuniculus 23570 ENSOCUP00000017886 100358408 ENSOCUG00000025203 oryCun2.0
Otolemur garnettii 11618 ENSOGAP00000011618 100945082 ENSOGAG00000012967 OR4C5 otoGar1
Otolemur garnettii 11628 ENSOGAP00000011626 ENSOGAG00000012979 OR4C6 otoGar1
Otolemur garnettii 1223 ENSOGAP00000001224 100945401 ENSOGAG00000001376 LOC100945401 otoGar1
Pan troglodytes 209 ENSPTRP00000006264 466887 ENSPTRG00000003605 LOC466887 panTro2
Pan troglodytes 12105 ENSPTRP00000048094 ENSPTRG00000003583 OR4C5 panTro2
Pan troglodytes 33591 ENSPTRP00000006255 466885 ENSPTRG00000003595 LOC466885 panTro2
Procavia capensis 15234 ENSPCAP00000014324 ENSPCAG00000015383 proCap1
Procavia capensis 10537 ENSPCAP00000016116 ENSPCAG00000018765 proCap1
Procavia capensis 8213 ENSPCAP00000016046 ENSPCAG00000018890 OR4C12 proCap1
Procavia capensis 7410 ENSPCAP00000007371 ENSPCAG00000018839 proCap1
Rattus norvegicus 13129 ENSRNOP00000008750 366115 ENSRNOG00000006706 Olr724 rn4
Rattus norvegicus 30154 ENSRNOP00000048492 404835 ENSRNOG00000030898 Olr646 rn4
Rattus norvegicus 30159 ENSRNOP00000050158 404830 ENSRNOG00000029832 Olr653 rn4
Rattus norvegicus 30160 ENSRNOP00000050547 295862 ENSRNOG00000033721 Olr655 rn4
Rattus norvegicus 30188 ENSRNOP00000008384 404821 ENSRNOG00000006408 Olr693 rn4
Rattus norvegicus 31147 ENSRNOP00000008690 295914 ENSRNOG00000006654 Olr721 rn4
Rattus norvegicus 31148 ENSRNOP00000008715 366114 ENSRNOG00000006669 Olr722 rn4
Rattus norvegicus 31149 ENSRNOP00000008762 311180 ENSRNOG00000006716 Olr725 rn4
Rhesus macaque 14921 ENSMMUP00000037182 709987 ENSMMUG00000000371 rheMac2
Sorex araneus 6023 ENSSARP00000006009 ENSSARG00000006640 OR4C5 sorAra1
Spermophilus tridecemlineatus 9303 ENSSTOP00000009298 speTri1
Spermophilus tridecemlineatus 11578 ENSSTOP00000011573 speTri1
Spermophilus tridecemlineatus 2147 ENSSTOP00000002136 speTri1
Sus scrofa 13978 ENSSSCP00000014032 susScr2
Sus scrofa 13979 ENSSSCP00000014033 susScr2
Sus scrofa 15392 ENSSSCP00000015446 susScr2
Sus scrofa 15393 ENSSSCP00000015447 100520069 ENSSSCG00000020684 LOC100520069 susScr2
Sus scrofa 15396 ENSSSCP00000015450 susScr2
Sus scrofa 15397 ENSSSCP00000015451 susScr2
Sus scrofa 15403 ENSSSCP00000015457 susScr2
Sus scrofa 15406 ENSSSCP00000015460 susScr2
Sus scrofa 15410 ENSSSCP00000015464 100517579 ENSSSCG00000021435 LOC100517579 susScr2
Sus scrofa 15411 ENSSSCP00000015465 100517754 ENSSSCG00000014532 LOC100517754 susScr2
Sus scrofa 15412 ENSSSCP00000015466 susScr2
Sus scrofa 15413 ENSSSCP00000015467 100517215 ENSSSCG00000022752 susScr2
Sus scrofa 15419 ENSSSCP00000015473 100526160 ENSSSCG00000024147 LOC100526160 susScr2
Tupaia belangeri 12023 ENSTBEP00000012004 ENSTBEG00000013875 OR4C6 tupBel1
Vicugna pacos 1793 ENSVPAP00000001276 ENSVPAG00000001382 OR4C5 vicPac1
Vicugna pacos 1809 ENSVPAP00000001277 ENSVPAG00000001383 vicPac1

multiple sequence alignment in CLUSTALW format


Procavia_capensis|16277             ------------------------------------------------------------
Erinaceus_europaeus|13540           ------------------------------------------------------------
Bos_taurus|28568                    ------------------------------------------------------------
Dasypus_novemcinctus|13523          ------------------------------------------------------------
Mus_musculus|22888                  ------------------------------------------------------------
Rattus_norvegicus|22406             ------------------------------------------------------------
Mus_musculus|22846                  ------------------------------------------------------------
Rattus_norvegicus|22366             ------------------------------------------------------------
Ochotona_princeps|15463             ------------------------------------------------------------
Homo_sapiens|17660                  ------------------------------------------------------------
Pan_troglodytes|8167                ------------------------------------------------------------
Otolemur_garnettii|13504            ------------------------------------------------------------
Microcebus_murinus|2797             ------------------------------------------------------------
Microcebus_murinus|5059             ------------------------------------------------------------
Microcebus_murinus|10664            ------------------------------------------------------------
Tupaia_belangeri|13856              ------------------------------------------------------------
Choloepus_hoffmanni|6189            ------------------------------------------------------------
Choloepus_hoffmanni|10987           ------------------------------------------------------------
Felis_catus|6208                    ------------------------------------------------------------
Canis_familiaris|28898              ------------------------------------------------------------
Canis_familiaris|28666              ------------------------------------------------------------
Canis_familiaris|8394               ------------------------------------------------------------
Canis_familiaris|8407               ------------------------------------------------------------
Loxodonta_africana|10342            ------------------------------------------------------------
Loxodonta_africana|7429             ------------------------------------------------------------
Loxodonta_africana|8250             ------------------------------------------------------------
Loxodonta_africana|10841            ------------------------------------------------------------
Loxodonta_africana|7347             ------------------------------------------------------------
Loxodonta_africana|15374            ------------------------------------------------------------
Loxodonta_africana|8254             ------------------------------------------------------------
Loxodonta_africana|10347            ------------------------------------------------------------
Dasypus_novemcinctus|5504           ------------------------------------------------------------
Dasypus_novemcinctus|6826           ------------------------------------------------------------
Equus_caballus|5245                 ------------------------------------------------------------
Echinops_telfairi|11116             ------GTGTACAAGGAAGATCAACCTAGTCTTGGGTTCCTACATTCGGGCTTTCCAGTC
Echinops_telfairi|11654             ------------------------------------------------------------
Echinops_telfairi|10565             ---------------ACCAAAACTATATTCCAAGGACTTAGCTTGAGTTTTCCATCAGTC
Vicugna_pacos|1925                  ------------------------------------------------------------
Dasypus_novemcinctus|6644           ------------------------------------------------------------
Spermophilus_tridecemlineatus|10360 ------------ACTAATAGTATTGCTTGGCTTAGTCTTGAGTTTTTTGTGCTTTTTTCA
Cavia_porcellus|23431               ------------------------------------------------------------
Callithrix_jacchus|41201            ------------------------------------------------------------
Mus_musculus|22929                  ------------------------------------------------------------
Rattus_norvegicus|22435             ------------------------------------------------------------
Equus_caballus|5271                 ------------------------------------------------------------
Sorex_araneus|6771                  ACTAATAATATAGCCCTACTTAGTCTTGAGTTTATCTGCTCAGGGTTTTCATTAGTCTTC
Sus_scrofa|9827                     ------------------------------------------------------------
Loxodonta_africana|10361            ------------------------------------------------------------
Homo_sapiens|17605                  ------------------------------------------------------------
Pan_troglodytes|6828                ------------------------------------------------------------
Canis_familiaris|8422               ------------------------------------------------------------
Oryctolagus_cuniculus|1850          ------------------------------------------------------------
Otolemur_garnettii|13491            ------ACTAATAATATGACCCCAGTTAGTTTGGGGTTTATCTGCTTGCGAATTCCATCA
Microcebus_murinus|9568             ------------------------------------------------------------
Dasypus_novemcinctus|3289           ------------------------------------------------------------
Dasypus_novemcinctus|6897           ------------------------------------------------------------
Dasypus_novemcinctus|15676          ------------------------------------------------------------
Choloepus_hoffmanni|6218            ------------------------------------------------------------
Spermophilus_tridecemlineatus|12911 ------------------------------------------------------------
Bos_taurus|29294                    ------------------------------------------------------------
Bos_taurus|27626                    ------------------------------------------------------------
Sus_scrofa|11423                    ------------------------------------------------------------
Cavia_porcellus|21650               ------------------------------------------------------------
Rattus_norvegicus|22372             ------------------------------------------------------------
Rattus_norvegicus|22374             ------------------------------------------------------------
Bos_taurus|29733                    ------------------------------------------------------------
Sus_scrofa|11396                    ------------------------------------------------------------
Sus_scrofa|11395                    ------------------------------------------------------------
Sus_scrofa|11400                    ------------------------------------------------------------
Sus_scrofa|11399                    ------------------------------------------------------------
Choloepus_hoffmanni|258             ------------------------------------------------------------
Monodelphis_domestica|24688         ------------------------------------------------------------
Monodelphis_domestica|24689         ------------------------------------------------------------
Monodelphis_domestica|24691         ------------------------------------------------------------
Callithrix_jacchus|41212            ------------------------------------------------------------
Homo_sapiens|17635                  ------------------------------------------------------------
Equus_caballus|5278                 ------------------------------------------------------------
Canis_familiaris|8369               ------------------------------------------------------------
Canis_familiaris|8352               ------------------------------------------------------------
Canis_familiaris|8363               ------------------------------------------------------------
Bos_taurus|6622                     ------------------------------------------------------------
Mus_musculus|22922                  ------------------------------------------------------------
Rattus_norvegicus|22432             ------------------------------------------------------------
Bos_taurus|6627                     ------------------------------------------------------------
Sus_scrofa|11415                    ------------------------------------------------------------
Sus_scrofa|11413                    ------------------------------------------------------------
Sus_scrofa|9826                     ------------------------------------------------------------
Sus_scrofa|11406                    ------------------------------------------------------------
Sus_scrofa|11409                    ------------------------------------------------------------
Erinaceus_europaeus|4256            ------------------------------------------------------------
Procavia_capensis|7897              ------------------------------------------------------------
Loxodonta_africana|10358            ------------------------------------------------------------
Echinops_telfairi|7364              ------------------------------------------------------------
Loxodonta_africana|10359            ------------------------------------------------------------
Procavia_capensis|11271             ------------------------------------------------------------
Mus_musculus|22924                  ------------------------------------------------------------
Oryctolagus_cuniculus|1855          ------------------------------------------------------------
Homo_sapiens|17643                  ------------------------------------------------------------
Oryctolagus_cuniculus|1854          ------------------------------------------------------------
Callithrix_jacchus|41203            ------------------------------------------------------------
Spermophilus_tridecemlineatus|2389  ------------------------------------------------------------
Felis_catus|31463                   ------------------------------------------------------------
Canis_familiaris|8420               ------------------------------------------------------------
Canis_familiaris|8433               ------------------------------------------------------------
Macropus_eugenii|12245              ------------------------------------------------------------
Ornithorhynchus_anatinus|16857      ------------------------------------------------------------
Echinops_telfairi|4282              ------------------------------------------------------------
Rhesus_macaque|12555                ------------------------------------------------------------
Loxodonta_africana|10357            ------------------------------------------------------------
Loxodonta_africana|23520            ------------------------------------------------------------
Loxodonta_africana|23521            ------------------------------------------------------------
Loxodonta_africana|10356            ------------------------------------------------------------
Choloepus_hoffmanni|440             ------------------------------------------------------------
Oryctolagus_cuniculus|1856          ------------------------------------------------------------
Mus_musculus|22921                  ------------------------------------------------------------
Rattus_norvegicus|22431             ------------------------------------------------------------
Erinaceus_europaeus|4844            ------------------------------------------------------------
Erinaceus_europaeus|2413            ------------------------------------------------------------
Sus_scrofa|11416                    ------------------------------------------------------------
Felis_catus|1160                    ------------------------------------------------------------
Canis_familiaris|8432               ------------------------------------------------------------
Canis_familiaris|8419               ------------------------------------------------------------
Monodelphis_domestica|24687         ------------------------------------------------------------
Macropus_eugenii|10461              ------------------------------------------------------------
Monodelphis_domestica|24684         ------------------------------------------------------------
Cavia_porcellus|7144                ------------------------------------------------------------
Homo_sapiens|17636                  ------------------------------------------------------------
Pan_troglodytes|6844                ------------------------------------------------------------
Sus_scrofa|11414                    ------------------------------------------------------------
Erinaceus_europaeus|4881            ------------------------------------------------------------
Otolemur_garnettii|1429             ------------------------------------------------------------
Microcebus_murinus|3048             ------------------------------------------------------------
Bos_taurus|6619                     ------------------------------------------------------------
Bos_taurus|6624                     ------------------------------------------------------------
Procavia_capensis|8766              ------------------------------------------------------------
Loxodonta_africana|10360            ------------------------------------------------------------
Vicugna_pacos|1942                  ------------------------------------------------------------
Canis_familiaris|8421               ------------------------------------------------------------
Felis_catus|6205                    ------------------------------------------------------------
Ochotona_princeps|11681             ------------------------------------------------------------
Rattus_norvegicus|22434             ------------------------------------------------------------
Mus_musculus|22917                  ------------------------------------------------------------
Mus_musculus|22928                  ------------------------------------------------------------
Oryctolagus_cuniculus|1853          ------------------------------------------------------------
Oryctolagus_cuniculus|1852          ------------------------------------------------------------
Ornithorhynchus_anatinus|16863      ------------------------------------------------------------
Ornithorhynchus_anatinus|16862      ------------------------------------------------------------
Ornithorhynchus_anatinus|16865      ------------------------------------------------------------
                                                                                                

Procavia_capensis|16277             ------------------------------------------------------------
Erinaceus_europaeus|13540           ------------------------------------------------------------
Bos_taurus|28568                    ------------------------------------------------------------
Dasypus_novemcinctus|13523          ------------------------------------------------------------
Mus_musculus|22888                  ------------------------------------------------------------
Rattus_norvegicus|22406             ------------------------------------------------------------
Mus_musculus|22846                  ------------------------------------------------------------
Rattus_norvegicus|22366             ------------------------------------------------------------
Ochotona_princeps|15463             ------------------------------------------------------------
Homo_sapiens|17660                  ------------------------------------------------------------
Pan_troglodytes|8167                ------------------------------------------------------------
Otolemur_garnettii|13504            ------------------------------------------------------------
Microcebus_murinus|2797             ------------------------------------------------------------
Microcebus_murinus|5059             ------------------------------------------------------------
Microcebus_murinus|10664            ------------------------------------------------------------
Tupaia_belangeri|13856              ------------------------------------------------------------
Choloepus_hoffmanni|6189            ------------------------------------------------------------
Choloepus_hoffmanni|10987           ------------------------------------------------------------
Felis_catus|6208                    ------------------------------------------------------------
Canis_familiaris|28898              ------------------------------------------------------------
Canis_familiaris|28666              ------------------------------------------------------------
Canis_familiaris|8394               ------------------------------------------------------------
Canis_familiaris|8407               ------------------------------------------------------------
Loxodonta_africana|10342            ------------------------------------------------------------
Loxodonta_africana|7429             ------------------------------------------------------------
Loxodonta_africana|8250             ------------------------------------------------------------
Loxodonta_africana|10841            ------------------------------------------------------------
Loxodonta_africana|7347             ------------------------------------------------------------
Loxodonta_africana|15374            ------------------------------------------------------------
Loxodonta_africana|8254             ------------------------------------------------------------
Loxodonta_africana|10347            ------------------------------------------------------------
Dasypus_novemcinctus|5504           ------------------------------------ATTGATCTACCAAATCACAATCCA
Dasypus_novemcinctus|6826           ------------------------------------------------------------
Equus_caballus|5245                 ------------------------------------------------------------
Echinops_telfairi|11116             TTACAGGAAATAACTCTGACTAAAATTATTCTGTTAATTAGCATATATCTGTCACATCAC
Echinops_telfairi|11654             ------------------------------------------------------------
Echinops_telfairi|10565             TTACAGAAACAGACAACTCTGACTGAAAGTATTCCGTTAATTAGTATATACCTGTCACAT
Vicugna_pacos|1925                  ---------------------------------------ATTTATCCTCCAAGTTGTAAT
Dasypus_novemcinctus|6644           ------------------------------------------ACTGATCTAATGCCATGC
Spermophilus_tridecemlineatus|10360 GTGTTACAAAAAATTCTATTCCAAGTTATTTCATTCTTCAAACCTCCAAATTTAAATATT
Cavia_porcellus|23431               ------------------------------------------------------------
Callithrix_jacchus|41201            ---------------------------------------TATTATAGGAAAAAATGCCTG
Mus_musculus|22929                  ------------------------------------------------------------
Rattus_norvegicus|22435             ------------------------------------------------------------
Equus_caballus|5271                 ------------------------------------------------------------
Sorex_araneus|6771                  CAGAAAATCATCCTGACACAAATTGTTCGTTTGATCAAAATTCGCCTTCTACACTGTAAT
Sus_scrofa|9827                     ------------------------------------------------------------
Loxodonta_africana|10361            ------------------------------------------------------------
Homo_sapiens|17605                  ------------------------------------ATGTATGTGTCAAATTGCAATCCT
Pan_troglodytes|6828                ------------------------------------ATGTATGTGTCAAATTGCAATCCT
Canis_familiaris|8422               ------------------------------------------------------------
Oryctolagus_cuniculus|1850          ------------------------------------------------------------
Otolemur_garnettii|13491            GTGGTACAGAAAATAATCCTGACTGAAGTTATTTTCTTGTTCATGATGTATGTGCCAAAT
Microcebus_murinus|9568             ------------------------------------------------------------
Dasypus_novemcinctus|3289           ------------------------------------------------------------
Dasypus_novemcinctus|6897           ------------------------------------------------------------
Dasypus_novemcinctus|15676          ------------------------------------------------------------
Choloepus_hoffmanni|6218            ---------------------------------------ATCTACCTACCACCTTGCAAT
Spermophilus_tridecemlineatus|12911 ------------------------------------------------------------
Bos_taurus|29294                    ------------------------------------------------------------
Bos_taurus|27626                    ------------------------------------------------------------
Sus_scrofa|11423                    ------------------------------------------------------------
Cavia_porcellus|21650               ------------------------------------------------------------
Rattus_norvegicus|22372             ------------------------------------------------------------
Rattus_norvegicus|22374             ------------------------------------------------------------
Bos_taurus|29733                    ------------------------------------------------------------
Sus_scrofa|11396                    ------------------------------------------------------------
Sus_scrofa|11395                    ------------------------------------------------------------
Sus_scrofa|11400                    ------------------------------------------------------------
Sus_scrofa|11399                    ------------------------------------------------------------
Choloepus_hoffmanni|258             ------------------------------------------------------------
Monodelphis_domestica|24688         ------------------------------------------------------------
Monodelphis_domestica|24689         ------------------------------------------------------------
Monodelphis_domestica|24691         ------------------------------------------------------------
Callithrix_jacchus|41212            ------------------------------------------------------------
Homo_sapiens|17635                  ------------------------------------------------------------
Equus_caballus|5278                 ------------------------------------------------------------
Canis_familiaris|8369               ------------------------------------------------------------
Canis_familiaris|8352               ------------------------------------------------------------
Canis_familiaris|8363               ------------------------------------------------------------
Bos_taurus|6622                     ------------------------------------------------------------
Mus_musculus|22922                  ------------------------------------------------------------
Rattus_norvegicus|22432             ------------------------------------------------------------
Bos_taurus|6627                     ------------------------------------------------------------
Sus_scrofa|11415                    ------------------------------------------------------------
Sus_scrofa|11413                    ------------------------------------------------------------
Sus_scrofa|9826                     ------------------------------------------------------------
Sus_scrofa|11406                    ------------------------------------------------------------
Sus_scrofa|11409                    ------------------------------------------------------------
Erinaceus_europaeus|4256            ------------------------------------------------------------
Procavia_capensis|7897              ------------------------------------------------------------
Loxodonta_africana|10358            ------------------------------------------------------------
Echinops_telfairi|7364              ------------------------------------------------------------
Loxodonta_africana|10359            ------------------------------------------------------------
Procavia_capensis|11271             ------------------------------------------------------------
Mus_musculus|22924                  ------------------------------------------------------------
Oryctolagus_cuniculus|1855          ------------------------------------------------------------
Homo_sapiens|17643                  ------------------------------------------------------------
Oryctolagus_cuniculus|1854          ------------------------------------------------------------
Callithrix_jacchus|41203            ------------------------------------------------------------
Spermophilus_tridecemlineatus|2389  ------------------------------------------------------------
Felis_catus|31463                   ------------------------------------------------------------
Canis_familiaris|8420               ------------------------------------------------------------
Canis_familiaris|8433               ------------------------------------------------------------
Macropus_eugenii|12245              ------------------------------------------------------------
Ornithorhynchus_anatinus|16857      ------------------------------------------------------------
Echinops_telfairi|4282              ------------------------------------------------------------
Rhesus_macaque|12555                ------------------------------------------------------------
Loxodonta_africana|10357            ------------------------------------------------------------
Loxodonta_africana|23520            ------------------------------------------------------------
Loxodonta_africana|23521            ------------------------------------------------------------
Loxodonta_africana|10356            ------------------------------------------------------------
Choloepus_hoffmanni|440             ------------------------------------------------------------
Oryctolagus_cuniculus|1856          ------------------------------------------------------------
Mus_musculus|22921                  ------------------------------------------------------------
Rattus_norvegicus|22431             ------------------------------------------------------------
Erinaceus_europaeus|4844            ------------------------------------------------------------
Erinaceus_europaeus|2413            ------------------------------------------------------------
Sus_scrofa|11416                    ------------------------------------------------------------
Felis_catus|1160                    ------------------------------------------------------------
Canis_familiaris|8432               ------------------------------------------------------------
Canis_familiaris|8419               ------------------------------------------------------------
Monodelphis_domestica|24687         ------------------------------------------------------------
Macropus_eugenii|10461              ------------------------------------------------------------
Monodelphis_domestica|24684         ------------------------------------------------------------
Cavia_porcellus|7144                ------------------------------------------------------------
Homo_sapiens|17636                  ------------------------------------------------------------
Pan_troglodytes|6844                ------------------------------------------------------------
Sus_scrofa|11414                    ------------------------------------------------------------
Erinaceus_europaeus|4881            ------------------------------------------------------------
Otolemur_garnettii|1429             ------------------------------------------------------------
Microcebus_murinus|3048             ------------------------------------------------------------
Bos_taurus|6619                     ------------------------------------------------------------
Bos_taurus|6624                     ------------------------------------------------------------
Procavia_capensis|8766              ------------------------------------------------------------
Loxodonta_africana|10360            ------------------------------------------------------------
Vicugna_pacos|1942                  ------------------------------------------------------------
Canis_familiaris|8421               ------------------------------------------------------------
Felis_catus|6205                    ------------------------------------------------------------
Ochotona_princeps|11681             ------------------------------------------------------------
Rattus_norvegicus|22434             ------------------------------------------------------------
Mus_musculus|22917                  ------------------------------------------------------------
Mus_musculus|22928                  ------------------------------------------------------------
Oryctolagus_cuniculus|1853          ------------------------------------------------------------
Oryctolagus_cuniculus|1852          ------------------------------------------------------------
Ornithorhynchus_anatinus|16863      ------------------------------------------------------------
Ornithorhynchus_anatinus|16862      ------------------------------------------------------------
Ornithorhynchus_anatinus|16865      ------------------------------------------------------------
                                                                                                

Procavia_capensis|16277             ---------------------------------------------ATGAAGCTGAACTGC
Erinaceus_europaeus|13540           ------------------------------------------------------------
Bos_taurus|28568                    ---------------------------------------------ATGGGGAATCCCAAC
Dasypus_novemcinctus|13523          ------------------------------------------------ATGGGACAAAAC
Mus_musculus|22888                  ---------------------------------------------ATGGAGAATGCAAAC
Rattus_norvegicus|22406             ---------------------------------------------ATGGAGAATGCAAAG
Mus_musculus|22846                  ---------------------------------------------ATGATGAATAAAAAC
Rattus_norvegicus|22366             ---------------------------------------------ATGATGAATAAAAAC
Ochotona_princeps|15463             ------------------------------------------------------------
Homo_sapiens|17660                  ---------------------------------------------ATGGAAAATCAAAAC
Pan_troglodytes|8167                ---------------------------------------------ATGGAAAATCAAAAC
Otolemur_garnettii|13504            ---------------------------------------------ATGGAAAATCCAAAT
Microcebus_murinus|2797             ---------------------------------------------ATGGAAAATAAAAAC
Microcebus_murinus|5059             ---------------------------------------------ATGGAAAATAAAAAC
Microcebus_murinus|10664            ---------------------------------------------ATGGAAAATAAAAGC
Tupaia_belangeri|13856              ---------------------------------------------ATGGAAAACAAAAAC
Choloepus_hoffmanni|6189            ---------------------------------------------ATGGGAAATCAAAAC
Choloepus_hoffmanni|10987           ---------------------------------------------ATGGGAAATCAAAAC
Felis_catus|6208                    ---------------------------------------------ATGGAGAATCCAAAC
Canis_familiaris|28898              ------------------------------------------TATATGGAGAATCCAAAA
Canis_familiaris|28666              ---------------------------------------------ATGGAGAATCCAAAA
Canis_familiaris|8394               ---------------------------------------------ATGGAGAATCCAAAA
Canis_familiaris|8407               ---------------------------------------------ATGGAGAATCCAAGA
Loxodonta_africana|10342            ---------------------------------------------AATCAAAATCAAAAC
Loxodonta_africana|7429             ---------------------------------------------ATGGGAAACCAAAAC
Loxodonta_africana|8250             ---------------------------------------------ATGGGAAACCAAAAC
Loxodonta_africana|10841            ---------------------------------------------ATGCGAAACCAAAAC
Loxodonta_africana|7347             ---------------------------------------------ATGGGAAACCAAAAC
Loxodonta_africana|15374            ---------------------------------------------ATGGGAAACCAAAAC
Loxodonta_africana|8254             ---------------------------------------------ATGGGAAATCAAAAC
Loxodonta_africana|10347            ---------------------------------------------ATGGGAAACCAAAAC
Dasypus_novemcinctus|5504           TATGCCATTTGCAGATATATCAATTATCCAAATACAAAACTGGATCTGGAGCAAGTGAAA
Dasypus_novemcinctus|6826           ------------------------------------------------------------
Equus_caballus|5245                 ------------------------------------------------------ATGAAC
Echinops_telfairi|11116             AATCCTTGTATTATTTGCAGGACCAATCCAAATGCCACACTGGATGTGGCGAGAGAGAAC
Echinops_telfairi|11654             ------------------------------------------------------------
Echinops_telfairi|10565             ATTCCTTGTATCATTTGCAGGACCAATCCAAATGCCATACTGGGATGCAGGCAAGAGAAC
Vicugna_pacos|1925                  CCCGCTATTTACAGAGAAATCCGTTATCCAAATGCCGAACTGGATTCAGAGCGAATGAAC
Dasypus_novemcinctus|6644           AGTCCCTGTGCCTTTTGCAGAACCAATTATCCAAATGCAAAATTAGATTTGGAGCAAAAC
Spermophilus_tridecemlineatus|10360 TGTACTATTCACAGATCAATCAATCACACCAACACCATAGTGGATTTGGAGCAAGTGAAC
Cavia_porcellus|23431               ---------------------------------------------ATGGAACCACTGAAT
Callithrix_jacchus|41201            ACATGTCAACATCATAAAAAAATCAATTATCCAAATGCCAAACTGGATAAGCAAGTGAAC
Mus_musculus|22929                  ---------------------------------------------ATGAAGCAAATAAAC
Rattus_norvegicus|22435             ---------------------------------------------ATGAAGCAAATGAAT
Equus_caballus|5271                 ---------------------------------------------ATGGAGCTAATGAGC
Sorex_araneus|6771                  CTCTGTACTCACAGATACATCGAGTATCCAAATGCCAAGCTGGAGTTTGAGCAAATGAAC
Sus_scrofa|9827                     ---------------------------------------------ACAGAGCAAATGAAC
Loxodonta_africana|10361            ---------------------------------------------ATGGAGCGAGTGAAC
Homo_sapiens|17605                  TGTGCTATTCACAGAAAAATCAATTATCCAAATACCAAACTGGATTTCGAGCAAGTGAAC
Pan_troglodytes|6828                TGTGCTATTCACAGAAAAATCAATTATCCAAATACCAAACTGGATTTCAAGCAAGTGAAC
Canis_familiaris|8422               ---------CTTAGACAATTCTGTTTAAATGTGGTCCTCAGCAGCACAGAACAAATGAAC
Oryctolagus_cuniculus|1850          ---------------------------------------------CAGAACGAAATGAAC
Otolemur_garnettii|13491            TATAGTCCTTGTCCTATTTTCAGGATCAATAACACCTCACTGGATTTGGAGCAAGTGAAT
Microcebus_murinus|9568             ------------------------------------------------------------
Dasypus_novemcinctus|3289           ------------------------------------------------------------
Dasypus_novemcinctus|6897           ------------------------------------------------------------
Dasypus_novemcinctus|15676          ------------------------------------------------------------
Choloepus_hoffmanni|6218            CCCTGTGCTGTTTGCAGAATCAATTATCCAAAGGCAAAATTGAATTCATGGCAAGTGAAA
Spermophilus_tridecemlineatus|12911 ---------------------------------------------ATGGAGACTACAAAC
Bos_taurus|29294                    ---------------------------------------------CACATGGAGAACAGG
Bos_taurus|27626                    ---------------------------------------------ATGGAGAATAGGAGC
Sus_scrofa|11423                    ---------------------------------------------ATGGAGAATAGAAAC
Cavia_porcellus|21650               ---------------------------------------------ATGGAGAACAGGAAC
Rattus_norvegicus|22372             ---------------------------------------------ATGGAAATTAGGAAC
Rattus_norvegicus|22374             ---------------------------------------------ATGGAAACTAGCAAC
Bos_taurus|29733                    ------------------------------------------------------------
Sus_scrofa|11396                    ---------------------------------------------ATGGAGACCAGGAAC
Sus_scrofa|11395                    ---------------------------------------------ATGGAGACTAAGAAC
Sus_scrofa|11400                    ---------------------------------------------AGAGAGACTAGGAAT
Sus_scrofa|11399                    ---------------------------------------------ATGGAGACTAGGAAT
Choloepus_hoffmanni|258             ------------------------------------------------------------
Monodelphis_domestica|24688         ---------------------------------------------ATGGATAATGGAAAA
Monodelphis_domestica|24689         ---------------------------------------------ATGGATAATAGAAAC
Monodelphis_domestica|24691         ---------------------------------------------ATGGATAATAGAAAC
Callithrix_jacchus|41212            ---------------------------------------------ATGCCGAATAAAAAC
Homo_sapiens|17635                  ---------------------------------------------ATGGCGAATAGAAAC
Equus_caballus|5278                 ---------------------------------------------ATGGAGAACATGAAC
Canis_familiaris|8369               ---------------------------------------------ATGGAGATTAGGAAC
Canis_familiaris|8352               ---------------------------------------------ATGGAGAATAGAAAC
Canis_familiaris|8363               ------------------------------------TATGAAATAATGGGGAATAGAAAC
Bos_taurus|6622                     ---------------------------------------ATGAAACCCATGAATAGGAAC
Mus_musculus|22922                  ---------------------------------------------ATGGAGAACCAAAAC
Rattus_norvegicus|22432             ---------------------------------------------ATGGAGAACCAAAAC
Bos_taurus|6627                     ---------------------------------------------ATGGAGAACAGGAAC
Sus_scrofa|11415                    ---------------------------------------------ATAAAGAATATGAAC
Sus_scrofa|11413                    ---------------------------------------------ATGGAGAATAGGAAC
Sus_scrofa|9826                     ---------------------------------------------ATGGAGAATAGGAAC
Sus_scrofa|11406                    ---------------------------------------------ATGGAGAATAGGAAC
Sus_scrofa|11409                    ---------------------------------------------ATGGAGAATAGGAAC
Erinaceus_europaeus|4256            ---------------------------------------------ATGGAGAATAGGAAC
Procavia_capensis|7897              ------------------------------------GTGAAATACATGGAGAATAAGAAC
Loxodonta_africana|10358            ---------------------------------------------ATGGAGAATAAGAAC
Echinops_telfairi|7364              ------------------------------------------------------------
Loxodonta_africana|10359            ------------------------------------------------ATGGAGAGTAGG
Procavia_capensis|11271             ------------------------------------AAAGAGTACATGGAGAGGAGGAAC
Mus_musculus|22924                  ---------------------------------------------ATGGAAATTAGGAGC
Oryctolagus_cuniculus|1855          ---------------------------------------------ATGGAGAACAGGAAT
Homo_sapiens|17643                  ---------------------------------------------ATGGAGAATAGGAAT
Oryctolagus_cuniculus|1854          ---------------------------------------------ATGGAGAAAAGGAAC
Callithrix_jacchus|41203            ------------------------------------ATGAAACACATGGAGAATAGGAAT
Spermophilus_tridecemlineatus|2389  ------------------------------------------------------------
Felis_catus|31463                   ------------------------------------GTGAAGCGCATGGAGAAGAGGAAC
Canis_familiaris|8420               ---------------------------------------------ATGGAGATTAGGAAC
Canis_familiaris|8433               ---------------------------------CAGGTGAAGCACATGGAGATTAGGAAC
Macropus_eugenii|12245              ------------------------------------------------------------
Ornithorhynchus_anatinus|16857      ---------------------------------------------ATGGAGAATGAAAAC
Echinops_telfairi|4282              ---------------------------------------------ATGGCAAGAATAAAT
Rhesus_macaque|12555                ---------------------------------------------ATGATGAGGATGAAT
Loxodonta_africana|10357            ------------------------------------------------------ATGAAT
Loxodonta_africana|23520            ---------------------------------------------GCGGTGAAGAAGATG
Loxodonta_africana|23521            ---------------------------------------------ATGAAGAGGATGAAT
Loxodonta_africana|10356            ------------------------------------------------------ATGAAT
Choloepus_hoffmanni|440             ---------------------------------------------ATGGAGAGGATGAAT
Oryctolagus_cuniculus|1856          ---------------------------------------------ATCATGAGGATGCAC
Mus_musculus|22921                  ------------------------------------------------------ATGAAT
Rattus_norvegicus|22431             ------------------------------------------------------ATGAAT
Erinaceus_europaeus|4844            ---------------------------------------------GTGGCAGCAATGAAT
Erinaceus_europaeus|2413            ---------------------------------------------GTGGCAGCAATGAAT
Sus_scrofa|11416                    ---------------------------------------------ATGGAGAGGACGAAT
Felis_catus|1160                    ---------------------------------------------ATGAAGAAGATGAAC
Canis_familiaris|8432               ------------------------------------------------------ATGAAT
Canis_familiaris|8419               ---------------------------------------------ATGGAGAAGATGAAT
Monodelphis_domestica|24687         ---------------------------------------------ATGAAGAGTATAAAC
Macropus_eugenii|10461              ------------------------------------------------------------
Monodelphis_domestica|24684         ---------------------------------------------ATGGATAATGGAAAC
Cavia_porcellus|7144                ------------------------------ATGCACACTGAATGCATGGAGAATAACAGG
Homo_sapiens|17636                  ---------------------------------------------ATGGAGAAGAAAAAG
Pan_troglodytes|6844                ---------------------------------------------ATGGAGAAGAAAAAG
Sus_scrofa|11414                    ---------------------------------------------ATGGAGAAAAAGAGA
Erinaceus_europaeus|4881            ---------------------------------------------ATGGAGAACAAAAGG
Otolemur_garnettii|1429             ---------------------------------------------ATGGAAAACAAAAGG
Microcebus_murinus|3048             ---------------------------------------------ATGGAGATGAAAAGG
Bos_taurus|6619                     ---------------------------------------ACAATGATGGCGAATGAAAGG
Bos_taurus|6624                     ---------------------------------------------------AATGAAAGG
Procavia_capensis|8766              ---------------------------------------------ATGGAGAATAACAGG
Loxodonta_africana|10360            ---------------------------------------------ATGGAGAATAACAGG
Vicugna_pacos|1942                  ---------------------------------------------ATGGAGGAGGAAAGG
Canis_familiaris|8421               ---------------------------------------------ATGGAAAATAAAAGA
Felis_catus|6205                    ---------------------------------------------ATGGAGAATAAAAGA
Ochotona_princeps|11681             ---------------------------------------------ATGGAGAACAAGAGG
Rattus_norvegicus|22434             ---------------------------------------------ATGGAGAATAGAAGG
Mus_musculus|22917                  ---------------------------ATGAATGACACTGAACACATGGAGAATAAAAGG
Mus_musculus|22928                  ---------------------------------------------ATGGAGAATAAAAGG
Oryctolagus_cuniculus|1853          ---------------------------------------------ATGGAGAACAAAAGG
Oryctolagus_cuniculus|1852          ---------------------------------------------ATGGAGAACAAAAGG
Ornithorhynchus_anatinus|16863      ---------------------------------------------ATGGAAAATCGAAAG
Ornithorhynchus_anatinus|16862      ---------------------------------------------ATGGAGAAAAAAAAT
Ornithorhynchus_anatinus|16865      ---------------------------------------ATGGAACAGATGGAAAATCAT
                                                                                                

Procavia_capensis|16277             AGTGTGACTGAGTTCATTCTGTCTGGGTTAACACAGGATGCTGTGAAGGAGAAAAAAGTG
Erinaceus_europaeus|13540           ------------------------------------------------------------
Bos_taurus|28568                    AATGTGAAGGAATTCATTATTTTGGGCATTATGAAGAATCCAGAGCTGCGGAAAATCCTC
Dasypus_novemcinctus|13523          AATGTGATAGAATTCATTCTTTCAGGTATTACAAAAAACCAGGAGTGGAAA------TTC
Mus_musculus|22888                  AATGTCACTGAATTCATTCTTGTGAGCATTACCAAGATTCCAGAGCTGAGAATACTATTC
Rattus_norvegicus|22406             AATGTCACTGACTTTATTCTTTTGAGCATCTCAAAGATTCCAGAGCTAAGAACAATATTC
Mus_musculus|22846                  AATGTGACAGAGTTTATTCTGTTGGGAGTTACAAGGGACCCAGAGCTGAGGAAAATATTG
Rattus_norvegicus|22366             AATGTGACAGAGTTTATTCTGTTGGGAATTACAAGTGATCCAGAGCTGAGGAAAATGCTG
Ochotona_princeps|15463             ------------------------------------------------------------
Homo_sapiens|17660                  AATGTGACTGAATTCATTCTTCTGGGTCTCACAGAGAACCTGGAGCTGTGGAAAATATTT
Pan_troglodytes|8167                AATGTGACTGAATTCATTCTTCTGGGTCTCACAGAGCACCTGGAGCTGCGGAAAATATTT
Otolemur_garnettii|13504            AACGTGACAGAATTCATTCTTCTGGGCCTTACAGAGAACCCTGAGCTGCGGAAAGTATTT
Microcebus_murinus|2797             AATGTGACAAAATTTATTCTTCTAGGCCTTATAGAGGACACAGAGTTGCGGAAAATATCT
Microcebus_murinus|5059             AATGGGACAAAATTCATTCTTCTGGGCCTTATAGAGAACACAGAGCTGCGAAAAATATTT
Microcebus_murinus|10664            AATGTGACAGATTTCATTCTTCTGGGCCTTATAGAGAACACAGAGTTGCGGAAAATATCT
Tupaia_belangeri|13856              AATGTGACAGAATTCATCCTTTTGGGTATTACAGAGAACCCAGAGCTGAGGAAAATATTT
Choloepus_hoffmanni|6189            AACGTGACAGAATTCATTCTTTTGGGCATTACAAAGAATCCAGAGCTGTGGAAAATATTA
Choloepus_hoffmanni|10987           AATGTGACAGAATTCATTCTTTTGGGCATTACAAAGAATCCAGAGCTGCGGAAAATATTC
Felis_catus|6208                    AATGCGACTGAATTCATTCTTTTGGGCATCACAGAGAACCCAGAGCTGCGGAAAACGCTC
Canis_familiaris|28898              AATGTGACTGAATTCATACATTTGGGCATTACAGAGAACCCAGAGCTGCGGAAAATGCTC
Canis_familiaris|28666              AATGTGACTGAATTCATACATTTGGGCATTACAGAGAACCCAGAGCTGCGGAAAATGCTC
Canis_familiaris|8394               AATGTGACTGAATTCATTCTTTTGGGCATTACAGAGAACCCAGAGCTGCGGAAAATGCTC
Canis_familiaris|8407               AATGTGACTGAATTCATTCTTTTGGGCATTACAGAGAACCCAGAGCTGCGGAAAATGCTC
Loxodonta_africana|10342            AAGGTAACTGAATTCATCCTTTTGGGTCTTACAAAGAACCCAGAGCTACGGAAAATATTC
Loxodonta_africana|7429             AATGTGACTGAATTCATTCTTTTGGGCCTTACAAAGAACCCACAGCTGCGGAAAATATTC
Loxodonta_africana|8250             AATGTGACTGAATTCATTCTTTTGGGCCTTACGAAGAACCCACAGCTGCGGAAAATATTC
Loxodonta_africana|10841            AATGTGACTGAATTCATTCTTTTGGGTCTTACGAAAAACCCAGAGCTGAGGAAAATATTT
Loxodonta_africana|7347             AACGTGACTGAATTCATTCTTTTGGGTCTTAGGAAAAACCCAGAGCTGCGGAAAATATTT
Loxodonta_africana|15374            AACGTGACTGAATTCATTCTTTTGGGTCTTACGAAAAACCCAGAGCTGCGGAAAATATTT
Loxodonta_africana|8254             AACGTAACTGAATTCATTCTTTTGGGTCTTACGAAAAACCCAGAGCTGAGGAAAATATTT
Loxodonta_africana|10347            AACGTGACTGAATTCATTCTTTTGGGTCTTACAAAAAACCCAGAGCTGCGGAAAATATTT
Dasypus_novemcinctus|5504           AACGTGACAGAATTCATCCTGCTTGGCCTGACGCAGAACCCAGATGTACAGAACCTCTTG
Dasypus_novemcinctus|6826           ------------------------------------------------------------
Equus_caballus|5245                 AACGTGACAGAATTCATCCTGCTTGGCCTGACACAGAGCCCAGATGTGTGGAAACTCATG
Echinops_telfairi|11116             AATGTGACAGAATTCATTCTGCTCGGCCTGACACAGGACCCAGATGTGCAGAGACTCCTC
Echinops_telfairi|11654             ------------------------------------------------------------
Echinops_telfairi|10565             AATGTGACAGAATTCATTCTGCTCGGCCTGACACAGGACCCGGATGTGCAGAAACTCCTT
Vicugna_pacos|1925                  AACGTGACGGAATTCCTCCTGCTCGGCCTGACGCAGACCCCAGATGTGCAGAAGCTCCCT
Dasypus_novemcinctus|6644           AACGTCACAGAATTCATCCTGCTCGGCCTGACACAGAACCCAAACATGCAGAAAATCTTG
Spermophilus_tridecemlineatus|10360 AATGTGACAGAATTCATCCTGCTGGGCCTGACCCAGGACCCTCATTTGCAGAAACTTCTC
Cavia_porcellus|23431               AATGTGACAGAATTCATCCTTCTCAGCCTCACACAGAACACAGAGATGCAGAAACTCTTA
Callithrix_jacchus|41201            AACTTAACGGAATTCATCTTGCTTGGCCTGACACAGAACGCAGAGGCACAGAAACTCTTG
Mus_musculus|22929                  AATGTGACAGAATTCATCCTGCTTGGGCTGACACAGAACCCAGATGTGCAGAAACTCTTG
Rattus_norvegicus|22435             AATGTAACAGAATTCATCCTGCTTGGGCTGACACAGAACCCAGATGTGCAGAAACTCTTG
Equus_caballus|5271                 AATGTGACTGAATTCATCCTGCTCGGCCTGACGCAGAACCCAGATGTGCAGAAACTCTTG
Sorex_araneus|6771                  AACGTGACCGAATTCATCCTGCTTGGTCTGACACAGAACCCACGTGTGCAAGAGCTTCTG
Sus_scrofa|9827                     AACGTGACAGAATTCCTCCTGCTTGGCCTGACCCAGAACCCAGCTGTGCAGAAATTCCTG
Loxodonta_africana|10361            AATGTGACAGAATTCATCCTGCTTGGCCTGACACAGAACCCAGATGTGCAGAAACTCTTG
Homo_sapiens|17605                  AACATAACGGAATTCATCTTGCTTGGCCTGACACAGAACGCAGAGGCACAGAAACTCTTG
Pan_troglodytes|6828                AACATAACGGAATTCATCTTGCTTGGCCTGACACAGAACGCAGAGGCACAGAAACTCTTG
Canis_familiaris|8422               AACGTGACGGAATTCATCCTGCTTGGCCTGACGCAGAACCCAGATGTGCAGAAACTCTTG
Oryctolagus_cuniculus|1850          AACGTAACAGAATTTGTCTTGCTTGGCCTGACACCAAACCCAGACATGCAGAAACTTCTG
Otolemur_garnettii|13491            AATGTGACAGAATTCATCCTGCTCGGCCTGACGCAGAACCCAGATGTGCAGAAACTCTTG
Microcebus_murinus|9568             ------------------------------------------------------------
Dasypus_novemcinctus|3289           ------------------------------------------------------------
Dasypus_novemcinctus|6897           ------------------------------------------------------------
Dasypus_novemcinctus|15676          ------------------------------------------------------------
Choloepus_hoffmanni|6218            AATGTGACGGAATTCATCCTGCTTGGCTTGACACTGAACCCGGATGTGCAGAAACTCTTG
Spermophilus_tridecemlineatus|12911 AATGTGACAGAGTTTGTTCTTCTGGGACTTACACAAAACCCAAAGATGCAGAAAATAGTA
Bos_taurus|29294                    AACATGACAGAGTTTGTTCTACTGGGGCTCACAGAGAATCCAAAGATGCAGAAAATTGTA
Bos_taurus|27626                    AACGTGACAGAGTTTGTTCTCTTGGGGCTCACACAGAATTCAAAGTTGCAGAAGATCATA
Sus_scrofa|11423                    AATGTGACTGAGTTCATTCTGCTGGGGTTAACACAGAATCCAAAGACTCAGAAAATCATA
Cavia_porcellus|21650               AATGTGACAGAGTTTGTTCTACTGGGGCTTACAGAGAACCCAAAGATGCAGAAAGTCATA
Rattus_norvegicus|22372             AACGTGACCGAGTTTGTTCTTCTGGGGCTCACACAGAATCTACACATGCAGAAAATCGTA
Rattus_norvegicus|22374             AACGTGACTGAATTTGTTCTTCTGGGACTCACACAGAATCTACACATGCAGAAAATCATA
Bos_taurus|29733                    ------------TTTATTCTACTGGGACTCACACAGAATCTGAAGGTGCAGAAAATCATA
Sus_scrofa|11396                    AACGTGACAGAGTTTATTCTACTGGGACTCACACAGAACCCACAGATGCAGAAAGTCATA
Sus_scrofa|11395                    AATGTAACGGTGTTCATTCTGCTGGGACTCACTCAGAATCCACACATGCAGAAAGTCATA
Sus_scrofa|11400                    AATGTAACGGAGTTCATTCTACTGGGCCTCACACAGAATTCACACATGCAGAAAGTCATA
Sus_scrofa|11399                    AATGTAACAGAGTTCATTCTACTGGGACTCACACAGAATCCACACATGCAGAAAGTCATA
Choloepus_hoffmanni|258             ------------------------------------------------------------
Monodelphis_domestica|24688         AATGTAACTGAATTCATTCTACTTGGACTAACTGAGAATCCAAAGATGCAGAAAATTGTT
Monodelphis_domestica|24689         AATGTGACTGAATTTATTCTACTGGGTCTTACAGATAATCCAAAGATGCAGAAAATTGTT
Monodelphis_domestica|24691         AATGTGACTGAATTTATTCTACTGGGTCTTACAGATAATCCAAAGATGCAGAAAATTGTT
Callithrix_jacchus|41212            AATGTGACAGAGTTTATTCTACTGGGGCTTACAGAGAATCCAAAGATGCAGAAAATCATA
Homo_sapiens|17635                  AATGTGACAGAGTTTATTCTATTGGGGCTTACAGAGAATCCAAAAATGCAGAAAATCATA
Equus_caballus|5278                 AATGTGACAGAATTTGTTCTACTGGGGCTCACGGAGAATCCAAAGATGCAGAAAATCATA
Canis_familiaris|8369               AACGTGACAGAATTTGTGCTACTGGGGCTCACAGAGAATCCAAAGATGCAGAAAATCATA
Canis_familiaris|8352               AATGTGACAGAGTTTGTTCTACTGGGGCTCACAGAGAATCCAAAGATGCAGAAAATCGTT
Canis_familiaris|8363               AATGTGACAGAGTTTGTTCTACTGGGGCTCACAGAGAATCCAAAGATGCAGAAAATCGTT
Bos_taurus|6622                     AACGTGACAGAGTTTTTTCTACTGGGACTCACACAGAATCCAAAGATGCAGAACATCATC
Mus_musculus|22922                  AATGTGACAGAATTTATCCTTCTGGGACTCACAGAGAACCCAAAGATGCAAAAAATTGTA
Rattus_norvegicus|22432             AATGTGACAGAATTTATCCTTCTGGGACTCACAGAGAATCCAAAGATGCAGAAAATTGTA
Bos_taurus|6627                     AATGTGACGGAGTTTGTTCTTCTGGGGCTCACACAGAATCCAAAGATGCAGAAAATTGTG
Sus_scrofa|11415                    AATGTGACAGAGTTTGTTCTCCTGGGGCTCACACAGAATCCAAAGATGCAGAAAATCATA
Sus_scrofa|11413                    AATGTGACAGAGTTTGTTCTCCTGGGGCTCACACAGAATCCAGAGATGCAGAAACTCTTA
Sus_scrofa|9826                     AATGTGACAGAGTTTGTTCTCCTGGGGCTCACACAGAATCCAGAGATGCAGAAACTCTTA
Sus_scrofa|11406                    AATGTGACAGAGTTTGTTCTCCTGGGGCTCACACAGAATCCAGAGATGCAGAAACTCATA
Sus_scrofa|11409                    AATGTGACAGAGTTTGTTCTCCTGGGGCTCACACAGAATCCAGAGATGCAGAAACTCATA
Erinaceus_europaeus|4256            AACGTGACAGAGTTTGTTTTACTGGGACTGACAGAAAATCCAAAGATGCAGATAGTTATA
Procavia_capensis|7897              AACGTGACAGAGTTTGTTCTACTGGGACTCACAGAAAATCCAAAGACACAGAAAATTCTT
Loxodonta_africana|10358            AATGTGACAGAGTTTGTTCTATTGGGGCTTACAGAAAATCCAAAGATGCAGAAAGTTGCA
Echinops_telfairi|7364              ------------------------------------------------------------
Loxodonta_africana|10359            AACGTGACAGAGTTTGTTCTACTGGGGCTCACGGAGAATCCAAAGATGCAGAAAATCATA
Procavia_capensis|11271             AATGTGACAGAGTTTGTCCTACTGGGGCTTACGGAGAACGCGAAGATGCAGAGAATCATA
Mus_musculus|22924                  AATGTGACAGAGTTTGTTCTCTTGGGGCTCACCAGAAACCCAAGCATGCAGAAAATCGTG
Oryctolagus_cuniculus|1855          AATGTGACAGAATTTGTTCTCCTGGGGCTTACAGAGAATCCAAACATGCAGAAAACGGTA
Homo_sapiens|17643                  AACATGACAGAGTTTGTTTTGCTGGGGCTTACAGAGAATCCAAAGATGCAGAAAATCATA
Oryctolagus_cuniculus|1854          AATGTGACAGAGTTTGTTCTCCTGGGACTTACAGAGAATCCAAACATGCAGAAAATCATA
Callithrix_jacchus|41203            AACGTGACAGAGTTTGTTCTACTGGGGCTTACAGAGAATCCAAAGATGCAGGAAATAATA
Spermophilus_tridecemlineatus|2389  ------------------------------------------------------------
Felis_catus|31463                   AATGTGACAGAGTTTGTTCTACTGGGACTCACAGAGAATCCAAAGATGCAAAAAATTATA
Canis_familiaris|8420               AATGTGACAGAGTTTGTTCTACTGGGGCTTACAGAGAATCCAAAGATGCAGAAAATTGTA
Canis_familiaris|8433               AATGTGACAGAGTTTGTTCTACTGGGGCTTACAGAGAATCCAAAGATGCAGAAAATTGTA
Macropus_eugenii|12245              ------------------------------------------------------------
Ornithorhynchus_anatinus|16857      AATGTGACAGAATTCATTCTTTTGGGACTTACACAGAATCCAGGGATGCAGAAAATAATA
Echinops_telfairi|4282              AATGTGACAGAATTCATCCTGTTGGGCCTGACCCAGAATATGGAGCTTCAAAATTTTTCA
Rhesus_macaque|12555                AATGTGACTGAGTTTATTCTCCTGGGCTTGACTCGAAATATGGAGCTTCAGAAATTTTCA
Loxodonta_africana|10357            AATGTGACAGAATTCAGCCTCCTGGGCCTGACAGAGAACACGGAGCTTCAAAAACTTTCA
Loxodonta_africana|23520            AATGTCACGGAATTTATCCTCCTGGGCCTGACAGAGAACACAGACCTTCAAAAATTTTCA
Loxodonta_africana|23521            AATGTGACGGAATTCATCCTCCTGGGCCTGACAGAGAACATAGAGCTTCAAAAATTTTCA
Loxodonta_africana|10356            AATGTGACAGAATTTATCCTCCTGGGCCTGACAGAGAACATAGAGCTTCAAAAATTTTCA
Choloepus_hoffmanni|440             AATGTGACAGAATTCATCTTCCTGGGCCTGACGCAGAATGTGGAACTTCAGAAATTTTCA
Oryctolagus_cuniculus|1856          AATGTATCTGAGTTCATCCTTCTGGGCTTGACCCAAAATATGGAGCTCCAGAAATTGGCA
Mus_musculus|22921                  AATATCACCGAATTCATCCTTGTGGGCTTGACTCAGAACATGGAGCTTCAGATATTTTCA
Rattus_norvegicus|22431             AATATCACCGAATTCATCCTTGTGGGCTTGACTCAGAACATGGAGCTTCAGATATTTTCA
Erinaceus_europaeus|4844            AATGTGACAGAATTTATCCTCTTGGGCCTGACTGAAAACCTGGAACTTCAGAAAGTTTCC
Erinaceus_europaeus|2413            AATGTGACAGAATTTATCCTCTTGGGCCTGACTGAAAACCTGGAACTTCAGAAAGTTTCC
Sus_scrofa|11416                    AATGTGTCGGAGTTCATCCTCCTGGGCCTGACTCAAAATATGGAGCTTCAGAAATTTTCA
Felis_catus|1160                    AATGTGACAGAATTCATCCTCCTGGGCTTGACTCAAAACGTGGAACTTCAGAAATTCTCC
Canis_familiaris|8432               AATGTGACGGAATTCATCCTCCTGGGCTTGACTCAAAATGTGGAACTTCAGAAATTTTCA
Canis_familiaris|8419               AATGTGACGGAATTCATCCTCCTGGGCTTGACTCAAAATGTGGAACTTCAGAAATTTTCA
Monodelphis_domestica|24687         AATGTGACTGAATTCATTCTCCTGGGCCTCACACAGAAACCAGAGATGCAGAAAATCATA
Macropus_eugenii|10461              ---------------------------------------------ATGCAGAAACTCATA
Monodelphis_domestica|24684         AATGTGACTGAGTTCATTCTCCTGGGCCTCACACAGAATCCAGAGATGCAGAAAATTATA
Cavia_porcellus|7144                AACGTGACTGAGTTCATTTTAATTGGTCTCACACAGAACCCAGGAGTGCAGAAAGCAGTG
Homo_sapiens|17636                  AATGTGACTGAATTCATTTTAATAGGTCTTACACAGAACCCCATAATGGAGAAAGTCACG
Pan_troglodytes|6844                AATGTGACTGAATTCATTTTAATAGGTCTTACACAGAACCCCATAATGGAGAAAGTCACG
Sus_scrofa|11414                    AATGTGACCGAATTCATTTTAATCGGTCTTACCCAGAATCCTCAAATGCAAAACGTAGTG
Erinaceus_europaeus|4881            AATGTGACTGAATTCATTTTACTTGGTCTTACACATAATCTTCAAATGCAGAAGGTAGTG
Otolemur_garnettii|1429             AATGTGACTGAATTCATTTTAATCGGTCTCACACAGGACCCCAAGATGCAGAAAGTCACC
Microcebus_murinus|3048             AATGTGACTGAATTCATTTTAATAGGTCTCACACAGAACCCCAAGATGCAGAAATTCACG
Bos_taurus|6619                     AATGTGACTGTGTTCATTCTAGTAGGTCTTACACAGAACCCCCAAATGCAAAAAATAGTG
Bos_taurus|6624                     AATGTGACTGTGTTCATTCTAGTAGGTCTTACACAGAACCCCCAAATGCAAAAAATAGTG
Procavia_capensis|8766              AATGTGACAGAATTCATTTTAATAGGTCTTACACAGAACCCAAAGGTACAAAAATTGGTA
Loxodonta_africana|10360            AATGTGACTGAATTCATTTTAATAGGTCTTACACAGAACCCAAAGATGCAGAAATTAGTG
Vicugna_pacos|1942                  AATGTGACTGAATTCATTTTAATAGGTCTTACACAGAACCCCCAAATGCAAAAAGCAGTG
Canis_familiaris|8421               AATGTGACTGAATTTATTTTAATAGGTCTTACACAGAACCCCACAATGCAGAATATAGTA
Felis_catus|6205                    AATGTGACTGAGTTTATTTTAATAGGTCTTACACAGAACCCCAAGATGCAGAATATAGTG
Ochotona_princeps|11681             AATGTGACGGAATTCATCTTAGTAGGTCTGTCACTGAACCCCACAGTGCAGAAAGTGCTG
Rattus_norvegicus|22434             AATGTGACTGAATTCATCTTGATAGGTCTTACACAGAACCCCCAAATGCAGAAAGTAGTG
Mus_musculus|22917                  AACGTGACTGAGTTCATCTTGATAGGTCTTACACAGAACCCCCAAATGCAGAAAGTAGTG
Mus_musculus|22928                  AATGTGACTGAATTCATCTTGATAGGTCTTACACAGAACCCCCAAATGCAGAAAGTAGTG
Oryctolagus_cuniculus|1853          AATGTGACTGAATTCATCTTAGTTGGTCTTTCACAGAACCCCAAAGTGCAGAAAGTCGTG
Oryctolagus_cuniculus|1852          AATGTGACTGAATTCATCTTAGCTGGTCTTTCACAGAACCCCAAAGTGCAGAAAGTCGTG
Ornithorhynchus_anatinus|16863      AACGTGACTGAATTCATTTTAGTGGGTCTCACACAGAGCCCCGATATGCAGAAGTTATTC
Ornithorhynchus_anatinus|16862      AATGTGACCGAATTTGTCCTCCTGGGTTTTACGCAAAGTCCGGAGATCCAGAGAACATTC
Ornithorhynchus_anatinus|16865      ACGGTGACCGAATTCATTTTATTGGGACTTACGCAGAATTCAGAAATGAGGCAAATATTT
                                                                                                

Procavia_capensis|16277             CTTGTGGTCTTCTTGTTTCTCTACCTTGCCACACTGTTGGCAAACTTGCTTATTGTCATG
Erinaceus_europaeus|13540           ------------------------------------------------------------
Bos_taurus|28568                    TCTGCTGTGTTTCTAATCATGTATGTATCCACCATTCTGGGAAACCTCCTCATTGTGGTA
Dasypus_novemcinctus|13523          TCTGCTTTGTTTCTAATCATGTATGTGGCCACAGTGATGGGAAACCTGCTCGTTGTGGTA
Mus_musculus|22888                  TCTGCTTTGTTTCTTATCATGTATGTGGCCACACTTTTGGGAAACCTACTGATCATTGTA
Rattus_norvegicus|22406             TCTGCTTTGTTTCTTATCATGTATGTGGTCACAATCTTGGGAAACTTATTGATTGTTGTA
Mus_musculus|22846                  TCTGTTTTGTTTCTTATTATGTATATGGCCACAGTCTTTGGAAATCTACTCATTGTGGTT
Rattus_norvegicus|22366             TCTGTGCTGTTTCTAATTATGTACATGATCACGATCTTTGGAAATCTTCTCATTGTGGTT
Ochotona_princeps|15463             ------------------------------------------------------------
Homo_sapiens|17660                  TCTGCTGTGTTTCTTGTCATGTATGTAGCCACAGTGCTGGAAAATCTACTTATTGTGGTA
Pan_troglodytes|8167                TCTGCCGTGTTTCTTGTCATGTATGTAGCCACAGTGCTGGAAAATCTACTTATTGTGGTA
Otolemur_garnettii|13504            TCTGCCATGTTTCTCATCATTTATGCGGCCACAGTGCTGGGAAACCTACTCATTGTGGTG
Microcebus_murinus|2797             TCTGCTGTGATTCTAATCATGTATTTGGCCACGGTATTGGGAAATCTACTCATTGTGGTC
Microcebus_murinus|5059             TCTACTGTGTTTCTAATCATGTATGTGGCCACAGTACTGGGAAATCTACTCATTGTGGTC
Microcebus_murinus|10664            TCTGCCGTGTTTGTAATCATTTATGTGGCCACAGTACTGGGAAATCTACTCATTGTGGTC
Tupaia_belangeri|13856              TCTGCTGTGTTTCTAATCATGTATGTTGCCACACTTTTGGGAAACTTACTCATTATAGTA
Choloepus_hoffmanni|6189            TCTGCTGTGTTTCTAATCAGGTATGTGGCCATAGTCATGGGAAGCCTACTCATTGTGGTA
Choloepus_hoffmanni|10987           TCTGCTGTGTTTCTAATCATGTATGTGGCTACAGTCATGGGAAACCTACTCATTGTGGTA
Felis_catus|6208                    TCTGCTGTGTTTCTAATCCTGTACGTGTCCACGGTTTTGGGGAACCTACTCATGGTGGTA
Canis_familiaris|28898              TCTGCTGTGTTTCTAATCATGTATGTGTTCACGGTTTTGGGAAACCTAGTAATTGTGGTA
Canis_familiaris|28666              TCTGCTGTGTTTCTAATCATGTATGTGTTCACGGTTTTGGGAAACCTAGTAATTGTGGTA
Canis_familiaris|8394               TCTGCTGTGTTTCTAATCATGTATGTGTCCACGGTTTTGGGAAACCTAGTAATTGTGGTA
Canis_familiaris|8407               TCTGCTGTGTTTCTAATCATGTATGTGTCCACGGTTTTGGGAAACCTAGTAATTGTGGTA
Loxodonta_africana|10342            TCTGCTGTGTTTCTAATCATGTATGTGGCCACCGTACCGGAAAACTTACTCATTGTGGTA
Loxodonta_africana|7429             CCTACTGTGTTTTTAATCATGTATGTGGCCACTGTATTGGGAAACTTACTCATTGTGGTA
Loxodonta_africana|8250             CCTACTGTGTTTTTAATCATGTATGTGGCCACCGTATTGGGAAACTTACTCATTGTGGTA
Loxodonta_africana|10841            TCTGCTGTGTTTCTAATCATGTATGTTGTCACCATGTTGGGAAACCTACTCATTGTGGTA
Loxodonta_africana|7347             TCTACTGTATTTGTAATCATGTATGTGACCACCGTGTTGGGAAACCTACTCATTGTGGTA
Loxodonta_africana|15374            TCTATTGTTTTTCTAATCATATATGTGACCACCATGTTGGGAAACCTACTCATTGTGGTA
Loxodonta_africana|8254             TCTACTGTATTTCTAATCATGTATGTGACCACCATGTTGGGAAACCTACTCATTGTGGTA
Loxodonta_africana|10347            TCTACTGTATTTCTCATCATGTATGTGACCACCATGTTGGGAAACCTACTCATTGTGGTA
Dasypus_novemcinctus|5504           TTTGTTGTGTTTACAATCATGTACTTTCTCACCATGGCAGGCAACCTACTCATCATAGTA
Dasypus_novemcinctus|6826           ---------------------TACTTTCTCACCCTTGTGGGCAACCTACTCATTGTAGTG
Equus_caballus|5245                 TTTCCTGTGTTTACAATCATCTACTTTCCCACTGTGGCAGGCAACCTACTCATTGTTGTG
Echinops_telfairi|11116             TTTGCTGTGTTCACAATCATCTACCTGCTCACCTTGGCAGGGAACCTACTCATTGTCCTG
Echinops_telfairi|11654             ------------------------------------------------------------
Echinops_telfairi|10565             TTTGCTGTGTTTGCAATCATCTACCTGCTCAACTTGGCAGGGAACCTACTCATTGTCCTG
Vicugna_pacos|1925                  TTTGCTGTGTTTACAGTCATCTACTTTCTTACTGTAGCAGGCAACCTACTCATTGTTGTG
Dasypus_novemcinctus|6644           TTCGTCGTGTTTACAGTCATCTATTTAATCACCCTGGCAGGGAATCTACTCATTGTAGTG
Spermophilus_tridecemlineatus|10360 TCTGTTGTATTTTTGATCATCTACTTTCTCACCCTGCTAGGCAACCTACTCATTGTTGTG
Cavia_porcellus|23431               TCTGTCATATTTGCCATCATCTACTGCCTTACCCTGGCAGGCAACTTACTCATTGTTGTG
Callithrix_jacchus|41201            TTCGCTGTGTTTACACTCATCTACTTTCTCACTATAGTAGGCAACCTACTCACTGTGGTG
Mus_musculus|22929                  CTTGTCATATTTGCACTCATCTACTCCCTTACCCTCATTGGCAACCTGCTCATTATTGTA
Rattus_norvegicus|22435             CTTGTCATATTTACACTCATCTACTCTCTTACCCTCATTGGCAACCTACTCATTATTGTA
Equus_caballus|5271                 TTCCCTGTGTTTGCAGTCATCTACTTTTTCACTGTGGCAGGAAACCCACTCATTGTGGTG
Sorex_araneus|6771                  TTTGCGGTGTTCACCGTTGTCTACCTTCTCACCGTAGCAGGCAACCTGCTCATTGTAGTG
Sus_scrofa|9827                     TTTGCTCTGTTTACAGTCATCTACTTGCTCACGGTGGCAGGCAACCTGCTCATTGTCATG
Loxodonta_africana|10361            TTTGCTGTCTTTGCAGTCATCTACCTGCTCGCCCTGGCAGGCAACCTACTCATTGTAGTG
Homo_sapiens|17605                  TTTGCTGTGTTTACACTCATCTACTTTCTCACCATGGTAGACAACCTAATCATTGTGGTG
Pan_troglodytes|6828                TTTGCTGTGTTTACACTCGTCTACTTTCTCACCATGGTAGGCAACCTAATCATTGTGGTG
Canis_familiaris|8422               TTTGCTGTGTTTATAGTCATCTACTTTCTCACTGTGGCAGGCAACTTACTCATTGTCGTG
Oryctolagus_cuniculus|1850          TTCGCTGTGTTCACAATCATCTACTTCCTCACCCTGATAGGCAACATACTCATTGTGGTG
Otolemur_garnettii|13491            TTCGCCGTGTTCACAGTCATCTACTTCCTCACCCTGACAGGCAACCTCCTCATTGTGGTC
Microcebus_murinus|9568             ------------------------------------------------------------
Dasypus_novemcinctus|3289           ------------------------------------------------------GTCGTG
Dasypus_novemcinctus|6897           ------------------------------------------------------------
Dasypus_novemcinctus|15676          ------------------------------------------------------------
Choloepus_hoffmanni|6218            TTTGTCATGTTTACACTTATCTACCTTCTCACTCTGGTGGGCAACCTACTCATTATAGTG
Spermophilus_tridecemlineatus|12911 TTTGCTGTATTTTTGCTCATCTACATTATCTCTATAGTAGGAAATTTGCTCATCTTGATA
Bos_taurus|29294                    TTTGCTATGTTTCTGGTCATCTACCTCACCACTGTGGTAGCAAATGTGCTCATTGTGGTC
Bos_taurus|27626                    TTTGTTTTGTTTTTGGTTGTCTACATCATCTCTGTGGTAGGAAATTTGTTCATCATGGTC
Sus_scrofa|11423                    TTCGTGGTATTTTTGATCATCGACATCATCTCTATGGTGGGAAATGTGCTCACTTTGGTT
Cavia_porcellus|21650               TTTACCGTGTTTTTAACCATCTACGTCATCACTATGGCAGGAAATGTGTTCATCATGGTC
Rattus_norvegicus|22372             TTTGTTGTGTTTTTGGTTATCTATGTTTTCTCTGTGGTGGGAAATTTGCTTATTTTGATC
Rattus_norvegicus|22374             TTTGTTGTGTTTTTGGTTATCTATGTCTTCTCTGTGGTGGGAAATTTGCTTATTTTGATC
Bos_taurus|29733                    TTTGCTTTGTTTCTCATTGTCTACATTGTCTCTATGGTAGGGAATGTGCTCACCTTGGTC
Sus_scrofa|11396                    TTCATTGTGTTTTTGATCGTCTACATGGTCTCCATGGTAGGAAATGTGCTCACCGTGGTC
Sus_scrofa|11395                    TTTGTGGTGTTTTTGCTCATCTACACTGTCTCTCTGGGAGGAAATGTGCTCACCGTGGTC
Sus_scrofa|11400                    TTTGTGGTGTTTCTGCTCATCTACGCTGTCTCTCTAGGAGGAAATGTGCTCACCATAGTC
Sus_scrofa|11399                    TTTGTGGTGTTTCTGCTCATCTACGCTGTCTCTCTGGGAGGAAATGTGCTCACCATAGTC
Choloepus_hoffmanni|258             ---------------------------------GTGGTAGGAAATGGGGTCATTGTGGTT
Monodelphis_domestica|24688         TTCGTTGTGTTTTTTATAATCTATGTCATTACAATGGTAGGTAACATACTTATTGTCATC
Monodelphis_domestica|24689         TTCGTTGTGTTTTTGATCATGTATGCTATCACAATGGTAGGTAACACACTCATTGTCATC
Monodelphis_domestica|24691         TTCGTTGTGTTTTTGGTCATGTATGCTGTCACAATGGTAGGTAACACACTCATTGTCATC
Callithrix_jacchus|41212            TTTGTTGTGTTTTCTGTCATCTACATCACTACCATGATAGGAAATGTGCTCATTTTGGTC
Homo_sapiens|17635                  TTTGTTGTGTTTTCTGTCATCTACATCAACGCCATGATAGGAAATGTGCTCATTGTGGTC
Equus_caballus|5278                 TTTGCTGTGTTTTTTGTCATCTACATCATTTCTATGGCAGGAAATGTGCTCATAGTGGTC
Canis_familiaris|8369               TTTGTTGTGTTTCTGGTCATCTACATCGTCTCTGTGGTAGGAAATGTGCTCACCGTGGTC
Canis_familiaris|8352               TTTGTTGTGTTTTTGATCATCTACATCGTCTCTGTGGTAGGAAATGTGCTCACTGTGGCA
Canis_familiaris|8363               TTTGTTGTGTTTTTGATCATCTACATCATCTCTGTGGTAGGAAATGTGCTCACCGTGGCA
Bos_taurus|6622                     TTTGCTGTTTTTTTGGTCATCTATATCATCACTGTGGTAGGAAACATGCTCATCGTGGTC
Mus_musculus|22922                  TTCATTATGTTTTTTCTTATCTACATCATTTCTATAACAGGAAATGTGCTCATTGTGGTC
Rattus_norvegicus|22432             TTCATTGTGTTTCTTCTTATCTATATCATTTCTATAACCGGAAATGTGCTCATTGTGGTC
Bos_taurus|6627                     TTTGCTGTGTTCTTTGCCATCTACATCACCACTGTGGTAGGAAATGTGCTCATCATCGTC
Sus_scrofa|11415                    TTTGCTGTGTTTTTTGTCATCTATATTATCACTGTGGTAGGAAATGTGCTCATCGTGGTC
Sus_scrofa|11413                    TCTGCTGTGTTTTCTGTCATCTATATTATCACTATGGTAGGAAATGTGCTCATCGTGGTC
Sus_scrofa|9826                     TCTGCTGTGTTTTTTGTCATCTATATTATCACTATGGTAGGAAATGTGCTCATTGTGGTC
Sus_scrofa|11406                    TCTGCTGTGTTTTCTGTCATCTATATTATCACTATGGTAGGAAATGTGCTCATCGTGATC
Sus_scrofa|11409                    TCTGCTGTGCTTTTTGTCATCTATATTATCACTATGGTAGGAAATGTGCTCATCGTGATC
Erinaceus_europaeus|4256            TTTGCTGTGTTCTTTGTCATCTACATCACCACTCTGGTGGGAAATCTGATCATTGTGGTC
Procavia_capensis|7897              TTTGCTGTGTTTTTTGTCATCTACATCATCACTGTGGTAGGAAATATGCTCACTGTGCTC
Loxodonta_africana|10358            TTTGCTGTGTTTTTGGTCATCTATACCATCACTGTGGTAGGAAATGTGCTCATTGGGGTC
Echinops_telfairi|7364              ------------------------------------------------------------
Loxodonta_africana|10359            TTTACCATGTTTTCTATCATCTACATCATCACTGTGATAGGAAATGTGCTCATTGTGGTC
Procavia_capensis|11271             TTTGCTGTGTTTTTTGTAGTCTACATCATCACTGTGGTAGGAAACATGCTCACTGTGGTC
Mus_musculus|22924                  TTTGCTGTATTTGTCGTCATCTACATCATCTCCATGGTAGGCAATGTGCTCATTGTGGTC
Oryctolagus_cuniculus|1855          TTTGCTGGGTTTTTTGTCATCTACATTATCTGTATGGGGGGAAATGTTCTCATTGTGGTC
Homo_sapiens|17643                  TTTGTTGTGTTTTTTGTCATCTATATCATCACTGTGGTGGGATATGTGCTCATTGTGGTC
Oryctolagus_cuniculus|1854          TTTGCTGTGTTTTTTATCATCTATATCATCACTGTGGTAGGGAATGTGCTCATCGTGGTC
Callithrix_jacchus|41203            TTTGTTGTGTTTTTTGTCATCTACATCATCACTGTGGTGGGAAATGTGCTCATTGTGGTC
Spermophilus_tridecemlineatus|2389  ------------------------------------------------------GTGGTC
Felis_catus|31463                   TTTGTCGTGTTTTTTGTCATCTACACCATCACTGTAGTAGGTAATATGCTCATTGTGGTC
Canis_familiaris|8420               TTTGTTGTGTTTTTTGTCATCTACACCATCACTGTGGTAGGTAATATGCTCATTGTGATC
Canis_familiaris|8433               TTTGTTGTGTTTTTTGTCATCTACACCATCACTGTGGTAGGTAATATGCTCATTGTGATC
Macropus_eugenii|12245              ------------------------------------------------------------
Ornithorhynchus_anatinus|16857      TTTGTCGTGTTTTTAGCCGTCTACAGCGTTACTGTGATTGGCAACTTGCTCATCATGGCA
Echinops_telfairi|4282              TTTGCTTTGATCTTAATTCTCTACTTGGTCACTCTGGTGGGTAATCTGCTCATCGTGATC
Rhesus_macaque|12555                TTTGTTGTGTTTTTGATTGTCTACTCGGTCACCTTGGCAGGCAACCTGCTCATCATCCTT
Loxodonta_africana|10357            TTTGCTGTGTTTTTAATTGTCTACTTGGTTACCCTGTCAGGCAACCTGCTCATCATGATC
Loxodonta_africana|23520            TTTGCTGTGTTTTTCATTGTCTATTTGGTTACCCTGACAGGCAACCTGCTCATCATGATC
Loxodonta_africana|23521            TTTGCTGTGTTTTTCATTGTCTACTTGGTTACCCTGGCAGGCAACCTGCTCATCATGATC
Loxodonta_africana|10356            TTTGCTGTGGTTTTAATTGTCTATTTGGTTACCCTGGCAGGTAACCTGCTCATCATGATC
Choloepus_hoffmanni|440             TTTGCTGTGTTTTTAATAGTCTATTTGGTCACTGTGGCAGGCAACCTGCTCATCATCATC
Oryctolagus_cuniculus|1856          TTTGCTGTGTTTTTAATTGTCTACCTGGTCACCTTAGCGGGCAACCTACTCATCATGATC
Mus_musculus|22921                  TTTGTCGTATTTTTCATTGTCTATCTGCTCACCTTGGCTGGCAACCTGCTTATCATGGTC
Rattus_norvegicus|22431             TTTGTCGTATTTTTCATTGTCTATCTGCTCACCTTGGCTGGCAACCTGCTTATCATGGTC
Erinaceus_europaeus|4844            TTTGTGGTGTTCTTAATGGTCTATCTGGTCACGTTGGCAGGAAACCTGCTCATCATGGTC
Erinaceus_europaeus|2413            TTTGTGGTGTTCTTAATGGTCTATCTGGTCACGTTGGCAGGAAACCTGCTCATCATGGTC
Sus_scrofa|11416                    TTTGTCGTGTTTTTAATGGTCTACTTGGTCACCTTGGCAGGGAACCTGGTCATCATGATC
Felis_catus|1160                    TTTTTTGTGTTTTTAATTGTCTACTTGGTCACTTTGGCGGGCAACTTGCTCATCATGATC
Canis_familiaris|8432               TTTGTTGTGTTTTTAATTGTCTACTTGGTCACCTTGGCAGGCAACTTGCTTATCATGATC
Canis_familiaris|8419               TTTGTTGTGTTTTTAATTGTCTACTTGGTCACTTTGGCAGGCAACTTGCTTATCATGATC
Monodelphis_domestica|24687         TTTGTGGTGTTTTTGTTCATCTACTTGGCAACACTGGGAGGTAACCTGCTCATTATCATC
Macropus_eugenii|10461              TTCGTGGTGTTTTTACTCATCTATTTGGCAACACTAGCAGGCAATTTGCTCATTATCACC
Monodelphis_domestica|24684         TTTGTGGTGTTCTTACTAATTTACTTGGTAACTTTGGTGGGTAACTTGCTTATTATTGTT
Cavia_porcellus|7144                TTTGTGGTCTTTCTGATTCTGTACATGGTAACACTCACTGTCAACCTGCTTATTGTGGTG
Homo_sapiens|17636                  TTTGTAGTATTTTTGGTTCTTTACATGATAACACTTTCAGGCAACCTGCTCATTGTGGTT
Pan_troglodytes|6844                TTTGTAGTATTTTTGGTTCTTTACATGATAACACTTTCAGGCAACCTGCTCATTGTGGTT
Sus_scrofa|11414                    TTTGTGGTGTTTTTGGTTGTATACATGATAACTCTTTCAGGCAACCTGCTCATTGTGGTT
Erinaceus_europaeus|4881            TTTGTGGTCTTTTTGTTTCTGTACTTGGTGACACTCTCTGGCAACCTGCTCATTATGGCT
Otolemur_garnettii|1429             TTCGTGGTCTTTTTGATTCTGTACATAATAACCCTCTCGGGCAACCTGCTCATCGTGGTG
Microcebus_murinus|3048             TTTGTGGTATTTTTGGTTTTGTACATAACAACACTCTCAGGCAACCTGCTCATCGTGGTT
Bos_taurus|6619                     TTTGTGGTGTTTTTGGTCTTGTACATGGTAACCCTCTCAGGCAACCTGCTCATTGTGGTT
Bos_taurus|6624                     TTTGTGGTGTTTTTGGTCTTGTACATGGTAACCCTCTCAGGCAACCTGCTCATTGTGGTT
Procavia_capensis|8766              TTTGTGGCATTTTTGGTTCTGTACATGGTAACACTCTCAGGCAATCTCCTTATTATTGTT
Loxodonta_africana|10360            TTTATGGTATTTTTGGTTCTGTACATGGTAACACTCTCAGGCAATCTACTTATTGTTGTT
Vicugna_pacos|1942                  TTTGCAGTGTTTCTGGTTTTGTACATGGTAACCCTCTCAGGCAACCTGCTCATCGTGGTT
Canis_familiaris|8421               TTTCTGGGATTTTTGATTCTGTACATGGTAACACTCTCAGGCAACTTGCTCATTGTGGTT
Felis_catus|6205                    TTTCTGGGATTTTTGATTCTATACATGGTAACACTCTCAGGCAACCTGCTCATTGTGGTT
Ochotona_princeps|11681             TTTGGGGTGTTCTTGCTTCTGTATGTGATAACGCTTTCAGGAAACCTTCTCATCGTGGTC
Rattus_norvegicus|22434             TTTGTGACATTTTTGATTCTGTACATGATAACAATTTCTGGCAACCTGCTCATTGTGGTC
Mus_musculus|22917                  TTCGTGACATTTTTGCTTCTGTACATGATAACAATTTCAGGCAACCTGCTCATTGTGGTC
Mus_musculus|22928                  TTCGTGACATTTTTGGTTCTATACATGACAACAATTTCAGGCAACCTCCTCATTGTGGTC
Oryctolagus_cuniculus|1853          TTTGTGGTGTTTTTGTTGCTGTATTTGACAACGCTCTCAGGAAACCTCCTCATTGTGGCC
Oryctolagus_cuniculus|1852          TTTGTGGTGTTTTTGTTGCTGTATTTGACAACGCTCTCGGGAAACCTCCTCATTGTGGCC
Ornithorhynchus_anatinus|16863      TTCGTTGTGTTTTTCAGTGTGTACATTGCAACTCTGGTGGGGAATCTTCTTGTTGTGGTA
Ornithorhynchus_anatinus|16862      TTTGTCATTTTTCTCTTATCCTATCTTGTCACCGTGATGGGGAATCTGCTCATTGTCATA
Ornithorhynchus_anatinus|16865      TTTGTCACATTTCTAATCATCTACATTGTAACTCTTCTGGGCAACATGCTCATCGTGGTA
                                                                                                

Procavia_capensis|16277             ACCATGAGATACAGTCGGATGTTAGGAGGCCCCATGTACTTCTTCCTTTTCTACTTGTCT
Erinaceus_europaeus|13540           ------------------------------------------------------------
Bos_taurus|28568                    ACTGTGGTCACAAGTCAGAGTCTGAGATCACCCATGTATTTTTTCCTTACCTTTTTATCC
Dasypus_novemcinctus|13523          ACTATGATCACAAGTCGGAGTCTGAGATCACCTGTGTATTTTTTCCTGACTTGCTTTTTT
Mus_musculus|22888                  ACTGTAACAGTGAGTCCGAATCTGAGGTCTCCCATGTATTTTTTCCTCATTTCCTTGTCC
Rattus_norvegicus|22406             ACTGTAATGAAGAGTTCGAATCTGAGGTCTCCCATGTATTTTTTCCTCATTTCCTTGTCC
Mus_musculus|22846                  ACCATAACCAGAAGCCCTAGTCTGAGGTCACCCATGTACTTCTTCCTTTTATCTTTGTCA
Rattus_norvegicus|22366             ACCATAACCAGAAGCCCGAGTCTGAGGTCACCCATGTATTTTTTCCTTTTATCTCTGTCA
Ochotona_princeps|15463             ---------------------------------------------------TTCTTGGCC
Homo_sapiens|17660                  ACTATTATCACAAGTCAGAGTCTGAGGTCACCTATGTATTTTTTTCTTACCTTCTTGTCC
Pan_troglodytes|8167                ACTATTATCACAAATCAGAGTCTGAGGTCACCTATGTATTTTTTTCTTACCTTCTTGTCC
Otolemur_garnettii|13504            ACCATAATCACAAGTCAGAGTCTGAGATCACCTATGTACTTTTTTCTTACCTTCTTGTCC
Microcebus_murinus|2797             ACCATAATCACAAGTCAGAGTCTGAGATCACCTATGTATTTTTTTCTTACCTTCTTTTCC
Microcebus_murinus|5059             ACCATAATTACAAGTCAGAGTCTGAGATCACCTATGTATTTTTTTCTTACCTTCTTGTCC
Microcebus_murinus|10664            ACCATAAACACAAGTCAGAGTCTTAGATCACCTATGTATTTTTTTCTTGCCTTCTTGTCC
Tupaia_belangeri|13856              ACCTTAATCGCAAGTCAGAATCTACAATCACCTATGTACTTTTTTCTTATATTCTTGTCT
Choloepus_hoffmanni|6189            ACCGTGACCACAAGTCGGAGTCTGAGATCACCCACGTATTTTTTCCTTACTTCCTTCTCC
Choloepus_hoffmanni|10987           ACCGTGATCACAAGTCAGAGTCTGAGATCACCCATGTATTTTTTCCTTACTTCCTTCTCC
Felis_catus|6208                    ACCGTGATCACAAGTCAGAGCCTGAGATCACCTATGTATTTTTTTCTCACTTCCTTGTCC
Canis_familiaris|28898              ACTGTGATCACAAGTCAAAGTCTGAGATCACCTATGTATTTTTTCCTTACTTTCTTATCC
Canis_familiaris|28666              ACTGTGATCACAAGTCAAAGTCTGAGATCACCTATGTATTTTTTCCTTACTTTCTTATCC
Canis_familiaris|8394               ACTGTGATCACAAGTCAGAGTCTGAGATCACCTATGTATTTTTTCCTTATTTTCTTATCC
Canis_familiaris|8407               ACTGTGATCACAAGTCAGAGTCTGAGATCACCTATGTATTTTTTCCTTCCTTTCTTATCC
Loxodonta_africana|10342            ACTATGACTGCAAGTCAGAGTCTGAGGTCACCTATGTATTTTTTCCTTCCTTCTGTTTCA
Loxodonta_africana|7429             ACTATGACTACAAGTCAGAGTTTGAGGTCACCTATGTATTTTTTCCTTACTTCCTTGTCC
Loxodonta_africana|8250             ACTATGACTACAAGTCAGAGTTTGAGGTCACCTATGTATTTTTTCCTTACTTCCTTGTCC
Loxodonta_africana|10841            ACTATGACTGCAAGTCAGAGTCTGAGGTCACCTATGTATTTTTTCCTTACTTCCTTGTCC
Loxodonta_africana|7347             ACTATGACTGCAAGTAAGAGTCTGAGTTCACCTTTGTATTTTTTCCTTATTTACTTGTCC
Loxodonta_africana|15374            ACTATGACTGCAAGTCAGAGTCTGAGGTCACCTATGTATTTTTTCCTT------TTGTCC
Loxodonta_africana|8254             ACTATGACTGCAAGTCAGAGTCTGAGGTCACCTATGTATTTTTTCCTTACTTACTTGTCC
Loxodonta_africana|10347            ACTATGACTGCAAGTCAGAGTCTGAGGTCACCTATGTATTTTTCCCTTACTTACTTGTCC
Dasypus_novemcinctus|5504           ACAATTGCCAGCAGCCCAGCTCTGGGGTCCCCTATGTACTTTTTTCTGTCTTACTTATCA
Dasypus_novemcinctus|6826           ACCATTGCCACCAGCCCAGCACTCCGCACCCCCATGTATTTCTTTCTGTCATTTTTATCC
Equus_caballus|5245                 ACGATCACCACGAAACGAACTCTGTGTTCCCCCATGTATTTTTTCCTGTCTTTCTTATCC
Echinops_telfairi|11116             ACCATCACCACCAGCCCAGCTTTGGGATCCCCCATGTATTTTTTTCTGTCATTCCTGTCC
Echinops_telfairi|11654             ------------------------------------TATTTTTTTCTGTCATTCCTGTCC
Echinops_telfairi|10565             ACCGTCACCACCAGCCCAGCCCTGGGCTCCCCCATGTATTTTTTTCTATTATTCCTGTCT
Vicugna_pacos|1925                  ACAGTCACCACTAGCAGAGCCCTGGGGGAGCCCATGTACTTTTTCCTGTCTTTCTTATCC
Dasypus_novemcinctus|6644           ACCATCGCCACCAGCCCAGCCCTGAGATCTCCCATGTATTTTTTTCTATCTTTCTTGTCC
Spermophilus_tridecemlineatus|10360 ACTATCACCACCAGCCCAGCCTTGGGTTCCCCCATGTATTTTTTTCTGTCCTTCTTGTCC
Cavia_porcellus|23431               ACTATCACCAGCAGCCCAGCCCTGGGCTCCCCCATGTACTTCTTTCTGTCCTTCTTATCT
Callithrix_jacchus|41201            ACAATCACCACCAGCCCAACCCTGGACTCTCCTATGTATTTTTTTCTGTCTTTCTTGTCC
Mus_musculus|22929                  ACAGTCATCTCTAGCCCGACACTGGGATCCCCCATGTACTTTTTTCTGTCCTTCTTATCC
Rattus_norvegicus|22435             ACAGTCATCTCTAGCCCAGCCCTGGGATCCCCCATGTATTTTTTTCTGTCCTTCTTATCC
Equus_caballus|5271                 ACAATCACCACCAGCAGAGCCCTAGGTTCCCCCATGTATTTTTTTCTGTCTTTCTTGTCC
Sorex_araneus|6771                  ACCATCACCACCAGCCCCGCCCTGGGATCCCCCATGTATTTTTTCCTGTGTTTCTTGTCC
Sus_scrofa|9827                     ACCGTCACCACCAGCAGAGCCCTGAGCTCCCCCATGTATTTTTTTCTTTCTTTCTTGTCC
Loxodonta_africana|10361            ACCATCACCACCAGCCCAGTCCTAGGCTCCCCCATGTATTTTTTTCTGTCTTTTCTGTCC
Homo_sapiens|17605                  ACAATCACCACCAGCCCAGCCCTGGACTCCCCCGTGTATTTTTTTCTGTCTTTCTTTTCC
Pan_troglodytes|6828                ACAATCACCACCAGCCCAGCCCTGGACTCCCCCGTGTATTTTTTTCTGTCTTTCTTTTCC
Canis_familiaris|8422               ACAATCAGCACCAGCAGAGCCCTGGGCTCCCCCATGTATTTTTTTCTGTCTTTCCTGTCC
Oryctolagus_cuniculus|1850          ACAGTCACCACCAGCCCAGCCCTGGGATCCCCCATGTATTTTTTTCTGTCTTTCTTGTCC
Otolemur_garnettii|13491            ACAATCACCACCAGCCCAGCCCTGGGTTCCCCCATGTATTTTTTTCTGTCTTTTTTGTCC
Microcebus_murinus|9568             ------------------------------------------------------------
Dasypus_novemcinctus|3289           ACAATCACCACCAGTCGAACGCTGGGTTCCCCCATGTATTTTTTTCTGTCATTTTTGTCC
Dasypus_novemcinctus|6897           ------------------------------------------------------------
Dasypus_novemcinctus|15676          ------------------------------------------------------------
Choloepus_hoffmanni|6218            ACCATCGCCACCAGCCCAGCCCTGGGCTCCCCCATGTATTTTTTTCTGTCTTTCTTATCC
Spermophilus_tridecemlineatus|12911 ACCATCACCACCAGTTCATTGTTGGGATCCCCCATGTACTTTTTCCTGGCCTATCTCTCC
Bos_taurus|29294                    ACCATAAATGTCAGTTCATCACTGAGGTCTCCCATGTACTTTGTCCTGGCCCATCTCTCC
Bos_taurus|27626                    ACCATTATAGTCAGCCCATTACTGGGATCTCCCATGTACTTTTTTCTGGCTTATCTCTCC
Sus_scrofa|11423                    ATCATGACAGCCAGTCCATTACTGGAGTCCCCCATGTACTTTTTTCTGGCTCATCTCTCT
Cavia_porcellus|21650               ATCATCACTGCTAGCCCGTTGTTACAGTCTCCCATGTACTTTTTCCTGGTCCATCTCTCC
Rattus_norvegicus|22372             ACCATTACGAACAGCCAACTGTTGGGGGCACCTATGTACTACTTCCTGGCCTATCTCTCC
Rattus_norvegicus|22374             ACCATTACAAACAGCCAACTGTTGGGATCCCCTATGTACTACTTCCTGGCCTATCTCTCC
Bos_taurus|29733                    ACCATCGCCACCAGCTCATTATTGGGGTCCCCCATGTACTTTTTCCTGGCTAATCTCTCT
Sus_scrofa|11396                    ACCATCACTCTCAGCCCATTGCTGAAGTCCCCCATGTACTATTTCCTGGCTCATCTCTCT
Sus_scrofa|11395                    ACCATCGCTACCAGCCCATTAATCAGGTGCCCCATGTACTTTTTCCTGGCTCATCTCTCT
Sus_scrofa|11400                    ACCATCACTACAAGCCCATTAATCGGGTGCCCCATGTACTATTTCCTGGCTCATCTCTCT
Sus_scrofa|11399                    ACCATCACTACCAGCCCATTAATCGGGTGCCCCATGTACTATTTCCTGGCTCATCTCTCT
Choloepus_hoffmanni|258             ACCATCATTGCCAATCCCAGGGTGGGATACCCCATGTTCTATTTCCTGGCCTATCTTGCA
Monodelphis_domestica|24688         ACCATCAACCTCAGCCCAACCCTTGGTTCCCCTATGTACTTTTTTCTGGCCTACTTGTCC
Monodelphis_domestica|24689         ACCATTATCATTGACCCAAGTATGGATTCCCCTATGTACTTTTTTCTGGCCTATTTGTCC
Monodelphis_domestica|24691         ACCATTATCATTGACCCAACTATGGATTCCCCTATGTACTTTTTCCTTGCCTACTTGTCC
Callithrix_jacchus|41212            ACCATCACTGCCAGCCCATCATTGGGGTCCCCCATGTACTTTTTCCTGGCCCATCTCTCC
Homo_sapiens|17635                  ACCATCACTGCCAGCCCATCACTGAGATCCCCCATGTACTTTTTCCTGGCCTATCTCTCC
Equus_caballus|5278                 ACCATCACTGCCAGCCCATTATTAGGGTCTCCCATGTACCTTTTTCTGGCCTATCTCTCT
Canis_familiaris|8369               ACTATCACTGCCAGCCCATTATCGGGGTCCCCCATGTACTTTTTCCTGGCCTATCTCTCC
Canis_familiaris|8352               GCTATCACCGCCAGCCCATTATTGGGGTCCCCCATGTACTTTTTCCTGGCCTATCTTTCC
Canis_familiaris|8363               GCTATCACCACCAGCCCATTATTGGGGTCCCCCATGTACTTTTTCCTGGCCTATCTTTCC
Bos_taurus|6622                     ACTGTTGCTACCAGTTCCTTACTGGAATCCGCCATGTACTTTTTCCTGGCTTATCTCTCC
Mus_musculus|22922                  ACCATAACTTCTACGTCATTATTAGAGTCCCCCATGTACTTTTTCCTGGCTTATCTATCC
Rattus_norvegicus|22432             ACCATAATTTCTACATCATTATTACAGTCCCCCATGTACTTTTTCCTGGCTTATCTGTCC
Bos_taurus|6627                     ACCATAACTGCCAGCCCATCTTTGGGATCCCCCATGTACTTTTTCCTGGCCTATCTCTCC
Sus_scrofa|11415                    ACCATCACTGCCAGCCCATCCCTGGGGTCCCCCATGTACTTTTTCCTGGCCTACCTCTCC
Sus_scrofa|11413                    ACCATCACTGCCAGCCCATCCCTGGGGTCCCCCATGTACTTTTTCCTGGCCCATCTCTCC
Sus_scrofa|9826                     ACCATCACTGCCAGCCCATCCCTGGGGTCCCCCATGTACTTTTTCCTGGCCCATCTCTCC
Sus_scrofa|11406                    ACCATCACTGCCAGCCCATCCCTGGGGTCCCCCATGTACTTTTTCCTGGCCCATCTCTCC
Sus_scrofa|11409                    ACCATCACTGCCAGCCCATCCCTGGGGTCCCCCATGTACTTTTTCCTGGCCCATCTCTCC
Erinaceus_europaeus|4256            ACCATCATTGCCAGCCCATTATTGGGGTCCCCCATGTATTTCTTTCTGGTCTATCTCTCC
Procavia_capensis|7897              ACCATCACTGCCAGCCCACTGGTTCGATCCCCCATGTACTATTTCCTCGCCTATCTCTCC
Loxodonta_africana|10358            ACCATCACTGCCAGCCCATTGCTGGGATCCCCCATGTACTTCTTCCTGGCCTATCTCTCC
Echinops_telfairi|7364              ---------------------------------------TTTTTCCTGGCTTATCTCTCC
Loxodonta_africana|10359            ACCATCGCTGCCAGCCCATCACTGGGATCCCCTATGTACTTTTTTCTGGCATATCTCTCC
Procavia_capensis|11271             ACCATCACCGCCAGCCCATCCTTGGGATCCCCCATGTACTTTTTCCTGACCTATCTCTCT
Mus_musculus|22924                  ACTATCACTGCCAGTCCATCGCTGGGCTCCCCTATGTACTTTTTCTTAGCGTATCTCTCT
Oryctolagus_cuniculus|1855          ACCATCACTGCCAGTCCATTGTTGAGGTCCCCTATGTACTTTTTTCTGGCCTATCTTTCC
Homo_sapiens|17643                  ACCATCACTGCCAGCCCATCACTGGGGTCCCCCATGTACCTTTCCCTGGCCTATCTCTCC
Oryctolagus_cuniculus|1854          ACCATCGCTGCCAGCCCGTCACTGGGATCCCCCATGTACTTCTTCCTGGCCTATCTCTCC
Callithrix_jacchus|41203            ACCATCACTGCCAGCCCATCATTGGGGTCCCCCATGTACTTTTTCCTGGCCCATCTCTCC
Spermophilus_tridecemlineatus|2389  ACCATTACTGCAAGCCCATTGTTGGGGTCCCCTATGTACTTTTTTTTGGCCTATCTCTCC
Felis_catus|31463                   ACTATCACTGCCAGCCCATTGTTGGGGTCTCCCATGTACTTTTTCCTGGCCTACCTCTCC
Canis_familiaris|8420               ACCATCACTGCCAGCCCATTGTTGGGATCCCCCATGTACCTTTTCCTGGCCTCTCTCTCC
Canis_familiaris|8433               ACCATCACTGCCAGCCCATTGTTGGGATCCCCCATGTACTTTTTCCTGGCCTATCTCTCC
Macropus_eugenii|12245              ------------------------------------------------------------
Ornithorhynchus_anatinus|16857      ACCATAAACAGCAGCAAGACTCTTGGCTGTCCCATGTACTTTTTTCTTAATCATTTGTCC
Echinops_telfairi|4282              ACCATCAGCACCAACAGGTCTTTAGGGTCCCCCATGTACTTCTTCTTGTCTTACTTATCC
Rhesus_macaque|12555                ACCATTAGCACCAGCAGGTCCCTGGCATCCCCCATGTACTTTTTCCTGTTTTACTTATCC
Loxodonta_africana|10357            ACCATCAGCACCAACAAGTCTTCAGGGTCCCCCATGTACTTCTTCCTGTCTTACTTATCC
Loxodonta_africana|23520            ACCATCAGCATCAATAGGTCTTTAGGATCCCCCATGTACTTCTTCTTGTTTTACTTATCC
Loxodonta_africana|23521            ACCATCAGCACCAATAGGTCTTTAGGATCCCCCATGTACTTCTTCTTGTTTTACTTATCC
Loxodonta_africana|10356            ATGATCAGCACCAATAGGTCTTTAGGATCCCCCATGTACTTCTTCTTGTTTTACTTATCC
Choloepus_hoffmanni|440             ACTGTGAGCACCAGCACAGCTCTGGGGTCTCCCATGTACTACTTCTTATCTTATTTATCC
Oryctolagus_cuniculus|1856          ACCATCAGCAGCAGCAAAGCCCTTGACTCCCCCATGTACTTCTTTCTGTCTTACTTGTCA
Mus_musculus|22921                  ACCATCAGCAGCAGCAAGGCCCTGGGATCCCCGATGTATTTCTTCCTCTCTTTCCTGTCG
Rattus_norvegicus|22431             ACCATCAGCAGCAGCAGAGCCCTGGGATCCCCGATGTACTTCTTCCTCTCTTTCCTCTCT
Erinaceus_europaeus|4844            ACCATCAGCACCAGTAGGACCCTGGGGTCCCCCATGTATTTCTTCTTGTCTTACTTATCT
Erinaceus_europaeus|2413            ACCATCAGCACCAGTAGGACCCTGGGGTCCCCCATGTATTTCTTCTTGTCTTACTTATCT
Sus_scrofa|11416                    ACCATCAGCACCAGCAAGGCCCTGGGATCCCCAATGTACTTCTTCCTGTCTTACTTATCC
Felis_catus|1160                    ACCATCAGTACCAGTAGTGCCCTCGAAACCCCCATGTACTTCTTCCTGTCTTACTTGGCC
Canis_familiaris|8432               ACCATCAGCACCAGCAAGGCCCTGGAAACCCCCATGTACTTCTTCCTGTCTTACTTGTCC
Canis_familiaris|8419               ACCATCAGCACCAGCAAGGCCCTGGAAACCCCCATGTACTTCTTCCTGTCTTACTTGTCC
Monodelphis_domestica|24687         ACCATTACCTGTAGCCAGGCTCTGGGGTCCCCCATGTACTACTTTCTGTCATACTTGTCT
Macropus_eugenii|10461              ACCATCAGCACCAGCCAGACTCTGGGTACCCCTATGTACTACTTTCTATCATACTTGTCT
Monodelphis_domestica|24684         ACTGTCACCACTAGCCAAGCTCTGAACTCTCCCATGTACTTCTTCTTGTCTTTCTTGTCC
Cavia_porcellus|7144                GCCATTGTCATCAGCCAGACTCTGAGCACACCCATGTATTTCTTCCTCAGTCACCTTTCC
Homo_sapiens|17636                  ACCATTACCACCAGCCAGGCTCTGAGCTCCCCCATGTACTTCTTCCTGACCCACCTTTCT
Pan_troglodytes|6844                ACCATTACCACCAGCCAGGCTCTGAGCTCCCCCATGTACTTCTTCCTGACCCACCTTTCT
Sus_scrofa|11414                    ACTCTTACCACCAGCCAGGCTCTGAACTCCCCCATGTACTTCTTCCTGACCCACCTTTCC
Erinaceus_europaeus|4881            ACCATAGCCATCAGCCAGACTCTGAACTCACCCATGTATTTCTTCCTGACTCATCTTTCC
Otolemur_garnettii|1429             ACCATCGCCACCAGCCAGGCTCTGAGCTCCCCCATGTACTTCTTCTTGACCCACCTTTCC
Microcebus_murinus|3048             ACCATTATCACCAGCCGGGCTCTGAGCTCCCCCATGTACTTCTTCCTGATCCACCTTTCC
Bos_taurus|6619                     ACCATTACCACCAGCCAGGCTCTGAACTCCCCCATGTACTTCTTCCTGACCCACCTTTCC
Bos_taurus|6624                     ACCATTACCACCAGCCAGGCTCTGAACTCCCCCATGTACTTCTTCCTGACCCACCTTTCC
Procavia_capensis|8766              ACTGTTACTACCAGCCAGGCTCTGAGTTCCCCCATGTACTTCTTCTTGACCCAACTTTCT
Loxodonta_africana|10360            ACTATTACTACCAGCCAGGCTCTGAGCTCCCCCATGTACTTCTTCTTGACCCACCTTTCT
Vicugna_pacos|1942                  ACCATTACCACCAGCCAGGCTCTGGACTCCCCCATGTACTTCTTCCTGACCCACCTTTCC
Canis_familiaris|8421               ACCATTACCACCAGCCAGGCTCTGAACTCCCCCATGTACTTCTTTCTGACTCATCTTTCC
Felis_catus|6205                    ACCATTACCACCACCCAGACTCTGAACTCCCCCATGTATTTCTTCCTGACTCATCTTTCC
Ochotona_princeps|11681             ACCATCGTCAGCAGCCAGGCCCTGAACTCGCCCATGTACTTCTTCCTGACCCACCTTTCC
Rattus_norvegicus|22434             ACTGTCATCAACAGTCAGGCTCTGAGTTCCCCAATGTATTTCTTCCTGAGTCACCTCTCC
Mus_musculus|22917                  ACTGTCATCAACAGCCAGGCTCTGAATTCCCCCATGTATTTCTTCCTGAGCCACCTCTCC
Mus_musculus|22928                  ACTATCATCAACAGCCAGGCTCTGAATTCCCCCATGTATTTCTTCCTGAGCCACCTCTCC
Oryctolagus_cuniculus|1853          ACCATCATCACCAGCCAGGCTCTGAGCTCTCCCATGTACTTCTTCCTGACCCACCTTTCC
Oryctolagus_cuniculus|1852          ACCATCATCACCAGCCAGGCTCTGAGCTCTCCCATGTACTTCTTCCTGACCCACCTTTCC
Ornithorhynchus_anatinus|16863      ACTATAATCTCCAGCTCGACTCTGGGGTCCCCTATGTATTTCTTCCTTGCCTACCTGTCC
Ornithorhynchus_anatinus|16862      GCCATAAAGGCCAGTAAAACTTTGGGCACCCCCATGTACTTTTTTCTGGCCTATTTATCA
Ornithorhynchus_anatinus|16865      ACCATAGGCAGCAGCAAGGCTCTGTCCACCCCCATGTATTTCTTCCTCTCTCACTTGTCT
                                                                                                

Procavia_capensis|16277             TTTGCTGATGTCTGTCTTTCAATAACCACAGCTCCTCGATTGATTATAGATACAATATCC
Erinaceus_europaeus|13540           ------------------------------------------------------------
Bos_taurus|28568                    CTTTTGGATACTGACTACTATTCTGCCATTGGCCATAAGATGATTGTAGACTCCCTTTCT
Dasypus_novemcinctus|13523          CTCATAGAAGTCCCCAACTCTTCTGTCATTGCC---AAGATGACTGTTGGCTCTCTCTTT
Mus_musculus|22888                  CTTTTGGATGTCATCTACTCTTCAGTCACTGCTCCCAAGTTGATTGTAGACTCTCTTTCT
Rattus_norvegicus|22406             TTTTTGGACGTCATCTACTCTTCAATCACTGCTCCCAAGTTGATTATAGATTCTCTTTCT
Mus_musculus|22846                  CTCATGGATGTCACTTACTCTTCTGTCATTGCTCCAAAATTGATTATGGACTCCCTTTCT
Rattus_norvegicus|22366             CTCATGGATGTCACTTACTCTTCTGTCATTGCTCCTAAGTTGATTATTGACTCCCTTTCT
Ochotona_princeps|15463             CTTCTGGATGTCACCTACTCTTCTGTCATTGCCCCCAAGATGGTCTTGGATTCCCTGTCT
Homo_sapiens|17660                  CTTTTGGATGTCATGTTCTCATCTGTCGTTGCCCCCAAGGTGATTGTAGACACCCTCTCC
Pan_troglodytes|8167                CTTTTGGATGTCATGTTCTCATCTGTCGTTGCCCCCAAGGTGATTGTAGACGCCCTCTCC
Otolemur_garnettii|13504            CTTTCAGATGTTATTTATTCTTCTGTCATTGCCCCCAAGATGATCGTGGACTCCCTCTCT
Microcebus_murinus|2797             ATTTCGGATGTCTCCTTCTCTTCTGTGATTACCCCCAAGATGATTGTGGACTCCCTCTCT
Microcebus_murinus|5059             ATTTCGGATGTCATCTACTCTTCCGTCATCGCCCCCAAGATGATTGTGGACTCCCTCTCT
Microcebus_murinus|10664            ATTTCGGATGTCATCTTCTCTTCTGTCATCACCCCGAAGATGATTGTGGACTCCCTCTCT
Tupaia_belangeri|13856              TTTTTGGATGTCACCTACTCTTCCGTCATTGCCCCCAAGTTGATTGTGGACTCGCTCTCT
Choloepus_hoffmanni|6189            CTCATGGATGTCATCTACTCTTCAGTCATTGCCCCCAAGACGATTGTGGACTCCCTCTCT
Choloepus_hoffmanni|10987           CTCATGGATGTCACCTACTCTTCAGTCATTGCCCCCAAGATGATTGTGGACTCCCTCTCT
Felis_catus|6208                    CTCATGGACGCCACCTACTGTTCCGTCATTGCCCCCAAGATGATCGTGGACTCCTTCTCC
Canis_familiaris|28898              TTTTTGGATGTTACCTACTCTTCTGTCATTGCCCCCAAGATGATTGTGGACTCCCTCTCC
Canis_familiaris|28666              TTTTTGGATGTTACCTACTCTTCTGTCATTGCCCCCAAGATGATTGTGGACTCCCTCTCC
Canis_familiaris|8394               CTTTTGGATGTTACCTACTCTTCTGTCATTGCCCCCAAGATGATTGTGGACTCCCTCTCC
Canis_familiaris|8407               CTTTTGGATGTTACCTACTCTTCTGTCATTGCTCCCAAGATGATTGTGGACTCCCTCTCC
Loxodonta_africana|10342            CTCATGGATGCCACCTATTCTTCTGTCATAGCTCCCAAGATGATTGTGGATTCCTTCTCT
Loxodonta_africana|7429             CTAACGGATACTGTCTATTCTTCTGTCATCGCTCCCAAGATGATTGTGGATTCCTTCTCT
Loxodonta_africana|8250             CTAACGGATACTGTCTATTCTTCTGTCATCACCCCCAAGATGATTGTGGATTCCTTCTCT
Loxodonta_africana|10841            CTCATGGATGCCATCTTTTCTTCTGTAGTCGCCCCCAAGATGATTGTGGATTCCCTCTCT
Loxodonta_africana|7347             CTAACGGATGCCATCTTTTCTTCCGTCATCACCCCCAAGATGATTGTGGATAGT------
Loxodonta_africana|15374            CTAACCAATGCCATCTTTTCTTCCGTCATCACCCCCAAGATGATTGTGGATTCCTTCTCT
Loxodonta_africana|8254             CTAACGGATGCCATCTTTTCTTCCGTCATCACCCCCAAGATGATTGTGGATTCCTTCTCT
Loxodonta_africana|10347            CTAATGGATGCCATCTTTTCTTCCGTCATCACCCCCAAGATGATTGTGGATTCCTTCTCT
Dasypus_novemcinctus|5504           TTTCAAGATGGTGCATTTTGTTCTAATACAGTTCCAAAAATGATATTTGACTTACGTGCT
Dasypus_novemcinctus|6826           TTCGTAGATTTTACCTGTTCTTCTATCACAGCCCCCAAAATGATATTTGATTTACTCGCT
Equus_caballus|5245                 TTCATAGATGGCTGCTGCTCCTCTACTGTGGTTCCCAAAATGATATATGACTTACTTGCA
Echinops_telfairi|11116             ATCACAGATGGAATCTTCACATCTACCATCGCCCCCAAAATGATGATTGACCTACTGGCT
Echinops_telfairi|11654             ATCACAGATGGAATCTTCACATCTACCATCGCGCCCAAAATGATAATTGACCTACTGGCT
Echinops_telfairi|10565             GTCACTGATGGAATCTTCACATCTACCATCGCTCCCAAAATGATGATTGACCTACTGGCT
Vicugna_pacos|1925                  TTCATAGACTGCTGCTGCTCAACTACCATGGCCCCCAAAATGATATTTGACTTGNNNNNN
Dasypus_novemcinctus|6644           TTTCTAGATGGCACTTTCTCTTCTATCACAGCCCCCAAAATGATATTTGATTTACTTGCT
Spermophilus_tridecemlineatus|10360 TTCATAGATGGCTGCTGCTCTTCTACCATGACCCCTAAAATGATAGTTGACTTACTTGAT
Cavia_porcellus|23431               TTCATTGATGGCTGCTGCTCTTCTACCATGGCCCCCAAAATGATATTTGACTTACTGGCT
Callithrix_jacchus|41201            TTCATAGATGGCTGCTGCTCTTCTGCTGTGGCCCCTAAAATGCTATTTGACTTACTCACT
Mus_musculus|22929                  TTCGTAGATGGCTGCTGCTCTTCCACCATGGCCCCCAAAATGATATTTGACTTACTTGCT
Rattus_norvegicus|22435             TTTGTAGATGGCTGCTGCTCTTCCACTATGGCACCCAAAATGATATTTGATTTACTTGCT
Equus_caballus|5271                 TTTATAGATGGCTGTTGCTCTTTTACTGTGGCTCCCAAAATGCTATTTGACTTACTTGCA
Sorex_araneus|6771                  TTCATAGATGGCTGCTGCTCTTCTACCATGGCCCCCAAAATGATACTGGACTTACTCGCC
Sus_scrofa|9827                     TTCCTAGATGGCTGCTGCTCTTCTACCATGGCCCCCAAAATGATATATGACTTACTCGCT
Loxodonta_africana|10361            TTCATAGATGGCTGCTGCTCTTCTACCATGGCCCCGAAAATGATTGTTGATTTACTGGCT
Homo_sapiens|17605                  TTCATAGATGGCTGCTCCTCTTCTACCATGGCCCCCAAAATGATATTTGACTTACTCACT
Pan_troglodytes|6828                TTCATGGATGGCTGCTCCTCTTCTACCATGGCCCCCAAAATGATATTTGACTTACTCACT
Canis_familiaris|8422               TTCATAGATAGCTGCTGCTCTTCAACTATGGCTCCCAAAATGATATTTGACTTACTTGCT
Oryctolagus_cuniculus|1850          TTTATAGATGGCTGCTGCTCTTCTACTATGGCCCCCAAGATGATATTTGACTTATTAGCC
Otolemur_garnettii|13491            TTCATAGATGGCTGCTGCTCTTCTACCATGGCCCCCAAAATGATCTTCGACTTACTCGCT
Microcebus_murinus|9568             ------------------------------------------------------------
Dasypus_novemcinctus|3289           TTCATAGATGGTTCCTTCTCTTCCATTACAGCCCCCAAAATGATATTTGACTTAATTGCA
Dasypus_novemcinctus|6897           ------------------------------------------------------------
Dasypus_novemcinctus|15676          ------------------------------------------------------------
Choloepus_hoffmanni|6218            TTTTTAGATGGCTCCTTCTCTTCTACCATAACCCCCAAAATGATATTTGACTTACTTGCT
Spermophilus_tridecemlineatus|12911 TTTATTGATGCCTGCTATGCCTCTGTCAATACCCTTAAGCCAATGGTAGATTCACTCCAT
Bos_taurus|29294                    TTTGTTGATGCCTGCTATTCCTCTGTAAGTACCCCCAAACTGATTGCAGATTCACGGTAT
Bos_taurus|27626                    CTTATTGATGCTTGCTACTCCTCT---------------CTGATTGTCGATTCCCTCTGT
Sus_scrofa|11423                    TTCATTGATGCCTGCTATTCCTGTGTCAACGCCCCTAAACTTATTGTAGATTCAGTCTAT
Cavia_porcellus|21650               TTCATTGATGCCTGTTACTCCTCTGTCTTTACTCCTAAACTAATTGTAGATTCACTCCAC
Rattus_norvegicus|22372             TTTATTGATGCCTGCTACTCCTCTGTCAATACACCTAAACTGATTTTTGATTCACTCCAT
Rattus_norvegicus|22374             TTTATTGATGCCTGCTACTCCTCTGTCAATACACCAAAACTGATTTTTGATTCACTCCAT
Bos_taurus|29733                    TTTATTGATGCCTGCTATTCCTGTGTCAATACCCCTAAACTCATTATAGATTTACTCTAT
Sus_scrofa|11396                    TTTATTGATGCTTGCTATTCCTGTGTCAATACCCCTAAACTCATTGTAGATTCTCTGTAT
Sus_scrofa|11395                    TTCATCGATGCTTGCTATTCCTGTACGGCTACCCCTAAATTGGTTGTAGACTCACTCCAT
Sus_scrofa|11400                    TTCATCGATGCTTGCTGTTCCTGTGTGGATACACCTAAATTGGTTGTAGACTCGCTCTAT
Sus_scrofa|11399                    TTCATCGATGCTTGCTATTCCTGTGTGGATACTCCTAAACTGGTTGTAGATTCACTCTAT
Choloepus_hoffmanni|258             TTAGTAGATGCCTGCTATTCCTCTGTCAATACTCCAAAACTTATCATAGATGCTCTCCAT
Monodelphis_domestica|24688         TTTATAGATGCCTGTTATTCCTCTGTTAATACACCAAAACTCATTATAGACTCACTTTAT
Monodelphis_domestica|24689         TTCATAGATGCCTGTTATTCCTCTGTTAATACACCAAAACTCATTATAGACTCATTTTAT
Monodelphis_domestica|24691         TTTATAGATGCCTGCTATTCATCTGTTAATGCACCCAAACTCATTACAGACTCATTATAT
Callithrix_jacchus|41212            TTTATTGATGCCTGCTATTCCTCCGTCAATGCCCCTAAGCTGATCACAGATTCACTCTAT
Homo_sapiens|17635                  TTTATTGATGCCTGCTATTCCTCTGTCAATACCCCTAAGCTGATCACAGATTCACTCTAT
Equus_caballus|5278                 TTTATTGATGCCTGCTATTCCTCTGTCAGTACCCCCAAATTGATTGTAGATTCACTCTGT
Canis_familiaris|8369               CTCATTGATGCCTGCTATTCTTCTGTCAATACCCCCACCCTCATCATAGAGTCACTCCGT
Canis_familiaris|8352               TTCATTGATGCCTGCTATTCTTCTGTCAATAACCCTAAACTGATTGTAGATTCACTCCGT
Canis_familiaris|8363               TTCATTGATGCCTGCTATTCTTCTGTCAATAACCCTAAACTGATTGTAGATTCACTCCGT
Bos_taurus|6622                     TTTATTGATGCCTCTTATTCCTCTGTCAACACTCCCAAATTGATCGTAGATTCACTCCAT
Mus_musculus|22922                  TTTATTGATGCTTGCTATTCCTCTGTTAGCACCCCTAAACTGATAGCAGATTCACTCTGT
Rattus_norvegicus|22432             TTTATTGATGCCTGCTATTCCTCTGTTAGCACCCCTAAACTGATAACAGATTCACTTTGT
Bos_taurus|6627                     TTTATCGATGCCTGCTACTCCTCTGTGTGTGCCCCTAAGATGATTGTAGATTCACTCTGT
Sus_scrofa|11415                    TTTATTGATGCCTGCTATTCCTCTGTCAGTACCCCCAAAATGATTATAGATTCACTCCGT
Sus_scrofa|11413                    TTCATTGATGCCTGCTATTCCTCTGTCAGTACCCCCAAAATGATTATAGATTCACTCCAT
Sus_scrofa|9826                     TTCATTGATGCCTGCTATTCCTCTGTCATTACCCCCAAAATGATTATAGATTCACTCCAT
Sus_scrofa|11406                    TTCATTGATGCCTGCTATTCCTCTGTCAGTACCCCCAAAATGATTATAGATTCACTCCAT
Sus_scrofa|11409                    TTTATTGATGCCTGCTATTCCTCTGTCAGTACCCCCAAAATGATTATAGATTCACTCCAT
Erinaceus_europaeus|4256            TTTATTGATGCCTGCTATTCTTCTGTCAATACTCCTAAACTGATCGTAGATTCACTCTAT
Procavia_capensis|7897              TTTATTGATGCTTGCTATTCCTCTGTCAGTGCCCCTAAACTGGTTGTAGATTTACTGCAT
Loxodonta_africana|10358            TTTATCGATGCTTGCTATTCCTCAGTCAATACCCCTAAACTGATTGTGGATTCACTCCGT
Echinops_telfairi|7364              TTTATCGATGCTTGCTACTCCTCGGTCAATACCCCTAAACTGATTGCAGATTCAGTCCGT
Loxodonta_africana|10359            TTTATCGATGCTTGCTATTCCTCTGTCAATACCCCTAAACTGATCATAGATTCACTCCAG
Procavia_capensis|11271             TTTATCGATGCCTGTTATTCCTCTGTCAATACCCCTAAACTGATCATAGATACACTGCAT
Mus_musculus|22924                  TTCATTGATGCCTGTTATTCCTCTGTCAACACTCCTAAATTGATCATAGACTCACTCCAT
Oryctolagus_cuniculus|1855          TTTATTGATGCCTGCTATTCGTCTGTCAGTACTCCAAAACTTATCACAGATTCATTCCAC
Homo_sapiens|17643                  TTTATTGATGCCTGCTATTCCTCTGTCAATACCCCTAACCTGATCACACATTCACTCTAT
Oryctolagus_cuniculus|1854          TTTATTGATGCCTGCTACTCCTCTGTCAATACCCCTAAACTGATCACAGATTCACTCCAT
Callithrix_jacchus|41203            TTTATTGATGCCTGCTATTCCTCTGTAAATACCCCTAAGCTAATCATAGATTCACTCTAT
Spermophilus_tridecemlineatus|2389  TTTATTGATGCCTGCTATGCCTCTGTCAGTACCCCTAAATTGATAGTGGATGCTCTCCAT
Felis_catus|31463                   TTTATTGATGCCTGCTATTCCTCTGTTAATACTCCTAAACTGATCATAGATTCCCTCCAT
Canis_familiaris|8420               TTTATTGATGCCTGCTACTCCTCTGTCAATACTCCCAAACTGATCATAGATTCGCTCCAT
Canis_familiaris|8433               TTTATTGATGCCTGCTACTCCTCTGTCAATACTCCCAAACTGATCATAGATTCGCTCCAT
Macropus_eugenii|12245              ------------------------------------------------------------
Ornithorhynchus_anatinus|16857      TTCATAGATATGATTTATTCTTCTTCCTCAGCTCCCAAACTGATTGCAGACTCCATCCGG
Echinops_telfairi|4282              CTGATAGATGGCTGCTTTTCTTCATCCATAACCCCCAAAATGTTAGCTGACTCTCTTGCT
Rhesus_macaque|12555                CTCATGGATGGCTGCTGTTCTTCATGCATGACCCCCAAAATGCTAGCTGATACTCTTTCT
Loxodonta_africana|10357            TTTATTGAATGCTGCTCTTCTTCATCCACGGCCCCCAAAATGCTAGCTGCCAGTCTTACA
Loxodonta_africana|23520            CTTATAGATGGCTGCTTTTCTTCATCCATGACCCCCAAAATGCTAGCTGACAGTCTTACA
Loxodonta_africana|23521            CTTATAGATGGCTGCTGTTCTTTATCCATGACCCCAAAAATGCTAGCTGACAGTCTTACA
Loxodonta_africana|10356            CTTATAGATGGCTGCTTTTCTTCAGCCATGACCCCCAAAATGCTAGCTGACAGTCTTACT
Choloepus_hoffmanni|440             CTTGTAGATGGCTGCTGTTCTTCCTCCATGGCCCCTAAGATGCTAGCTGACTCTCTGGCT
Oryctolagus_cuniculus|1856          CTTATAGATGGCTGCTGTTCCTCATCCATGACCCCTAAAATGCTAGCTGACGCTCTTGCT
Mus_musculus|22921                  CTGATAGATGGCTGCTGCTCCTCGTCCATGACTCCTAAGATGCTGGCTGACTCTCTCTCT
Rattus_norvegicus|22431             CTGATAGATGGCTGCTGCTCCTCATCCATGACTCCAAAGATGCTGGTCGACTCTCTCTCT
Erinaceus_europaeus|4844            CTCATAGATGGCTGCTGCTCTTCCTCCATGACCCCCAAAATGCTAGCTGACACACTCAGT
Erinaceus_europaeus|2413            CTCATAGATGGCTGCTGCTCTTCCTCCATGACCCCCAAAATGCTAGCTGACACACTCAGT
Sus_scrofa|11416                    CTTTTAGATAGCTGTTGCTCTTCCTCCATGACCCCTAAAATGCTGGCTGACACCCTTACT
Felis_catus|1160                    CTTATAGATGGCTGTTGTTCTTCCTCCATGACCCCTAAAATGCTCGCTGACACTCTTACT
Canis_familiaris|8432               CTTATAGATGGCTGCTGTTCTTCCTCCATGACCCCTAAAATGCTTGCTGACACTCTTACT
Canis_familiaris|8419               CTTATAGATGGCTGCTGTTCTTCCTCCATGACCCCTAAAATGCTTGCTGACACTCTTACT
Monodelphis_domestica|24687         TTCCTAGATGGCTGTTGTTCATCTTCCTTGGCCCCCAAAATGATAATTGACTCACTCTTT
Macropus_eugenii|10461              TTCATAGATGGCTGCTGTTCATCCTCCTTGGCCCCTAAAATGATAATTGACTCACTCTTT
Monodelphis_domestica|24684         ATCATAGATGGTCTTTGCTCTTCTTCCATGGCCCCCAAACTGATAGTTGACTCATTATAT
Cavia_porcellus|7144                TTGATAGACACAATTTATTCCTCTTCCTCAGCTCCAAAGCTGATTGTAGACTCCTTGCAT
Homo_sapiens|17636                  TTGATAGACACAGTTTATTCTTCTTCTTCAGCTCCTAAGTTGATTGTGGATTCCTTTCAA
Pan_troglodytes|6844                TTGATAGACACAGTTTATTCTTCTTCTTCAGCTCCTAAGTTGATTGTGGATTCCTTTCAT
Sus_scrofa|11414                    TTGATAGACACAATTTATTCTTCTTCCTCAGCTCCTAAGCTGATTGTGGACACCCTTAAC
Erinaceus_europaeus|4881            TTGATAGACACCATTTATTCTTCTTCTTCCGCCCCCAAACTGATCGTGGACTCCCTCCAT
Otolemur_garnettii|1429             TTGATAGACACAGTTTACTCTTCTTCTTCAGCTCCTAAGCTGATCGCGGACTCCCTTCAT
Microcebus_murinus|3048             TTGATAGACACGATTTATTCTTCTTCTTCAGCTCCTAAGCTGATTGTGGACTCCCTTCAT
Bos_taurus|6619                     TTGATAGACACAATTTACTCTTCTTCTTCAGCTCCTAAGTTGATTGTGGACTCCCTTCAG
Bos_taurus|6624                     TTGATAGACACAATTTACTCTTCTTCTTCAGCTCCTAAGTTGATTGTGGACTCCCTTCAG
Procavia_capensis|8766              TTGATAGACACAATTTATTCTTCTTCTTCAGCTCCTAAGCTGATTGTGGACTCCCTTCAT
Loxodonta_africana|10360            TTGATAGACACAGTTTATTCCTCTTCTTCAGCTCCTAAGCTGATTGTGGACTCCCTTCAG
Vicugna_pacos|1942                  TTGATAGACACAATTTATTCTTCTTCTTCAGCGCCTAAGCTGATTGTGGACTCCCTTCAC
Canis_familiaris|8421               GTGATAGACACAATTTATTCTTCCTCTTCAGCTCCTAAGCTGATTGTGGACTCCCTTCAT
Felis_catus|6205                    TTGATAGACACAATTTATTCTTCTTCTTCAGCTCCTAAGCTGATTGTGGACTCCCTTCAC
Ochotona_princeps|11681             TTGATAGACACAATTTATTCTTCCTCCTCGGCTCCCAAGCTGATCGCAGACTCCCTTCAT
Rattus_norvegicus|22434             TTGATAGATACAATTTATACTTCTTCTTCAGCTCCAAAGCTGATTGTGGACTCCCTTCAG
Mus_musculus|22917                  TTGATAGATACAATTTACACCTCTTCTTCAGCTCCAAAGCTGATTGCGGACTCCCTTCAA
Mus_musculus|22928                  TTGATAGATACAATTTACACTTCTTCTTCAGCTCCAAAGCTGATTGCGGACTCCCTTCAA
Oryctolagus_cuniculus|1853          TTCATAGACACGATTTACTCCTCTTCTTCAGCTCCCAGGCTGATTGCAGACTCCTTGCAG
Oryctolagus_cuniculus|1852          TTCATAGACACGGTTTATTCCTCTTCTTCAGCTCCCAGGCTGATTGCAGACTCCCTGCAG
Ornithorhynchus_anatinus|16863      TTAATCGATACCTGCTACTCCACCTCCATCACCCCCAAAATGCTCGTAGATCTGCTGTCC
Ornithorhynchus_anatinus|16862      TTCATAGATACCTGCTATACATCCTGTGTGGCTCCCAAGATGATTACAGATTTGCTTCAG
Ornithorhynchus_anatinus|16865      TTTATTGACGCTAGTTATTCTTCCTCTTCTGCCCCCAAAATGCTCATCGATTTGTCTTCT
                                                                                                

Procavia_capensis|16277             AAGAAGAAAGTCATCTCCTACAACGAGTGCATGGCTCAGATTTTTGCAGGTCATTTTTTT
Erinaceus_europaeus|13540           ------------------------------------------------------------
Bos_taurus|28568                    GAGAGTGCTACCATCACCCTGGAAGGCTGCATGGTCCAGCTCTTCACTGAACACTTCTTT
Dasypus_novemcinctus|13523          CAGAGCACTACCATCTCCCTGGAAGGCTGTATGACCCAGCTCTTTGCAGAACATTTATTT
Mus_musculus|22888                  GAGAACACTACCATCTCCCTAGAAGGCTGCATGACCCAACTCTTTGCTGAACACTTTTTT
Rattus_norvegicus|22406             GAAAACACTACGATCTCCCTAGAAGGCTGTATGACCCAGCTCTTTGCTGAACACTTCTTT
Mus_musculus|22846                  GAGAGGACTATTGTCTCATTTGAAAGATGTATGACCCAGCTATTTGCAGAACATTTCTTT
Rattus_norvegicus|22366             GAAAGGACTATTGTGTCATTTGAAGGTTGCATGGCCCAGTTATTTGCAGAACACTTTTTT
Ochotona_princeps|15463             GAGAACACGACCATCTCCCTTGCAGGTTGCATGACCCAGCTCTTCGCAGAGCACTTCTTT
Homo_sapiens|17660                  AAGAGCACTACCATCTCTCTCAAAGGCTGCCTCACCCAGCTGTTTGTGGAGCATTTCTTT
Pan_troglodytes|8167                AAGAGCACTACCATCTCTCTCAAAGGCTGCCTGACCCAGCTCTTTGCGGAGCATTTCTTT
Otolemur_garnettii|13504            GAGGGCACAACCATCTCCCTGGAAGGCTGCATGACCCAGCTCTTTGCGGGACATTTCTTT
Microcebus_murinus|2797             GAGAGCACTACCATCTCCCTTGAAGGCTGCATGACCCAGCTCTTTGGAACACACTTCTTT
Microcebus_murinus|5059             GAGAGCACCACCATCTCCCTTGAAGGCTGCATGACCCAGCTCTTTGCAGCACACTTCTTT
Microcebus_murinus|10664            AAGAGCACTACCATCTCCCTTGAAGGCTGCATGACCCAGCTCTTTGCAGCACACTTCTTT
Tupaia_belangeri|13856              GAAAGCACGACCATCTCCCTGGAAGGCTGCATGACCCAGCTCTTTGCAGAGCACTTTTTT
Choloepus_hoffmanni|6189            GAGAGCACTACCATCTCCCTGAAAGTCTGCATGACCCAGCTCTTTGCAGAGCATTTCTTT
Choloepus_hoffmanni|10987           GAGAGCACTACCATCTCCCTGAAAGGTTGCATGACCCAGCTCTTTGCAGAACATTTCTTT
Felis_catus|6208                    GAGAGAACTACCATCTCCTTTGAAGGCTGCATGGCCCAGCTCTTTGCGGAGCATTTCTTT
Canis_familiaris|28898              AAGAGCACTGTCACCTCCTTAAAAGGTTGCATGGCGCAGCTCCTTGCAGAGCATTTCTTT
Canis_familiaris|28666              AAGAGCACTGTCACCTCCTTAAAAGGTTGCATGGCGCAGCTCCTTGCAGAGCATTTCTTT
Canis_familiaris|8394               AAGAGCACTGTCATCTCCTTAGAAGGTTGCATGGCGCAGCTCTTTGCAGAGCATTTCTTT
Canis_familiaris|8407               AAGAGCACTGCCATCTCCTTAGAAGGTTGCATGACCCAGCTCTTTGCAGAGCATTTCTTT
Loxodonta_africana|10342            GAGAGTGCTACCATCTCCCTGGAAGGCTGCATGATCCAGCTCTTTGCAGAACATTTCTTT
Loxodonta_africana|7429             GAGAGTACTACCATCTCCCTCAAAGGCTGCATGATTCAGCTTTTTGCAGAACATTTCTTT
Loxodonta_africana|8250             GAGAGTACTACCATCTCCCTCAAAGGCTGCATGATTCAGCTTTTTGCAGGACATTTCTTT
Loxodonta_africana|10841            GAGAGCACTACCATCTCCCTCAAAGGCTGTATGACCCAGCTCTTTGCAGAACATTTCTTT
Loxodonta_africana|7347             ------ACTACCATCTCCCTTGAAGGCTGCGTGACCCAGCTCTTTGCAGTACATTTCTTT
Loxodonta_africana|15374            GAGAGTACTACCATCTTGCTCGAAGGCTGCATGACCCAGCTCTTTGCAGTACATTTCTTT
Loxodonta_africana|8254             GAGAGTACTACCATCTCGCTCGAAGGCTGCATGACCCAGCTCTTTGCAGTACATTTCTTT
Loxodonta_africana|10347            GAGAGTACTACCATCTCCCTCAAAGGCTGCATGACCCAGCTCTTTGCAGTACATTTCTTT
Dasypus_novemcinctus|5504           GAGAAGAAAACTATTTCCTTCACTGGGTGCATGGCCCAGCTCTTTGTAGAGCATGTCATA
Dasypus_novemcinctus|6826           GAAAAGAAAACTATCTCCTTCAATGGGTGCATGACTCAGCTCTTTTTGGAGCATTTAATC
Equus_caballus|5245                 GAAAAGAAAACCATCTCCTTCAGTGAGTGCCTGACTCAGCTCTTTGAAGAGCATTTCTTT
Echinops_telfairi|11116             GAAAAGAAAACCATCTCCTTCCATGGGTGCATGACTCAGCTCTTCACAGAGCACTTCTTT
Echinops_telfairi|11654             GAAAAGAAAACCATCTCCTTCCGTGCATGCATGACTCAGCTCTTCACAGAGCACTTCTTT
Echinops_telfairi|10565             GAAAAGAAAACCATCTCCTTCCGTGGGTGCATGACTCAGCTCTTCACAGAGCATTTCTTT
Vicugna_pacos|1925                  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dasypus_novemcinctus|6644           AAGAAGAAAACTATCTCCTTCAGTGGTTGCATGACTCAGCTATTTGTGGAGCATGTCATC
Spermophilus_tridecemlineatus|10360 GAAAAGAAAACTATCTCCTTTAGTGGGTGCATGACTCAGCTCTTTGCAGAACATTTCTTT
Cavia_porcellus|23431               GAAAAGAAAACCATCTCCTTCAGTGGGTGCATGACTCAGCTCTTTGCTGAACATTTCTTT
Callithrix_jacchus|41201            GAAAAGAAAACTATCTCCTTCAGCGGGTGCATGACCCAGCTCTTCGCAGGACATTTCTTT
Mus_musculus|22929                  GAAAGGAAAACAATCTCCTTCAATGGCTGCATGACTCAGATCTTTGCAGAACATTTCTTT
Rattus_norvegicus|22435             GAAAAGAAAACTATCTCCTTTAATGGCTGCATGACTCAGATCTTTGCAGAACATTTCTTT
Equus_caballus|5271                 GAAAAGAAAACCATCTCCTTCGGTGGGTGCCTGACTCAGCTTTTTGCAGGGCAATTCTTT
Sorex_araneus|6771                  AAAAAGAAAACTATTTCCTTTGGTGGGTGCATGACTCAGCTCTTTGCCGAGCACTTTTTT
Sus_scrofa|9827                     GAAAAGAAAACCATCTCCTTCAGCGGGTGCATGACTCAGCTCTTTGCAGAGCATTTCTTT
Loxodonta_africana|10361            GAAAAGAAAACCATCTCCTTCAGTGGGTGCATGACTCAGCTCTTTGCAGAGCATTTCTTT
Homo_sapiens|17605                  GAAAAGAAAACTATTTCCTTCAGTGGGTGCATGACCCAGCTCTTTGTAGAACATTTCTTT
Pan_troglodytes|6828                GAAAAGAAAACTATTTCCTTCAGTGGGTGCATGACCCAGCTCTTTGCAGAACATTTCTTT
Canis_familiaris|8422               AAAAAGAAAACTATCTCCTTCAGTGGGTGCATGACTCAGCTCTTTGCAGAACATTTCTTT
Oryctolagus_cuniculus|1850          GAAAAGAAAACCATCTCCTTCAGTGGGTGCATGACCCAGGTCTTTGCAGAACATTTCTTT
Otolemur_garnettii|13491            GAAAAGAAAACTATCTCCTTCCGTGGGTGCATGACTCAGCTCTTTGCAGAACACTTCTTT
Microcebus_murinus|9568             ------------------------------------------------------TTCTTT
Dasypus_novemcinctus|3289           GAGAAAAAAACCATATCTTTTGTTGGATGTATGACACAGGTCTTTATGGAACATTTCTTT
Dasypus_novemcinctus|6897           ------------------------------------------------------------
Dasypus_novemcinctus|15676          ------------------------------------------------------------
Choloepus_hoffmanni|6218            GAAAAGAAAACCATTTCCTTCAGTTGGTGCATGACTCAGCTCTTTGCAGAGCATTTCCTT
Spermophilus_tridecemlineatus|12911 AAAAAGAAAACCATCTTGTTCTATGCGTGCATAATGCAAATTTTTGGGGAACATTTCTTT
Bos_taurus|29294                    GAAAAGAAGACTATCCTATTTAATGGTTGCATGACCCAAATCTTTGGGGAACATTTCTTT
Bos_taurus|27626                    GAAAGGAATACCATCCTCTTCAATGGATGCGTGATGCAAATCTTTGGGGAACATTTCTTC
Sus_scrofa|11423                    GAGAAGAAAACCAGCCCATTCAATCAATGCATGACCCAAGTCTTTGGCGAACATTTATTT
Cavia_porcellus|21650               AAAAAGAAGACCATTCTGCTCAATGGATGCATGACCCAGGTTTTTGCGGGACATTCTTTT
Rattus_norvegicus|22372             AAAAAGAAATCTATTAAATTCAATGGGTGCATGACCCAAGTTTTTGCAGAACATTTCTTT
Rattus_norvegicus|22374             AAAAAGAAATCTATTAAATTCAATGGGTGCATGACCCAAGTTTTTGCAGAACATTTCTTT
Bos_taurus|29733                    GAGAAGAAAGTCAGCCCTTTCAATGGATGCATGACTCAAATATTTGGGGAACATTTCTTT
Sus_scrofa|11396                    GAAAAGAAAACCAGTCTTTTCAATGCATGCATGACTCAAATCTTTGGGGAACATTTCTTT
Sus_scrofa|11395                    GAAAAGAAAACAAGCACTTTCCATGGATGCATGATCCAAATCTTTGGGGAACATTTCTTT
Sus_scrofa|11400                    GAAAAGAAAACAAGCACTTTCCATGGATGCATGATGCAAATCTTTGGGGAACATTTCTTT
Sus_scrofa|11399                    GAAAAGAAAACAAGCACTTTCCATGGATGCATGATGCAAATCTTTGGGGAACATTTCTTT
Choloepus_hoffmanni|258             GAAAAGAAGACCATCTCATTCAATGGATGTATGACCCAAATTTTTTGGGAACATTTCTTT
Monodelphis_domestica|24688         GAAAAGAAAACCATATTCTTCAATGGTTGCATGACACAAGTCTTTGGTGAACACTTCTTT
Monodelphis_domestica|24689         GAAAAGAAAACCATTTTCTTCAATGGTTGCATGGCACAAGTCTTTGGTGAACACTTCTTT
Monodelphis_domestica|24691         GAAAAGAAAATCATTTCCTTCAATGGTTGCATGACACAAGTCTTTAGTGAACACTTCTTT
Callithrix_jacchus|41212            GAAAAGAAGACCATCCTATTCAGTGGATGCATGACTCAAGTCTTTGGAGAACATTTTTTT
Homo_sapiens|17635                  GAAAACAAGACTATCTTATTCAATGGATGTATGACTCAAGTCTTTGGAGAACATTTTTTC
Equus_caballus|5278                 GAAAAGAAGACCATCCTATTCAATGGGTGTATGACCCAAATCTTTGGGGAACATTTCTTT
Canis_familiaris|8369               GAAAAGAAGACCATCCCATTCAATGCATGCATAATCCAAATCTTTGGGGAACATTTCTTT
Canis_familiaris|8352               GAAAAGAAGACCACCACATTCAATGCATGTATAACCCAAATCTTTGGGGAACATTTTTTT
Canis_familiaris|8363               GAAAAGAAGACCACCACATTCAATGCATGTATAACCCAAATCTTTGGGGAACATTTTTTT
Bos_taurus|6622                     GAAAGTAAAACTATCCTATTCAACGGATGCATGACCCAAATCTTTGGAGAACATTTCTTT
Mus_musculus|22922                  GAAAAGAAGACCATCCCATTTAATGGATGCATGACTCAGATCTTTGGGGAGCATTTGTTT
Rattus_norvegicus|22432             GAAAAGAAGACCATTCTCTTTAATAGTTGCATGACTCAGATCTTTGGGGAGCATTTGTTT
Bos_taurus|6627                     GAAAAGAAAACCATCTTATTTCATGGATGCATGACCCAAATCTTTGGGGAACATTTCTTT
Sus_scrofa|11415                    GGAAAGAAAACCATCCTATTTGATGAGTGTATGACCCAAATCTTTGGGGAACATTTCTTT
Sus_scrofa|11413                    GGAGAGAAGACCATCCTGTTTGAGGAGTGTATGACCCAAATCTTTGGGGAACATTTCTTT
Sus_scrofa|9826                     GGAAAGAAGACCATCCTGTTTGATGAGTGTATGACCCAAATCTTTGGGGAACATTTCTTT
Sus_scrofa|11406                    GGAAAGAAGACCATCCTGTTTGAGGAGTGTATGACCCAAATCTTTGGGGAACATTTCTTT
Sus_scrofa|11409                    GGAAAGAAGACCATCCTGTTTGAGGAGTGTATGACCCAAATCTTTGGGGAACATTTCTTT
Erinaceus_europaeus|4256            GAAAAGAAGACTATCCTGTTCAATGGATGCATGACACAAGTTTTTGGGGAACATTTCTTC
Procavia_capensis|7897              AAAAGAAAGACCATTCCGTTCAATGGGTGTATGACCCAAGTCTTTGGGGAACATTTCTTT
Loxodonta_africana|10358            GAAAGGAAGACCATCCCATTCAATGGATGTATGACTCAAGTCTTTGGGGAACATTTCATC
Echinops_telfairi|7364              GAAAGGAAGACCAGCACATTCAATGGATGTATGACACAAATATTCGGAGAACATTTCTTT
Loxodonta_africana|10359            GAAAGGAAGACCATCCTGTTTGATGGATGTATGACCCAAGTTTTTGGGGAACATTTCTTT
Procavia_capensis|11271             GAAAGGAAGACCATCCTATTCAAAGGATGTATGACTCAAGTCTTTGGGGAACATTTCTTT
Mus_musculus|22924                  GAAAAAAAGACAATACTATTCAATGGATGCATGACCCAGGTCTTTGGGGAGCATTTCTTT
Oryctolagus_cuniculus|1855          GAAAAGAAGACCATCATGTTCAGTGGATGTATGACCCAAGTCTTTGGGGAACATTTCTTT
Homo_sapiens|17643                  GGAAAGAAGGCCATCCTATTCAATGGATGCATGACTCAAGTCTTTGGAGAACATTTCTTC
Oryctolagus_cuniculus|1854          GAAAAGAAGACCATCATGTTCAATGGATGTATGACCCAAGTCTTTGGGGAACATTTCTTT
Callithrix_jacchus|41203            GAAAAGAAGACCATCCTATTCAATGGATGCATGACTCAAGTCTTTGGAGAACATTTCTTT
Spermophilus_tridecemlineatus|2389  GAAAAGAAGATTATCCTGTTCAATGGATGCATGACTCAAATCTTTGGGGAACATTTCTTT
Felis_catus|31463                   AAAAAGAAGACTACCCTATACAATGGATGCATGACTCAAATATTTGGAGAACATTTCTTT
Canis_familiaris|8420               GAAAAGAAGACTACCCTATACAATGGATGCATGACCCAAATATTTGGAGAACATTTTTTT
Canis_familiaris|8433               GAAAAGAAGACTACCCTGTACAATGGATGCATGACCCAAATATTTGGGGAACATTTTTTT
Macropus_eugenii|12245              ------------------------------------CAGCTCTTTACAGAGCATTTCTTT
Ornithorhynchus_anatinus|16857      GAGAAGAACACCATCTCCTTTGAAGGATGCATGACCCAGGTCTATGCAGAACATATCTTT
Echinops_telfairi|4282              GTGAGAAAAACCATCTCTTTCAAGGGATGTATGACTCAAGTCTTTGTTGAGCATCTTCTG
Rhesus_macaque|12555                GTGAAAAAAACCATTACTTTTAGGGGGTGCATGACTCAAGTCTTTGCTGGGCATCTTTTT
Loxodonta_africana|10357            GTGAGAAAAACCATCTCTTTTGGGGGGTGTATGACTCAAATCTTTGCTGAGCATCTTTTT
Loxodonta_africana|23520            GTGAGAAAAACCATCTCTTTTGGTGGGTGTATGACTCAAATCTTTGCTGAGCATCTTTTT
Loxodonta_africana|23521            GCAAGAAAAACCATCTCTTTTGGTGGGTGTATGACTCAAATCTTTGCTGTGCATCTTTTT
Loxodonta_africana|10356            GTGAGAAAAACCATCTCTTTTGGTGGGTGTATGACTCAAATCTTTGCTAAGCATCTTTTT
Choloepus_hoffmanni|440             GTGAGGAAAACCATCTCATTCAGGGGGTGCATGAGTCAAGTCTTTGCTGAACATCTTTTT
Oryctolagus_cuniculus|1856          GAGAGAAAAACCATCTCCTTTCAAGGCTGCCTGACTCAGGTCTTTGCTGAGCATCTCTTT
Mus_musculus|22921                  GTGCGGAAAACCATTTCTTTCAGTGGCTGCATGACTCAAGTCTTTGCCGAGCATTTTTTC
Rattus_norvegicus|22431             GCAAAGAAAACCATTTCTTTCACTGGATGCATGACTCAAGTCTTTGCGGAGCATTTTTTC
Erinaceus_europaeus|4844            GAGAAAAAAGTCATCTCTTTCAGTGGGTGTATGACTCAAGTCTTTGCTGAGCATCTCTTT
Erinaceus_europaeus|2413            GAGAAAAAAGTCATCTCTTTCAGTGGGTGTATGACTCAAGTCTTTGCTGAGCATCTCTTT
Sus_scrofa|11416                    GTGAGAAAGATTATCTCTTTTAGGGGATGTATGACTCAGGTCTTTGCCGAGCATCTTTTT
Felis_catus|1160                    GTGAGAAAAATCATCTCTTTTACAGGATGTATGACTCAAGTCTTTGCTGAACATTTTTTT
Canis_familiaris|8432               ATGAGAAAAATAATCTCTTTTAGGGGATGTATGACTCAGGTCTTTGCTGAGCATTTTTTT
Canis_familiaris|8419               ATGAGAAAAATAATCTCTTTTAGGGGATGTATGACTCAGGTCTTTGCTGAGCATTTTTTT
Monodelphis_domestica|24687         GAGAAGAAAACAATCTCCTTCAATGGGTGCATGACCCAACTCTTTGCAGAACACTTTTTT
Macropus_eugenii|10461              GAGAAGAAAACCATCTCCTTTAATGGATGTATGACTCAGCTCTTTGCAGAACATTTCTTT
Monodelphis_domestica|24684         GAAAAGAAAACCATATCTTTTAATGGATGTATGACTCAACTCTTTGCAGAACATTTCTTT
Cavia_porcellus|7144                GAGAAGAAAGTCATCTCCTTTAATGGGTGCATGGCTCAGGTGTATGCAGAACACATTTTT
Homo_sapiens|17636                  GAGAAGAAAATCATCTCCTTTAATGGGTGTATGGCTCAAGCCTATGCAGAACACATTTTT
Pan_troglodytes|6844                GAGAAGAAAATCATCTCCTTTAATGGGTGTATGGCTCAAGCCTATGCAGAACACATTTTT
Sus_scrofa|11414                    AAGAAGAAAAGTATCTCCTTTATTGGGTGCATGGCTCAAGTCTATGCTGAACACATTTTC
Erinaceus_europaeus|4881            GAGAAGAAAACGATTTCCTTTAATGGATGTATGGCTCAGGTCTATGCAGAGCATATATTT
Otolemur_garnettii|1429             GAGAAGAAAATCATCTCTTTTAATGGGTGTATGGCTCAGGTCTATGCAGAACACATTTTT
Microcebus_murinus|3048             GAGAAGAAAATCATCTCCTTTAATGGGTGTATGGCTCAAGTCTATGCAGAACATATTTTT
Bos_taurus|6619                     GAGATCAAGACAATCTCGTTTAATGGGTGTATGGCTCAAGTCTATGCAGAACACATTTTT
Bos_taurus|6624                     GAGATCAAGACAATCTCGTTTAATGGGTGTATGGCTCAAGTCTATGCAGAACACATTTTT
Procavia_capensis|8766              GAGAAGAAAAGGATTTCCTTTAATGGGTGTATGGCCCAAGTCTATGCAGAACACATCTTT
Loxodonta_africana|10360            GAGAAGAAAATGATTTCCTTTAATGGGTGTATGGCCCAAGCCTATGCAGAACACATCTTT
Vicugna_pacos|1942                  GAGAAGAAAATTATCTCCTTTAATGGGTGTATGGCTCAAGTCTATGCAGAACACATTTTT
Canis_familiaris|8421               GAAAAGAAAATTATCTCCTTTAGTGGCTGTATGGCTCAAGTCTATGCAGAACACATTTTT
Felis_catus|6205                    GAGAAGAAAATTATCTCCTTTAATGGGTGTATGGCTCAGGTTTATGCAGAACACATTTTT
Ochotona_princeps|11681             GAGCAGAAAACCATCTCCTTCAATGGGTGTATGACGCAAGTGTATGCCGAGCATATTTTT
Rattus_norvegicus|22434             GAGAACAAAGTCATCTCCTTTAATGGATGCATGGCTCAAGTCTATGCAGAGCACATTTTT
Mus_musculus|22917                  GAGAACAAAGTCATCTCCTTTAATGGATGCATGGCTCAAGTCTATGCAGAGCACATTTTT
Mus_musculus|22928                  GAGAACAAAGTCATCTCCTTTAATGGATGCATGGCTCAAGTCTATGCAGAGCACATTTTT
Oryctolagus_cuniculus|1853          GAGCGGAAAACCATCTCCTTCACTGGGTGTATGGCTCAAGTCTATGCAGAACACATTTTT
Oryctolagus_cuniculus|1852          GAGCGGAAAACCATCTCCTTCACTGGGTGTATGGCTCAAGTCTATGCAGAACACATTTTT
Ornithorhynchus_anatinus|16863      ATGAGGAAAACCATTTCCTTCAACCGATGTATGGCTCAACTCTTTATCGAACATTTGTGT
Ornithorhynchus_anatinus|16862      GAGAGGAAAACGATCTCCTTCAATGGCTGCATGTCGCAGCTGTTTGCAGAACATTTGTTC
Ornithorhynchus_anatinus|16865      GGGGAGAAAACGATCACCTTCAATGACTGCATGACTCAGGTCTTTACCGAGCACTTGTTC
                                                                                                

Procavia_capensis|16277             GGGTGCATGGAGATCTTTGTACTCATACTCATCTCCTTTGATCGCTATGTGGCTATTTGC
Erinaceus_europaeus|13540           ------------------------------------------------------------
Bos_taurus|28568                    GGTGAAGTGGGCATCATCCTTCTCACTGTGATGGTCTATGACTGCTCCATGGCCATCTAT
Dasypus_novemcinctus|13523          GTTAGTGTGGGGATTATCCTTCTC---GCTATGGCCTATGACTGCTACGTGGCCATATGT
Mus_musculus|22888                  GGTGGGGTAGAGATCATCCTTCTCATCGTGATGGCCTATGACAGCTATGTGGCTATCTGT
Rattus_norvegicus|22406             GGTGGGGTAGAGATCATCCTACTCATTGTGATGGCCTATGACCGCTATGTGGCTATCTGT
Mus_musculus|22846                  GGTGGGGTGGGCATCATCCTTCTCATTGTTATGGCCTATGATCGCTATGTCGCCATCTGT
Rattus_norvegicus|22366             GGTGGAGTGGGCATCATCCTTCTCATTGTGATGGCCTATGATCGCTATGTTGCCATCTGT
Ochotona_princeps|15463             GGTGGCGTGGCGATCATCCTTCTCATCGTGATGGCCTATGACCGCTACGTGGCCATCTGT
Homo_sapiens|17660                  GGTGGTGTGGGGATCATCCTCCTCACTGTGATGGCCTATGACCGCTACGTGGCCATCTGT
Pan_troglodytes|8167                GGCGGTGTGGGGATCATCCTCCTCACTGTGATGGCCTATGACCGCTACGTGGCCATCTGT
Otolemur_garnettii|13504            GGTGGTGTGGGGATGATTCTTCTCATTGTGATGGCCTATGACCGCTACGTGGCCATCTGT
Microcebus_murinus|2797             GGTGGTGTGGGGATCATCCTGCTCATCGTGATGGCCTATGACCGCTACGTGGCCATCTGT
Microcebus_murinus|5059             GGTGGTGTGGGGATCATCCTGCTCATCGTGATGGCCTATGACCGCTACGTGGCCATCTGT
Microcebus_murinus|10664            GGTGGTGTGGGGATCATCCTGCTCATCGTGATGGCCTATGACCGCTACGTGGCCATCTGT
Tupaia_belangeri|13856              GGTGGTGCAGGCATCATCCTGCTCATTGTGATGGCCTATGACCGTTATGTGGCCATCTGT
Choloepus_hoffmanni|6189            GCTGGTGTGGGGATCATCTTTCTCATTGTTATGGCCTATGACCGCTACGTGGCCATCTGT
Choloepus_hoffmanni|10987           GGTAGTGTGGGGATCATCCTTCTCACTGTTATGGCCTATGACCGCTATGTGGCCATCTGT
Felis_catus|6208                    GGTGGTGTGGGGGTCATCCTTCTCGTCGTGATGGCCTATGACCGCTACGTGGCCATCTGT
Canis_familiaris|28898              GGTGGTGTGGGGATCATCCTCATC---GTGATGGCCTATGACCGCTACGTGGCCATCTGT
Canis_familiaris|28666              GGTGGTGTGGGGATCATCCTCATC---GTGATGGCCTATGACCGCTACGTGGCCATCTGT
Canis_familiaris|8394               GGTGGTGTGGGGATCATCCTTCTCATCGTGATGGCCTATGACCGCTACGTGGCCATCTGT
Canis_familiaris|8407               GGTGGTGTGGGGATCATCCTTCTCATCGTGATGGCCTATGACCGCTATGTGGCCATCTGT
Loxodonta_africana|10342            GGTGGGGTGTCAATCATCCTTCTCATCGTGATGGCCTATGATCGCTACGTGGCCATCTGT
Loxodonta_africana|7429             GGTGGGGTGTCGATCATCCTTCTCATTGTGATGGCCTATGACCGCTACCTGGCCATCTGT
Loxodonta_africana|8250             GGTGGGGTGTCAATCATCCTTCTCATTGCGATGGCCTATGACCGCTACATGGCCATCTGT
Loxodonta_africana|10841            GGTGGAGTGTCAATCATCCTTCTCATTGTGATGGCCTATGACCACTATGTGGCCATCTGT
Loxodonta_africana|7347             GGTGGGGTGTCGATCATCCTTCTCATTGTGATGGCCTATGACCGCAATGTGGCCATCTGT
Loxodonta_africana|15374            GGTGGGGTGTCGATCATCCTTCTCATTGTGATGGCCTATGACCGCTATGTGGCCATCTGT
Loxodonta_africana|8254             GGTGGGGTGTCGATCATCCTTCTCATTGTGATGGCCTATGACCGCTATGTGGCCATCTGT
Loxodonta_africana|10347            GGTGGGGTGTCAATCATCCTTCTCATTGTGATGGCCTATGACCGCTATGTGGCCATCTGT
Dasypus_novemcinctus|5504           GGTGGAGCTGAGGTTATCTTGCTCTCGGTGATGGCTTATGACCGCTATATGGCCATTTGC
Dasypus_novemcinctus|6826           AGTGGAGCTGAGCTCATTCTCCTCACAGTGATGGCCTATGACCGCTACCTGGCTATCTGC
Equus_caballus|5245                 GGAGGAGTTGAGATCATCTTGCTCACAGTGATGGCCTATGACCACTATGTGGCCATCTGC
Echinops_telfairi|11116             GGAGGTGTTGAGATCCTTCTTCTCACGGTGATGGCTTATGACTGCTATGTGGCCATCTGC
Echinops_telfairi|11654             GGAGGTGTTGAGATCCTTCTCCTCATGGTGATGGCTTATGACCGCTATGTGGCCATCTGC
Echinops_telfairi|10565             GGAGGCGTTGAGATCCTTCTACTCGTTGTGATGGCTTATGACCGCTATGTGGCCATCTGC
Vicugna_pacos|1925                  NNNNNNNNNNNNNNNNNNNNNNTCACGGTGATGGCCTATGACCGCTACGTGGCCATCCAC
Dasypus_novemcinctus|6644           GGAGGAGCTGAGATCATCCTGCTCACAGTGATGGCCTATGACCGCTACGTGGCCATCTGC
Spermophilus_tridecemlineatus|10360 GGGGGAGTTGAGATCATTCTGCTCACAGCGATGGCCTATGACCGCTATGTGGCCATCTGC
Cavia_porcellus|23431               GGAGGAGTGGAGATTCTCCTGCTCACAGTTATGGCTTATGACCGCTACGTGGCCATCTGC
Callithrix_jacchus|41201            GCGGGAGTTGAGATCATTCTGCTCGTGGTGATGGCCTATGACCGATACGTGGCCATCTGC
Mus_musculus|22929                  GGTGGAGTTGAGATCATCCTGCTCACAGCGATGGCCTATGACCGCTATGTGGCCATCTGT
Rattus_norvegicus|22435             GGTGGAGTGGAGATCATCCTGCTCACAGCCATGGCCTATGACCGCTATGTGGCCATCTGC
Equus_caballus|5271                 GGGGGAGTTGAGATCATCCTGCTCACAGTAATGGCCTATGACCGCTATGTGGCCATCTGT
Sorex_araneus|6771                  GGAGGAGTTGAAATCATCCTGCTCACCGTGATGGCCTATGACCGCTACGTGGCCATCTGC
Sus_scrofa|9827                     GGAGGAGTTGAGATTATCCTGCTGACGGTGATGGCCTATGACCGCTACGTGGCCATCTGC
Loxodonta_africana|10361            GGAGGAGTTGAGATCCTCTTACTCACAGTAATGGCCTATGACCGATACGTGGCCATCTGC
Homo_sapiens|17605                  GGGGGAGTTGAGATCATTCTGCTCGTGGTGATGGCCTATGACTGCTATGTGGCCATCTGC
Pan_troglodytes|6828                GGGGGAGTTGAGATCATTCTGCTCGTGGTGATGGCCTATGACTGCTATGTGGCCATCTGC
Canis_familiaris|8422               GGGGGAGTTGAGATTATCCTGCTCACAGTGATGGCCTATGACCGCTACGTGGCTATCTGC
Oryctolagus_cuniculus|1850          GGGGGAGTTGAGATCATCTTACTCACAGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Otolemur_garnettii|13491            GGGGGAGTGGAGATCATCCTGCTGGTGGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Microcebus_murinus|9568             GGGGGAGTTGAGATCATCCTGCTCGTGGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Dasypus_novemcinctus|3289           GGGGGATGTGAGGTTATCCTGCTCACGGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Dasypus_novemcinctus|6897           ---------------------------GTGATGGCCTATGACCGCTACGTGGCCATCTGC
Dasypus_novemcinctus|15676          GGTGGAGTTGAGATCATCCTGCTCACAGCGATGGCTTATGATCGCTATGTGGCCATTTGC
Choloepus_hoffmanni|6218            GGTGGAGTTGAGATCATTCTGCTCATGGTGATGGCCTATGACCGCTACGTGGCCATCTGC
Spermophilus_tridecemlineatus|12911 GGAGGTGCAGAGGTCATTCTGCTTACAGTGATGGCCTATGACCGCTATGTAGCCATCTGC
Bos_taurus|29294                    GGAGGTGCTGAGATAATCCTGCTCACTGTGATGGCCTATGACTGCTATGTGGCCATCTAC
Bos_taurus|27626                    GGAAGTGCTGAGGCCATCCTGCTCACTGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Sus_scrofa|11423                    GGAGGTGCTGATATCATCCTGCTTACCGTAATGGCCTACGACCGCTATGTGGCCATCTGC
Cavia_porcellus|21650               GGAGGTGCTGAGGTCATCCTGCTGACTGTGATGGCCTATGACCGCTATGTGGCCATTTGC
Rattus_norvegicus|22372             GGAGGAGCTGAGATTATCCTGCTAACTGTGATGGCTTATGATCGCTATGTAGCCATCTGT
Rattus_norvegicus|22374             GGAGGAGCTGAGGTTATCTTGCTTACTGTGATGGCTTATGACCGCTATGTAGCCATTTGT
Bos_taurus|29733                    GGAGGTGCTGATGTCATCCTGCTCACTGTGATGGCCTATGACCGCTACGTGGCCATCTGC
Sus_scrofa|11396                    GGAGGTGCAGATGTCATCCTACTTACTGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Sus_scrofa|11395                    GGAGGGGCTGATATCATCCTGCTGACCATGATGGCCTATGACCGTTATGTGGCCATCTGC
Sus_scrofa|11400                    GGAGGGGCTGATATCATCCTGCTGACTGCGATGGCCTATGACCGCTATGTGGCCATCTGC
Sus_scrofa|11399                    GCAGGAGCTGATATCATCCTGCTGACCGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Choloepus_hoffmanni|258             GGAGGTGCTGAGATCATTGTGCTTACTGTGATGGCCTATGACCGCTATGTGGCCATATGC
Monodelphis_domestica|24688         GGAGGTGCTGAAGGCATCCTGCTTACAGTAATGGCCTATGACCGCTATGTGGCAATTTGC
Monodelphis_domestica|24689         GGAGGTGCTGAGGTCATCCTGCTCACAGTAATGGCCTATGACCGCTATGTGGAAATTTGC
Monodelphis_domestica|24691         GGAGGTGCTGAGGTCATCCTGCTCACAGTAATGGCCTATGACCGCTATGTGGCAATTTGC
Callithrix_jacchus|41212            GGAGGTGTTGAGGTTATCCTACTTACTGTAATGGCCTATGACCGATATGTGGCCATCTGC
Homo_sapiens|17635                  AGAGGTGTTGAGGTCATCCTACTTACTGTAATGGCCTATGACCACTATGTGGCCATCTGC
Equus_caballus|5278                 GGAGCTGCTGAAATCATCCTGCTCACTGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Canis_familiaris|8369               GGAGGTGCTGATGTCATCCTGCTTACTGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Canis_familiaris|8352               GGAGGTGCTGATGTCATCTTGCTTACTGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Canis_familiaris|8363               GGAGGTGCTGATGTCATCCTGCTTACTGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Bos_taurus|6622                     GGAGGAGCTGAGGGCATCCTTCTTACTGTGATGGCCTATAACCGCTATGTGGCCATCTGC
Mus_musculus|22922                  GGAGGTGCTGAAATCATCCTGCTGACAGTAATGGCCTATGACCGCTATGTGGCCATCTGC
Rattus_norvegicus|22432             GGAGGTGCTGAAATCATCCTGCTGACAGTAATGGCCTATGACCGCTATGTGGCCATCTGC
Bos_taurus|6627                     GGAGGTGCTGAAGTCATCCTGCTTACTGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Sus_scrofa|11415                    GGAGGTGCTGAGGTCATCCTGCTGACTGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Sus_scrofa|11413                    GGAGGTGTAGAGATCATCCTGCTGACTGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Sus_scrofa|9826                     GGAGGTGCTGAGGTCATCCTGCTGACTGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Sus_scrofa|11406                    GGAGGTGCTGAGGTCATCCTGCTGACTGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Sus_scrofa|11409                    GGAGGTGCTGAGGTCATCCTGCTGACTGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Erinaceus_europaeus|4256            GGAGGCGCTGAGGTCATCCTGCTCACTGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Procavia_capensis|7897              GGAGGTGCTGAGGTCATCCTTCTTACTGTGATGGCTTATGACCGTTATGTGGCCATCTGC
Loxodonta_africana|10358            GGAGGTGCTGAGGTCATCCTTCTTACTGTGATGGCTTATGACCGTTATGTGGCCATCTGC
Echinops_telfairi|7364              GGCGGCACGGAAGTCATCCTGCTAACTGTGATGGCTTATGACCGCTATGTGGCCATCTGC
Loxodonta_africana|10359            GGAGGTGCTGAAGGAATCCTTCTTACTGTGATGGCTTATGATCGCTATGTAGCCATCTGC
Procavia_capensis|11271             GGGGGTGCTGAGGGTATCCTTCTTACAGTGATGGCTTATGATCACTATGTGGCCATCTGC
Mus_musculus|22924                  GGAGGTGCTGAGGGCATCCTGCTTACTGTGATGGCCTATGACCGCTATGTGGCAATCTGC
Oryctolagus_cuniculus|1855          GGAGGTGCTGAAGTCATCTTGCTAACTGTGATGGCTTATGACCGCTATGTGGCCATCTGC
Homo_sapiens|17643                  GGAGGTGCAGAGGGCATCCTACTTACTGTGATGGCCTATGACCACTATGTGGCCATCTGC
Oryctolagus_cuniculus|1854          GGAGGCACAGAAGGCATTCTACTTACTGTGATGGCCTATGACCGCTACGTGGCCATCTGC
Callithrix_jacchus|41203            GGAGGTGCGGAGGGCATCCTACTTACTGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Spermophilus_tridecemlineatus|2389  GGAGGCTCTGAGATAATTCTGCTTACAGTGATGGCTTATGACCGCTATGTGGCCATCTGC
Felis_catus|31463                   GGAGGTGCTGAAGGCATCCTGCTTACTGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Canis_familiaris|8420               GGAGGTGCTGAAGGCATCCTGCTTACTGTGATGGCCTATGACCGTTATGTGGCTATCTGC
Canis_familiaris|8433               GGAGGTGCTGAAGGCATCCTGCTTACTGTGATGGCCTATGACCGTTATGTGGCTATCTGC
Macropus_eugenii|12245              GGTGGTGCTGAGATCATCCTGCTCACAGTCATGGCCTATGACCGCTATGTGGCCATCTGT
Ornithorhynchus_anatinus|16857      GGAGGTGCTGAGATCCTCCTCCTCACAGTGATGGCCTACGATCGCTACGTGGCCATCTGT
Echinops_telfairi|4282              GGTGCTGCTGAGATCATCCTGCTGACCGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Rhesus_macaque|12555                GGTTCTGCTGAGATTGTGCTTCTCACGGTGATGGCCTATGACCGCTATGTGGCCATTTGT
Loxodonta_africana|10357            GGAGCTGCTGAGATCATCCTGCTGACGGTGATGGCCTATGACCGCTACGTGGCCATCTGC
Loxodonta_africana|23520            GGTGCTGCTGAGATCATCCTGCTGACGGTGATGGCCTATGACCGCTACATGGCCATCTGC
Loxodonta_africana|23521            GGTGCTGCTGAGATCATCCTGCTGACGGTGATGGCCTATGACCGCTACGTGGCCATCTGC
Loxodonta_africana|10356            GGTGCCGCTGAGATCATCCTGCTGACAGTGATGGCGTATGACCACTACGTGGCCATCTGC
Choloepus_hoffmanni|440             GGTGCAGCTGAGATTATCCTGCTCACAGTGATGGCCTATGACTGCTATGTGGCCATCTGC
Oryctolagus_cuniculus|1856          GGTGCTGCTGAGATCATCCTTCTCACGGTGATGGCCTATGACCGCTATGTGGCCATCTGT
Mus_musculus|22921                  GGGGCTGCTGAGATTATTCTTCTCACAGTGATGGCCTACGACCGCTATGTGGCCATCTGT
Rattus_norvegicus|22431             GGGGCTGCTGAGATTATTCTGCTCACAGTTATGGCCTACGACCGCTATGTGGCCATCTGC
Erinaceus_europaeus|4844            GGTGCTGCTGAGATCATCCTGCTCACAGTCATGGCCTATGACCGTTATGTGGCCATTTGC
Erinaceus_europaeus|2413            GGTGCTGCTGAGATCATCCTGCTCACAGTCATGGCCTATGACCGTTATGTGGCCATTTGC
Sus_scrofa|11416                    GGTGCTGCTGAGATTATCCTTCTCACGGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Felis_catus|1160                    GGTGCTGCTGAGATTATCCTTCTCACAGTAATGGCCTATGACCGTTATGTGGCCATCTGC
Canis_familiaris|8432               GGTGCTGCTGAGATAATCCTCCTTACAGTAATGGCCTATGACCGCTATGTGGCCATCTGC
Canis_familiaris|8419               GGTGCTGCTGAGATTATCCTCCTTACAGTAATGGCCTATGACCGCTATGTGGCCATCTGC
Monodelphis_domestica|24687         GGTGGTGCTGTGATCATCCTGCTCACAGTCATGGCTTATGACCGCTATGTGGCAATTTGC
Macropus_eugenii|10461              GGTGGTGCTGAGATCATCCTGCTCACAGTCATGGCCTATGACCGCTATGTTGCAATTTGC
Monodelphis_domestica|24684         GGTGGTGCTGAGATCATCTTGCTAACAGTCATGGCATATGACCGTTATGTAGCCATATGC
Cavia_porcellus|7144                GGTGCTACTGAGATCATCCTGCTGATGGCGATGGCCTATGACCGCTATGTGGCCATCTGT
Homo_sapiens|17636                  GGTGCTACTGAGATCATCCTGCTGACAGTGATGGCCTGTGACTGCTATGTGGCCATCTGC
Pan_troglodytes|6844                GGTGCTACTGAGATCATCCTGCTGACAGTGATGGCCTGTGACTGCTATGTGGCCATCTGC
Sus_scrofa|11414                    GGTGCTACTGAGATTATCCTACTGATGGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Erinaceus_europaeus|4881            GGTGCCACTGAGATCATCTTGCTAACAGTGATGGCCTATGACCGCTATGTAGCCATCTGC
Otolemur_garnettii|1429             GGAGCTGCAGAGATCATCCTGCTGACGGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Microcebus_murinus|3048             GGTGCTACTGAGATCATCCTGCTGATAGTAATGGCCTATGACCGCTATGTGGCCATCTGC
Bos_taurus|6619                     GGTGCTACTGAGATCATCCTGCTCACAGAGATGGCCTATGACCACTACGTGGCCATCTGC
Bos_taurus|6624                     GGTGCTACTGAGATCATCCTGCTCACAGAGATGGCCTATGACCACTACGTGGCCATCTGC
Procavia_capensis|8766              GGTGGTACTGAGATCATCTTGCTGACAGTGATGGCCTATGACCGCTACGTGGCCATCTGC
Loxodonta_africana|10360            GGTGCTACTGAGATCATCCTGTTGACAGTGATGGCCTATGACCGCTATGTGGCCATCTGT
Vicugna_pacos|1942                  GGTGCTACTGAGATCATCCTGCTGATGATAATGGCCTATGACCGCTACGTGGCCATCTGC
Canis_familiaris|8421               GGTGCTACAGAGATCATCTTGCTGACAGTGATGGCCTATGATCGCTATGTGGCCATCTGC
Felis_catus|6205                    GGTGCTACTGAGATCATCCTGCTCACAGTAATGGCCTATGATCGCTATGTGGCCATCTGC
Ochotona_princeps|11681             GGTGCCACTGAGATCCTTCTGCTGACAGCGATGGCCTATGACCGCTACGTGGCCATCTGC
Rattus_norvegicus|22434             GGTGCTACGGAGATCATCCTGTTGACAGTGATGGCTTATGACCGCTATGTGGCCATCTGC
Mus_musculus|22917                  GGTGCTACTGAGATCATCCTGTTGACAGTGATGGCTTATGACCGCTATGTGGCCATCTGC
Mus_musculus|22928                  GGTGCTACTGAGATCATCCTATTGACAGTGATGGCCTATGACCGCTATGTGGCCATCTGC
Oryctolagus_cuniculus|1853          GGTGCTACGGAGATCATTCTCCTGACAGCCATGGCCTACGACCGCTACGTGGCCATCTGC
Oryctolagus_cuniculus|1852          GGTGCTACGGAGATCATTCTCCTGACAGCCATGGCCTACGACCGCTACGTGGCCATCTGC
Ornithorhynchus_anatinus|16863      GCTGGGGCTGAGATAGTCCTTCTCTTGGCCATGGCCTATGACCGGTACGTGGCCATCTGT
Ornithorhynchus_anatinus|16862      GCCGGGGCTGAGATCATCCTCCTCATGGTGATGGCCTATGACCGCTATGTGGCCATCTGT
Ornithorhynchus_anatinus|16865      GCCGGGGCCGAGATCGTCCTCCTCATGGCGATGGCCTACGATCGCTATGTGGCCATCTGT
                                                                                                

Procavia_capensis|16277             AAGCCCCTGAGATACACAACCATCATGAGCCAGAATGTCTGTGATGCACTGTTGAATCTG
Erinaceus_europaeus|13540           ------------------------------------------------------------
Bos_taurus|28568                    AAGCCTCTTCACTATGTGACCATCATGAGGCCTTGGATGTGCTGCCTTTTGCTGGGAGTG
Dasypus_novemcinctus|13523          AAGCCCCTGCACTACCAGACCATCATGAGTCCTCAGATGTGCTGTCTGCTGCTGGGGGCA
Mus_musculus|22888                  AAACCTCTACACTACACGACCATTGTTAGTCCCCGAGTATGCTGGCTGATGGTGGGAGGT
Rattus_norvegicus|22406             AAACCTCTGCACTACAGGACAATTGTTAGTCCTAGAATGTGCTGGCTGATGGTGGGAGGG
Mus_musculus|22846                  AAGCCTCTGCACTACGTGAAAATGATGACTCCTAGGGTGTGCTGCTTGATGGTAGGAGGA
Rattus_norvegicus|22366             AAGCCTCTGCACTACACAAAAATCATGACTCCTAACGTGTGCTGCTTGATGGTAGGAGGG
Ochotona_princeps|15463             AAGCCCCTGCACTACACAACCACCATGAGTCCTCGAGTGTGCTACTTTATGGTGGGAGGG
Homo_sapiens|17660                  AAGCCCCTGCACTACACGATCATCATGAGTCCACGGGTGTGCTGCCTAATGGTAGGAGGG
Pan_troglodytes|8167                AAGCCCCTGCACTACACGATCATCATGAGTCCACGGGTGTGCTGCCTAATGGTAGGAGGG
Otolemur_garnettii|13504            AAGCCCCTGCACTACACCAGCATCATGAGACCCAAGATGTGCCACCTGCTCGTGGGAGGG
Microcebus_murinus|2797             AAGCCCCTGCACTACACGAGCATCATGCGTCCTAGCGTGTGCCGCCTGATGGTGGCAGGG
Microcebus_murinus|5059             AGGCCCCTGTACTACACGAGCATCATGCGTCCTAGCGTGTGCCGCCTGATGGTGGCAGGG
Microcebus_murinus|10664            AGGCCCCTGCACTACACGAGCATCATGCGTCCTAGCGTGTGCCGCCTGATGGTGGCAGGG
Tupaia_belangeri|13856              AAGCCCCTGCACTACATGGTCATCATGAGTCCTCGGGTGTGCTGGCTGATGGTGGGAGGG
Choloepus_hoffmanni|6189            AAGCCCCTGCACTATCTGACCATCGTGAGTCCTCGGGTGTGCTGCCTGCTGTCGGGAGCA
Choloepus_hoffmanni|10987           AAGCCTCTGCACTACCAGACCATCATGAGTCCTCAGGTGTGCTGCCTGCTGCTGGGAGCA
Felis_catus|6208                    AAGCCCCTGCACTACCCGAGCATCATGCACCCTCGGGTGTGCCGCCTGCTGCTGGGAGGC
Canis_familiaris|28898              AAGCCCCTGCACTACTCGACCATCATGAGCCCTCAGATGTGCTGCCTGCTGCTGGGAGGG
Canis_familiaris|28666              AAGCCCCTGCACTACTCGACCATCATGAGCCCTCAGATGTGCTGCCTGCTGCTGGGAGGG
Canis_familiaris|8394               AAGCCCCTGCACTACTTGACCATCATGAGCCCTCGGATGTGCTGCCTGCTGCTGGGAGGG
Canis_familiaris|8407               AAGCCCCTGCACTACATGACCATCATGAGCCCTCGGATGTGCTGCCTGCTGCTGGGAGGG
Loxodonta_africana|10342            AAGCCCCTGCACTACATGACTATCATGAAGTCTCAGGTGTGCTGCCTGCTGCTGGGAGGG
Loxodonta_africana|7429             AAGCCCCTGCATTACATGACCATCATGAGTCCTTGGGTGTGCCGCCTGCTGCTGGGAGGG
Loxodonta_africana|8250             AAGCCCCTGCATTACGTGACTGTCATGAGTCCTCGGGTGTGCCGCCTGCTGCTGGGAGGG
Loxodonta_africana|10841            AAGCCCCTGCACTACAGGACCATCATGAGTTCTCGGATGTGCTGCCTGCTGCTGGGAGGG
Loxodonta_africana|7347             AAGCCCCTGCACTACATGACTACCACGAGTCCTCGGGTGTGCTGCCTGCTGCTGGGAGGG
Loxodonta_africana|15374            AAGCCCCTGCACTACATGACTACCATGAGTCCTCGGGTGTGCTGCCTGCTGCTGGGAGGG
Loxodonta_africana|8254             AAGCCCCTGCACTACATGACTACCATGAGTCCTCGGGTGTGCTGCCTGCTGCTGGGAGGG
Loxodonta_africana|10347            AAGCCCCTGCACTACATGACTACCATGAGTCCTCGGGTGTGCTGCCTGCTGCTGGGAGGG
Dasypus_novemcinctus|5504           AGGCCTCTGTACTACATGATAAAAATGAATTGGCGTGTGTGTGTCTGTTTGGTGGTCCTG
Dasypus_novemcinctus|6826           AGGCCCCTGCACTACATGATCAAAATGAACTGGCAGATGTGTGGTCTCTTGGTGGCAGTG
Equus_caballus|5245                 AAGCCCCTGCACTACACAATCACAATGAACAGGCGAGTGCGTGGCTTCCTGGTGGCCATC
Echinops_telfairi|11116             AAACCCCTGCACTATATGACCACAATGAACCGACACATGTGTGGTCTCCTGGTGGCCCTG
Echinops_telfairi|11654             AAACCCCTGCACTATATGATCACAATGAATCGACACATGTGTGGTCTCCTGGTGGCCCTG
Echinops_telfairi|10565             AAACCCCTGCACTATATGATCACAATGAACCGACACATGTGTGGTCTCCTGGTGGCCCTG
Vicugna_pacos|1925                  AAGCCCCTGCACTACGTGATCACAATGAATAGGCACATGTGTGGCCTCCTGGTGGCCCTG
Dasypus_novemcinctus|6644           AGACCCCTGCACTACATGATCATAATGAACCAACGGGTATGTCGTCTCCTGGTGGTCATG
Spermophilus_tridecemlineatus|10360 AAGCCCCTGCACTATATGAGCACAATGAACAGGCGAGTATGTGGCCTCCTGGTGTCTGTG
Cavia_porcellus|23431               AAGCCCCTGCATTACATGATCACAATGAGCAGGCGTGTGTGTGGCCTCCTGGTGTCCATG
Callithrix_jacchus|41201            AAGCCCCTGTACTATCTGATCACAATGAACAGGCAGGTGTGTGACCTCCTGGTGGCCATG
Mus_musculus|22929                  AAGCCACTACACTACATGATCACAATGAACAGGAGAGTATGTGGCTTCCTGGTTTCCACG
Rattus_norvegicus|22435             AAGCCCCTCCACTACATGATCACAATGAATAGGAGAGTATGTGGATTCCTGGTTTCCATG
Equus_caballus|5271                 AAGCCATTGCACTACACAATCACAATGAACAGGCAAGTGTGTGGCCTCCTGGTGGTCCTG
Sorex_araneus|6771                  AAGCCCCTGCATTATATGATCATCATGAACAGGCGGGTATGTGGCCTTCTTGTGGTCCTG
Sus_scrofa|9827                     AGGCCCCTGCACTACATGATTACCATGAACAGGCAAGTGTGTGGCCTTCTGGTGGCCCTG
Loxodonta_africana|10361            AAACCCCTGCACTACATGATCACAATGAACCGGCAGGTATGTGGCCTCCTGGTGGCCGTG
Homo_sapiens|17605                  AAGCCCCTGTACTACCTGATCACAATGAACAGGCAGGTATGTGGCCTCCTGGTGGCCATG
Pan_troglodytes|6828                AAGCCCCTGTACTACCTGATCACAATGAACAGGCAGGTATGTGGCCTCCTGGTGGCCATG
Canis_familiaris|8422               AAGCCCCTACACTACATGATCACAATGAACAGGCAAATGTGTGCCAACTTGGTGGCCGTG
Oryctolagus_cuniculus|1850          AAGCCCCTGCACTACATGACCACAATGAACAGGCAGATGTGTGGCCTCTTGGTGGCCCTG
Otolemur_garnettii|13491            AAACCTCTGCACTACATGATCACAATGAACAGGCAGGTGTGTGGCCTCCTGGTGGCCACG
Microcebus_murinus|9568             AAACCCCTACACTACATGATCACAATGAACAGACAGGTGTGCAGCCTCCTGGTGGCTATG
Dasypus_novemcinctus|3289           AGGCCCCTGCACTACATGATCACAATGAACAGGCGAGTGTGTGTTCTCCTGATGGTTGTG
Dasypus_novemcinctus|6897           AGGCCTTTGCACTACATGATCATAATGAACCGGAGGTTGTGTGGCATTCTGGTGGTCATG
Dasypus_novemcinctus|15676          AAGCCCCTGCATTACATGGTAACAATGAACCGGCGGGTATGTAGTCTCCTAGTGGTTGTG
Choloepus_hoffmanni|6218            AGGCCCCTGCACTACATGACCACAATGAACCGGCGGGTGTGTGGCTTCCTGGTGGTTGTG
Spermophilus_tridecemlineatus|12911 AAGCCCTTGCACTATACAACCATCATGAACCGGAAAGTATGTCCCCTACTAATGGGAGTG
Bos_taurus|29294                    AAGCCCTTGCACTATACAACCATCATGAACTGGTGGGTGTGTGGGCTCCTAGTGGGAGTG
Bos_taurus|27626                    AAGCCCTTGCACTACACAAGCATCGTGAACTGGAGGGTGTGTTGGCTGCTAATTGGAGTA
Sus_scrofa|11423                    AAGCCCTTGCACTATACAAACATCATGAACTGGCACGTGTGTTGGCTACTAGTGGGAGTG
Cavia_porcellus|21650               AAGCCCTTGCACTATACAGCCATCATGAAGCGGAGAGTGTGCAGCCTGCTAATAATAGTA
Rattus_norvegicus|22372             AAACCCTTGCACTATGCAACCATCATGAACCGACAACTCTGTAACATCCTTGTGGGTGTG
Rattus_norvegicus|22374             AAACCCTTGCACTATGCAACCATCATGAACCGACAACTCTGTAACATCCTTGTAGGTGTG
Bos_taurus|29733                    AAGCCCTTGCACTATACGACCATCATGAATCGGCGGCTGTGTGGACTGCTAGTGGGAGTG
Sus_scrofa|11396                    AAGCCCTTGTACTATGCAACCATCATGAATCGGCAGCTATGTGGCCTGCTGGTGGGAGTG
Sus_scrofa|11395                    AAGCCCTTGTACTATGCAACCATCATGAATCGGCAGCTATGTGGCCTGCTGGTGGGAGTG
Sus_scrofa|11400                    AAGCCCTTGTACTATGCAACCATCATGAATCGGCAGCTATGTGGCCTGCTGGTGGGAGTG
Sus_scrofa|11399                    AAGCCCTTGTACTATGCAACCATCATGAATCGGAGGCTATGTGGCCTGCTGGTGGGAGTG
Choloepus_hoffmanni|258             AAGCCCTTGCACTATACAACCATCATGAACCAGCGGCTATGTGGCTTGTTAGTGGGAGTG
Monodelphis_domestica|24688         AAGCCTCTGCACTACATGACCATCATGAATTGGCGGGTACGTGGCATCTTGGTTGGTGTA
Monodelphis_domestica|24689         AAGCCTCTGCACTACATGACCATCATGAATTGGAAGGTGCGTGCCATCTTGATGGTTGTG
Monodelphis_domestica|24691         AAGCCTCTGCACTACATGACCATCATGAATTGGAGGGTGCGTGGCATCTTGATGGTTGTG
Callithrix_jacchus|41212            AAGCCCTTGCACTATACCACCATCATGAAGCAGTGTGTGTGTAGCCTGCTAGTCAGTGTG
Homo_sapiens|17635                  AAGCCCTTGCACTATACCACCGTCATGAAGCAGCATGTTTGTAGCCTGCTAGTGGGAGTG
Equus_caballus|5278                 AAGCCCTTGCGCTATACATCCATCATGAACTGGCGGATGTGTGGCCTGCTAATGAGAGTG
Canis_familiaris|8369               AAGCCACTGCACTACATGACCATCATGAATCGGCGGCTATGTGGCCTGCTCATGGCAGTG
Canis_familiaris|8352               AAGCCACTGCACTACATGATCATCATGAATCGGCAGGTGTGTGGCTTGCTCATGGCAGTG
Canis_familiaris|8363               AAGCCACTGCACTACATGACCATCATGAATCGGCAGGTGTGTGGCTTGCTCATGGCAGTG
Bos_taurus|6622                     AAGCCCTTGCACTATACAAGCATCATGAATCGGTGGGTGTGTGGGCTGCTAGTGGGAGTG
Mus_musculus|22922                  AAACCCCTTCATTATGCAACGATCATGAGTCGAAGACTATGTAGCCTGCTAGTGGGAGTG
Rattus_norvegicus|22432             AAACCCCTCCATTATGCAACCATCATGAGTCGAAGACTATGCAGCCTGCTAGTAGGAGTG
Bos_taurus|6627                     AAGCCCTTGCACTATACAAGCATCATGAACTGGCAGGTGTGCGGGCTGCTGGTGGGAGTG
Sus_scrofa|11415                    AAGCCTTTGCACTATACAACCATCATGAATTGGAGAGTGTGTGGGCTACTACTGGGAGTG
Sus_scrofa|11413                    AAGCCTTTGCACTATACAACCATCATGAATCGCCGAGTGTGTCGTCTTCTCATGGGAGTG
Sus_scrofa|9826                     AAGCCTTTGCACTACATGACTATCATGAATCGGCGAGTGTGTGGCCTGCTGGTGGGAGTG
Sus_scrofa|11406                    AAGCCTTTGCACTACATGACCATCATGAATCGGCGAGTGTGTGGCCTGCTGTTGGGAGTG
Sus_scrofa|11409                    AAGCCTTTGCACTACATGACCATCATGAATCGGCGAGTGTGTGGCCTGCTGGTGGGAGTG
Erinaceus_europaeus|4256            AAGCCTTTACACTATACAACGATCATGAACAGGCAGATGTGTGGCTTACTAGTGGGAGTG
Procavia_capensis|7897              AAGCCCTTGCACTACACAACCATCATGAACTGGAGAGTGTGTGGTCTGCTCATTGGAGTC
Loxodonta_africana|10358            AAGCCCTTGCACTACACAACTATCATGAACCGGAGAGTGTGTGGTCTGCTAATTGGAGTC
Echinops_telfairi|7364              AAGCCTTTGCACTACACAACCATCATGAACCGGAGAGTGTGTAGCCTGCTAATAGGAGTC
Loxodonta_africana|10359            CAGCCCTTGCACTACACAACTATCGTGAACAAGAGAGTATGTGGCCTGCTAGTGGGAGTC
Procavia_capensis|11271             AAGCCCTTGCATTACACAACGATCATGAACCGGAGAGTATGCGGTCTGCTAGTAGGAGTA
Mus_musculus|22924                  AAGCCCTTACACTATACAACCATCATGAGCAGAAGGGTATGTGGCCTGCTGGTAGGAGTG
Oryctolagus_cuniculus|1855          AAGCCCTTGCACTACACAACCATCATGAACCGACGGGTGTGTGGGCTCCTAGTAGGGGTG
Homo_sapiens|17643                  AAGCCCTTGCACTATATGACTATCATGAACCAGTGTGTGTGTGCCCTGCTAATGGGAGTG
Oryctolagus_cuniculus|1854          AAGCCCTTGCACTACACAACCATCATGAACCGACGGGTGTGTGGCCTTCTAGTGGCAGTT
Callithrix_jacchus|41203            AAGCCCCTGCACTATATGACTATCATGAACCGGCATGTGTGTGCCCTGCTAATGGGAGTG
Spermophilus_tridecemlineatus|2389  AAGCCCTTGCACTACACAACCATCATGAACCGACGTGCGTGTGGCCGTCTAATGGGAGTA
Felis_catus|31463                   AAGCCATTGCACTACATGACCATCATGAATCGGCGGGTGTGTGGCCTGTTAATGGGAGTG
Canis_familiaris|8420               AAGCCACTGCACTACACAACCATCATGAATCGGCGAGTGTGTGGCCTGTTAATGGGAGTG
Canis_familiaris|8433               AAGCCACTGCACTACACAACCATCATGAATCGGCGAGTGTGTGGCCTGTTAATGGGAGTG
Macropus_eugenii|12245              AAACCTCTGCACTACATGACCATCATGAGCCAGAATTTGTGTGTCATGTTAGTAGGGATG
Ornithorhynchus_anatinus|16857      AAGCCTCTGCACTACCCGACCATTGTCAATAGGCGGTTATGCAGGCTGCTGGTGGGGGTC
Echinops_telfairi|4282              AAACCCCTGCACTACATGACCATCATGAGCCACAGGCTGTGTATTCTCCTGGTGGGCGTG
Rhesus_macaque|12555                AAACCCCTGTACTACATGACCATCATGAACCAACAGGTGTGTAGATTCCTTGTGGGAGCA
Loxodonta_africana|10357            AAACTCCTGCACTACATGACCATCATGAGCCACAGGCTGTGCATTCTTCTGGTGAGAATA
Loxodonta_africana|23520            AAACCCCTGCACTACATGACCATCATGAGCCACAGGCTGTGCACTCTTCTGGTGAGAATA
Loxodonta_africana|23521            AAACCCCTGCACTACATGACCATCATGAGCCACAGGCTGTGCATTCTCCTGGTGAGAATA
Loxodonta_africana|10356            AAACCCCTGCACTACACGACCATTATGAGCCATAGGCTGTGCCTTCTCCTGGTGGGAGTA
Choloepus_hoffmanni|440             AAACCCCTGCACTACACAAGTATCATGAGACAAAAGGTGTGTGGCCTCCTCATGGGAGTG
Oryctolagus_cuniculus|1856          AAGCCTTTGCACTACATGAATATCATGAACCGACAGGTGTGTAGCCTCCTTGTGGGAGTG
Mus_musculus|22921                  AAACCGCTGCGCTACACGATCATTATGAACAGATTTGTGTGTGGCCTCTTGGTGGGGGTG
Rattus_norvegicus|22431             AAACCCCTACGCTACACAATCATCATGAACAGATTTGTGTGTGGCCTCTTGGTGGGGGTG
Erinaceus_europaeus|4844            AAACCCCTGCACTACTCCACCATCATGAGTCAAAGGGTGTGCAACCTTCTTGTGGGAGTG
Erinaceus_europaeus|2413            AAACCCCTGCACTACTCCACCATCATGAGTCAAAGGGTGTGCAACCTTCTTGTGGGAGTG
Sus_scrofa|11416                    AAACCCTTGCACTACATGACCATCATGAGCCGACAGGTGTGTAACCTTCTTATAGGAGTG
Felis_catus|1160                    AAACCCTTGCATTACACAACCATCATGAGTCACCAGGTGTGTGGCCTCCTTGTAGGAGTG
Canis_familiaris|8432               AAACCCTTGCGCTACACAACCATCATGAGTCAACAGGTCTGTAGCCTCCTTGTGGGCGTG
Canis_familiaris|8419               AAACCCTTGCGCTACACAACCATCATGAGTCAACAGGTCTGTAGCCTCCTTGTGGGCGTG
Monodelphis_domestica|24687         AAGCCTTTGCACTATACCTTGATTATGAGCCAGAAGCTTTGTAGCCTACTAGTGGGGATA
Macropus_eugenii|10461              AGACCTCTGCACTATACCATGATTATGAGCCATAGGCTCTGTGGCCTTCTGGTGGGGGTA
Monodelphis_domestica|24684         AAGCCTCTGCACTATACCACAATCATGAGCCAGAGGCTCTGTGGTCTTCTTGTAGGGGTA
Cavia_porcellus|7144                AAACCTCTGCACTACGTGAGCATCATGAGTCGCAAGGTGTGCATTCTCCTTGTGGGGGTG
Homo_sapiens|17636                  AAACCTCTGAACTACACAACCATTATGAGCCACAGCCTGTGCATTCTCCTGGTGGCAGTG
Pan_troglodytes|6844                AAACCTCTGAACTACACAACCATTATGAGCCATAGCCTGTGCATTCTTCTGGTGGCAGTG
Sus_scrofa|11414                    AGACCTCTTCACTACACAACCATCATGAGCCACAGGCTGTGTATTGTCCTGCTGGGAGTG
Erinaceus_europaeus|4881            AAACCCTTGCACTACACAACCATCATGAGTCACCGACTGTGTGTTCTTCTGCTGGGAGTG
Otolemur_garnettii|1429             AGGCCTCTGCACTATGCAACTGTCATGGGCCGCCAGCTGTGCGTTCTCCTCCTGGGCGTG
Microcebus_murinus|3048             AAGCCTCTGCACTATACAACTGTCATGTGCCACAGGCTGTGCATGCTGCTCGTGGGAGTG
Bos_taurus|6619                     AAACCTCTGCACTACACGGCCATCATGAGCCACAGGCTGTGCGTCCTCCTGCTGGGGGTG
Bos_taurus|6624                     AAACCTCTGCACTACACGGCCATCATGAGCCACAGGCTGTGCGTCCTCCTGCTGGGGGTG
Procavia_capensis|8766              AAACCCCTGCACTACCCGAGCATCATGAGTCAGAGGCTGTGCGTTCTGCTGGTGGGAGTG
Loxodonta_africana|10360            AAACCCCTGCACTACATAAACATCATGAGCCACAGGCTGTGCATTCTCCTGGTAGGAGTG
Vicugna_pacos|1942                  CGACCTCTGCACTATACAACCATCATGAGCCACAGGCTGTGCGTTCTCCTGATGGGAGTG
Canis_familiaris|8421               AAACCTCTTCACTATACTACTGTCATGAACCATAGGTTGTGCATTCTCCTGCTGGGCGTG
Felis_catus|6205                    AGACCTCTGCACTATGCGACTGTCATGAGCCACAGGCTGTGCTTTCTTCTGCTGGGAGTG
Ochotona_princeps|11681             AAGCCCCTGCACTACAGCGCCATCATGAGCCCCAGGCTGTGCGTCCTGCTGGTGGGAGTG
Rattus_norvegicus|22434             AAACCTCTGCACTATATGACCATCATGAACCACAAGCTATGCATTCTTCTGGTGGGCGTG
Mus_musculus|22917                  AAACCTCTGCACTATATGACCATCATGAGCCACAAGCTATGCATTCTCCTGGTGGGGGTA
Mus_musculus|22928                  AAACCTCTGCACTATATGACCATCATGAGCCACAAGCTATGCATTCTCCTGGTGGGGGTA
Oryctolagus_cuniculus|1853          AAACCTCTGCACTACGCCAGCATCATGAGCCACAGGCTGTGCATCCTGCTGGTGGGAGTG
Oryctolagus_cuniculus|1852          AAACCTCTGCACTACGCCAGCATCATGAGCCACAGGCTGTGCATCCTGCTGGTGGGAGTG
Ornithorhynchus_anatinus|16863      AACCCCCTGCACTACATAACCATTATGAGGCAGACCGTGTGCAGCCTGTTGGTGGGGGTG
Ornithorhynchus_anatinus|16862      AAGCCCCTGCACTACATGGCCATCATGAGTCAGCGCATGTGCGGCCTGCTGGTGGGAACG
Ornithorhynchus_anatinus|16865      AAGCCCCTGCACTACACGGCCATCATGAGTCAACGCCTTTGTAGTCTGCTGGTGGGGGTG
                                                                                                

Procavia_capensis|16277             GCCTGGATGGGATCTTTTATTCATTCACCAGTACAGATTTTCTTGATTTTGGAATTACCC
Erinaceus_europaeus|13540           GCCTGGGTGGGAGCCTGTGTGCATTCTTTAGTTCAGATTTTTCTAGCCGTAAGTTTGCCT
Bos_taurus|28568                    ACTTGGCTGGGGGAGTCCATACATGTAACAATACAACTTCTCTTTATGTATCAAGTACCC
Dasypus_novemcinctus|13523          GCCTGGGTGGGAGGAACTATGCACGCAAAGGTACAGCTCCTGTTTATGTACCAAATACCC
Mus_musculus|22888                  GCTTGGGTGGGAGGATTTGCTCACGGAACCATTCAGCTGCTCTTTATGTATCAAATACCT
Rattus_norvegicus|22406             GCTTGGGTGGGAGGATTTGCTCATGCAACCATTCAGCTTCTCTTTATGTATCAAATACCT
Mus_musculus|22846                  GCTTGGGTAGGAGGATCTATGCATGCAACCATTCAGCTTCTCTTTATGTATCAAATACCA
Rattus_norvegicus|22366             GCTTGGGTAGGAGGATCTATGCATGCAACCATTCAGCTTCTTTTTATGTATCAAATACCA
Ochotona_princeps|15463             GCTTGGGTGGGGGGATCCATGCATGCTACAATACAGCTTCTTTTCATGTATCAGATACCT
Homo_sapiens|17660                  GCTTGGGTGGGGGGATTTATGCACGCAATGATACAACTTCTCTTCATGTATCAAATACCC
Pan_troglodytes|8167                GCTTGGGTGGGGGGATTTATGCACGCAATGATACAACTTCTCTTCATGTATCAAATACCC
Otolemur_garnettii|13504            GCCTGGGTGGGGGGATTGATGCATGCAACAATACAGCTTCTGTTCATGTCCCAAATACCC
Microcebus_murinus|2797             GCTTGGGTGGGGGGATTTCTTCATGCAGCAATACAGCTCCTCTTCATG------------
Microcebus_murinus|5059             GCTTGGGTGGGGGGATTTCTGCATGCAGCAATACAGCTCCTCTTCATGTGTCAAATACCC
Microcebus_murinus|10664            GCTTGGGTGGGGGGATTTCTGCATGCAGCAATACAGCTCCTCTTCATGTGTCAAATACCC
Tupaia_belangeri|13856              TCTTGGGTGGGGGGATCCCTGCATGCCACAGTACAGCTTCTCTTCATGTACCAAATACCT
Choloepus_hoffmanni|6189            GCCTGCGTTGGGGGAGCTATGCACGCAACGATACAGCTTCTCTTTATGTACCAAAGACCC
Choloepus_hoffmanni|10987           GCCTGGGTGGGGGGAGCTATGCATGCAACGATACAGCTTCTCTTTATGTACCAATTACCC
Felis_catus|6208                    GCCTGCGTGGGGGGGTTTATCCACGCAACGATACAGCTTCTCTTCATGTATCAAATACCC
Canis_familiaris|28898              GCCTGGGTGGGGGGATTTATCCATGCAGCAATACAGCTTCTCTTCATGTATCAAATACCC
Canis_familiaris|28666              GCCTGGGTGGGGGGATTTATCCATGCAGCAATACAGCTTCTCTTCATGTATCAAATACCC
Canis_familiaris|8394               GCCTGGGTGGGGGGATTTATCCATGCAGCAATACAGCTTCTCTTCATGTATCAAATACCC
Canis_familiaris|8407               GCCTGGGTGGGGGGGTTTATCCATGCAGCAATACAGCTTCTCTTCATGTATCAACTACCC
Loxodonta_africana|10342            GCCTGGGTAGGCGGGTCCATGCATGCAACAATACAGCTTCTCTTCATGTACCAAATACCC
Loxodonta_africana|7429             ACCTGGGTGGGAGGATTTTTGCATGCAATGATACAGCTCCTCTTCATGTACCAAATACCT
Loxodonta_africana|8250             ACCTGGGTGGGAGGATTTTTGCATGCAATGATACAGCTCCTCTTCATGTACCACATACCT
Loxodonta_africana|10841            GCCTGGGTGGGAGGATTTTTGCATGCAATGATACAGCTTCTCTTCATGTACCAAAAACCT
Loxodonta_africana|7347             GTCTGGGTGGGAGGATTTTTGCATGCAATTACACAGCTCCTCTTCATGTACCAAATACCT
Loxodonta_africana|15374            GTCTGGGTGGGAGGATTTTTGCATGCAATTACACAGCTCCTCTTCATGTACCAAATACCT
Loxodonta_africana|8254             GTCTGGGTGGGAGGATTTTTGCATGCAATTACACAGCTCCTCTTCATGTACCAAATACCT
Loxodonta_africana|10347            GTCTGGGTGGGAGGATTTTTGCATGCAATTACACAGCTCCTCTTCATGTACCAAATACCT
Dasypus_novemcinctus|5504           TCCTGGGTTGGGGGATTTCTTCATGCTGTAATTCAAATCCTTTTCATTGTTTGGTTGCCA
Dasypus_novemcinctus|6826           TCCTGGGCTGGGGGATTTCTTCATGCCCTGATTCAAATCCTTTTTATGCTGTGGTTATCT
Equus_caballus|5245                 GCTTGTTATGGGAGATTTCTTCATGCTCTGATTCAAATTCTTTTTATCGTCTGGTTGCCC
Echinops_telfairi|11116             GCCTGGGCTGGAGGATTTATTCATGGTCTGATTCAAGTTCTTTTTATGGTCTGGTTGCCC
Echinops_telfairi|11654             GCCTGGGCTGGAGGACTGCTTCATGCTGTGATTCAAATGCTTTTTATAGTCTGGTTGCCC
Echinops_telfairi|10565             GCCTGGGCTGGAGGATTTATTCATGGTCTGATTCAAGTTCTTTTTATGGTCTGGTTGCCC
Vicugna_pacos|1925                  GCCTGGGCCGGAGGATTTCTTCATGCTCTGATTCAAATTCTTTTTATAGTCTGGTTGCCC
Dasypus_novemcinctus|6644           TCCTGGGCTGGGGGATTTCTTCATGCTCTGATTCAAATGCTTTTTATGGTGTGGGTACCC
Spermophilus_tridecemlineatus|10360 GCTTGGGCTGGAGGATTTCTTCATGGTCTGATCCAAACTCTTTTTGTGGTCTGTTTGCCC
Cavia_porcellus|23431               GCCTGGGCTGGGGGATTGCTTCATGCTCTCATCCAGATTCTTTTCATGGTCTGGTTGCCA
Callithrix_jacchus|41201            GCATGGGTCGGGGGATTTCTTCACGCTCTGATTCAACTGCTTTTGATAGTCCGACTGCCC
Mus_musculus|22929                  GCCTGGGCTGGGGGATTTCTTCATGCTTTGATTCAAATTCTTTTTATGGTCTGGTTGCCT
Rattus_norvegicus|22435             GCCTGGGCTGGGGGATTTCTTCATGCTTTGATTCAAATTCTTTTTATGGTCTGGTTGCCT
Equus_caballus|5271                 GCCTGGACTGGGGGATTTCTTCACGCACTGATTCAAATTCTTTTTTTGGTCTGGCTGCCC
Sorex_araneus|6771                  GCCTGGGCTGGGGGATTTCTTCACGCTCTCATTCAAATTCTTTTTATACTCTGGCTACCC
Sus_scrofa|9827                     GCCTGGGCCGGGGGATTTCTTCATGCCCTGATTCAAATTCTTTTTATAGTCTGGTTGCCC
Loxodonta_africana|10361            GCCTGGGCTGGGGTTTTTTTTCATGCTCTGATTCAAATTCTTTTTATGGTCTGGTTGCCC
Homo_sapiens|17605                  GCATGGGTCGGGGGATTTCTTCACGCTCTGATTCAAATGCTTTTAATAGTCTGGCTGCCC
Pan_troglodytes|6828                GCA---GTCGGGGGATTTCTTCACGCTCTGATTCAAATGCTTTTAATAGTCTGGCTGCCC
Canis_familiaris|8422               GCCTGGGCTGGGGGATTTCTTCATGCTCTGATTCAAATTCTTTTTATAGTCTGGTTGCCC
Oryctolagus_cuniculus|1850          GCCTGGGCTGGGGGATTTCTTCATGCTCTGATTCAAATTCTTTTTATGGCCTGGTTACCC
Otolemur_garnettii|13491            GCCTGGGTCGGAGGACTTCTCCACGCTGGGATTCAAATTCTTTTCATGGCCTGGTTGCCT
Microcebus_murinus|9568             GCCTGGGCTGGCGGTTTTCTTCATGCTCTGATTCAAATTCTCTGTATGGTCTGGTTGCCT
Dasypus_novemcinctus|3289           TCCTGGGCTGGGGGATTTATTCATGGTCTGGTTCAAATTCTCTTTATTGTGTGGTTGCCG
Dasypus_novemcinctus|6897           TCCTGGGCTGGAGGATTTCTTCATGCCCTGATTCAAGTCCTTTTCATTGTGTGGTTGCCC
Dasypus_novemcinctus|15676          TCCTGGGCTGGGGGATTTCTTCATGGCCTGATTCAAATCATTTTCATTTCATGGTTGCCC
Choloepus_hoffmanni|6218            TCCTGGGCAGGAGGATTTCTTCATGCTCTGATACAAATCCTTTTTATGCTGTGGTTGCCC
Spermophilus_tridecemlineatus|12911 ACATGGGTGGGAGGTTTTCTCCATGCAACCATCCAGATCCTCTTCATCTTACCACTACCC
Bos_taurus|29294                    GCATGGGTGGGAGGCTTTCTTCATGGATTCATACAGATCCTCTTTATTTTCCACTTACCC
Bos_taurus|27626                    GCATGGGCGGGAGGCTTTCTTCATGGAATCATACAGATCTTTTTCATCTTCAGATTACCC
Sus_scrofa|11423                    GTTTCGGTTGGGGGTTTTATCCATTCAACTATACAGATTCTCCTCATCTTCAGATTACCC
Cavia_porcellus|21650               TCATGGGTGGGAGGCTTTCTTCATGGAACCATACAGATCCTCTTCATTTTCCGACTGCCA
Rattus_norvegicus|22372             TCATGGGTTGGAGGCTTTCTTCATGCAGGTATACAAATGCTTTTCATGATTGGATTACCT
Rattus_norvegicus|22374             TCGTGGTTTGGAGGCTTTCTTCATGGAGGTATACAAATCCTTTTCATGATTGGATTACCT
Bos_taurus|29733                    GCGTGGGTGGGAGGCTTTCTTCATGGAATAATTCAGATCCTCTTCATCTTCAGGTTACCC
Sus_scrofa|11396                    GTGTGGGTGGGAGGTTTTCTTCATGGATTCATTCAGATCCTCTTCATCTTCAGATTGCCC
Sus_scrofa|11395                    TCATGGCTGGGAGGCTTTCTCCATGCATTCATTCAGATCCTCTTCATCTTCAGATTGCCC
Sus_scrofa|11400                    TCATGGCTGGGAGGCTTTCTCCATGGATTCATTCAGATCCTCTTCATCTTCAGATTGCCC
Sus_scrofa|11399                    TCATGGCTGGGAGGCTTTCTTCATGGATTCATTCAGATCCTCTTCATCTTCAGATTGCCC
Choloepus_hoffmanni|258             GCATGGGTGGGAGGTTTTCTTCATGCAACCATACAAATTCTTTTCACATTTCGATTACCC
Monodelphis_domestica|24688         GTCTGGATAGGAGGCTTACTCCATGCAACTATACAGATGCTCTTCCTGAGCCAATTACCC
Monodelphis_domestica|24689         GTCTGGTTAGGAGGCTTACTCCATGCAACTATACAGATACTCTTCCTGATCCAATTACCC
Monodelphis_domestica|24691         GTCTGGATAGGAGGCTTACTCCATGCAACTATACAGATGCTCTTCCTGAGCCAATTACCA
Callithrix_jacchus|41212            TCATGGGTAGGAGGCTTTCTTCATGCAACCATACAGATCCTCTTCATCTTCCAATTACCT
Homo_sapiens|17635                  TCATGGGTAGGAGGCTTTCTTCATGCAACCATACAGATCCTCTTCATCTGTCAATTACCT
Equus_caballus|5278                 GTGTGGGTTGCAGCATTTGTTCACTCGAACATACAGATGCTCTTCATCTTCCAATTACCA
Canis_familiaris|8369               GTGTGGGTGGGAGGCTTTCTTCATGCAGCCATACAGATCCTCTTTATCATCCCACTACCC
Canis_familiaris|8352               GTGTGGGTGGGAGGCTTTCTTCATGCAGCCATACAGATCCTCTTTATCATCCCTCTACCT
Canis_familiaris|8363               GTGTGGGTGGGAGGCTTTCTTCATGCAGCCATACAGATCCTCTTTATCATCCCTCTACCC
Bos_taurus|6622                     TCATGGGTGGGAGGCTTTCTTCACGCAACCATACAGATCCTCTTCATCTTCCACTTACCC
Mus_musculus|22922                  TCATGGCTAGGAGGTTTTCTTCATGCCACCATACAGATCCTGTTCATTTTCCAATTACCC
Rattus_norvegicus|22432             TCATGGTTAGGAGGTTTTCTTCATGCCACCATACAGATCCTGTTTATTTTCCAATTACCA
Bos_taurus|6627                     TCATGGGTGGGAGGCTTTCTTCATGGATTCATACAGATCCTCTTCATCTTCCGCTTACCC
Sus_scrofa|11415                    TCATGGGTGGGAGGTTTCCTTCACGGAACCATTCAGATCCTCTTCATTTTCAGATTACCC
Sus_scrofa|11413                    TCGTGGGTGGGAGGCTTTCTTCATGCAACCATACAGATCCTCTTCATCTCCAGATTACCC
Sus_scrofa|9826                     TCGTGGGTGGGAGGCTGTCTTCATGCAACCATACAGATCCTCTTCATCTCCAGATTACCC
Sus_scrofa|11406                    TCGTGGGTGGGAGGCTGTCTTCATGCAACCATACAGATCCTCTTCATCTCCAGATTACAC
Sus_scrofa|11409                    TCGTGGGTGGGAGGCTTTCTCCATGGATTCATTCAGATCCTCTTCATCTCCAGATTACCC
Erinaceus_europaeus|4256            TCATGGATGGGAGGTTTTCTTCACGGAATCATCCAGATCTTCTTCATCTTCAGACTACCC
Procavia_capensis|7897              TCATGGGCGGGAGGCTTTCTTCATGCAATCATACAGATCCTTTTCATGTTTCATCTACCC
Loxodonta_africana|10358            TCCTGGGTTGGAGGCTTTCTCCATGCCATCATACAGATCCTCTTCATCTTTAGATTACCC
Echinops_telfairi|7364              TCCTGGGTGGGAGGCTTCCTTCATGGAGCTATACAGATCCTCTTTATATTTCGATTACCT
Loxodonta_africana|10359            GTGTGGGTGGGAGGCTTTCTCCATGCAACCATACAGATCCTCTTCATGTTTAGATTACCA
Procavia_capensis|11271             GTGTGGCTGGGAGGCTTTCTCCATGCAACCATACAGATCCTCTTCATATTTCGATTACCC
Mus_musculus|22924                  GTATGGGTCGGAGGTTTTCTTCATGCAACCATACAGATTCTGTTTATTTTTAAATTACCT
Oryctolagus_cuniculus|1855          TCATGGATAGGTGGCTTTCTTCATGCAACCATACAGATACTGTTCATCTTCAAATTACCT
Homo_sapiens|17643                  GTGTGGATGGGAGGCTTTCTTCATGCAACCATACAGATCCTCTTCATCTTCCAATTACCT
Oryctolagus_cuniculus|1854          GTATGGGTGGGTGGCTTTCTTCATGCAATCATACAAATGCTTTTTATTTTCCAATTACCC
Callithrix_jacchus|41203            GTGTGGATGGGAGGCTTTCTTCATGCAACCATACAGATCCTCTTCGTCTTCCAATTACCT
Spermophilus_tridecemlineatus|2389  GCATGGACAGGAGGCTTTCTCCATGCAACCATCCAGATCCTCTTCATCTTCCGACTACCC
Felis_catus|31463                   GTGTGGGTGGGAGGCTTTCTTCACGCAACTATACAGATACTCTTCATCTTCCAATTACCC
Canis_familiaris|8420               GTGTGGGTTGGAGGCTTTCTTCATGCAACTATACAGATCCTCTTCATTTTCCAATTACCC
Canis_familiaris|8433               GTGTGGGTTGGAGGCTTTCTTCATGCAACTATACAGATCCTCTTCATTTTCCAATTACCC
Macropus_eugenii|12245              GCATGGCTAGGCGGCTTTCTTCATGCCATGATACAGATTGTATCCATATTCTGGTTACCT
Ornithorhynchus_anatinus|16857      ATTTGGATGGGGGGGATTCTTCACGCAACGATCCAGATTCTCCTCACGGTTAGATTGCCA
Echinops_telfairi|4282              GCCTGGGCCGGAGGCTTTGTCCATGCAACTAGTCAGATCCTCTTCACAGTCTGGCTGCCC
Rhesus_macaque|12555                GCCTGGGTTGGAGGCTTTGTTCATGCAACAATTCAGATCCTCTTCACAGTCTGGCTACCC
Loxodonta_africana|10357            GTCTGGGCTGGAGGCTTTATCCATGCAACCATTCAGGTCCTCTTCATAGTCTGGCTGCCC
Loxodonta_africana|23520            GTCTGGGCTGGAGGCTTTGTCCATGCAATCATTCAGGTCCTCTTCATAGTCTGGCTGCCC
Loxodonta_africana|23521            GTCTGGGCTGGAGGCTTTATCCACGCAACCATTCAGGTCCTCTTCACGGCCTGGCTGCCC
Loxodonta_africana|10356            GCCTGGGCTGGAGGCTTTGTCCATGCAACCATTCAGGTCCTCTTCATAGTCTGGCTGCCC
Choloepus_hoffmanni|440             GTCTGGGCTAGAGGCTTTGTCCATGCAACCATTCAGATCCTCTTCACAGTCTGGCTGCCC
Oryctolagus_cuniculus|1856          GCCTGGGCTGGAGGTGTCTTCCATGCAGCTATTCAGATCCTTTTCACAGTCTGGCTGCCC
Mus_musculus|22921                  GCCTGGGCTGGGGGTTTTATTCATGCGACCATTCAGATCCTCTTCACAGTCTGGCTGCCT
Rattus_norvegicus|22431             GCCTGGGCTGGAGGTTTTGTTCATGCAACCATTCAGATCCTCTTCACAGTCTGGTTGCCT
Erinaceus_europaeus|4844            GCCTGGGCTGGAGCCTTTGTCCATGCCACCATTCAGATCCTCTTCACCATCTGGCTGCCC
Erinaceus_europaeus|2413            GCCTGGGCTGGAGCCTTTGTCCATGCCACCATTCAGATCCTCTTCACCATCTGGCTGCCC
Sus_scrofa|11416                    GCTTGGGCTGGAGCCTTTATCCATGCGACCATTCAGCTCCTCTTCACGGTCTGGCTGCCT
Felis_catus|1160                    GCCTGGGCTGGAGCCTTTGTCCATGCAACCATTCAGATCCTCTTCACAGTCTGGCTGCCT
Canis_familiaris|8432               GTCTGGGCTGGAGCCTTTGTCCATGCAACCATTCAGATCTTCTTCACAGTCTGGCTGCCT
Canis_familiaris|8419               GCCTGGGCTGGAGGCTTTGTCCATGCAACCATTCAGATCTTCTTCACAGTCTGGCTGCCT
Monodelphis_domestica|24687         GCTTGGGCTGGGGGCTTTCTACATGCAACAATACAGCTTATCATCACAATCTGGCTCCCC
Macropus_eugenii|10461              GCCTGGGCTGGAGGCTTTCTGCATGCATTAATACAGCTTCTCCTTACAATATGGCTCCCT
Monodelphis_domestica|24684         GCTTGGGCTGGGGGCTTTCTCCATGCAATAATACAGCTTCTCTTCACAGTCTGGTTGCCA
Cavia_porcellus|7144                GCCTGGGCTGGAGGATTTCTGCATGCTACTGTTCAGATTCTCTTTACTGTGTGGCTTCCC
Homo_sapiens|17636                  GCCTGGGTGGGAGGATTTCTTCATGCAACTATTCAGATTCTCTTTACAGTATGGCTGCCC
Pan_troglodytes|6844                GCCTGGATGGGAGGATTTCTTCATGCAACTATTCAGATTCTCTTTACAGTATGGCTGCCC
Sus_scrofa|11414                    GCCTGGACTGGAGGATTTCTCCATGCAACCATTCAGATTCTTCTTATTGTCAGGCTGCCT
Erinaceus_europaeus|4881            GCCTGGACTGGGGGATTTCTCCATGCAACCATTCAGATCCTCTTCACTATATGGCTGCCC
Otolemur_garnettii|1429             GCCTGGCTGGGGGGATTTCTCCACGCGACCATTCAGATCCTCTTTACAGTCTGGCTGCCC
Microcebus_murinus|3048             GCCTGGACTGGAGGATTTCTCCACGCAACCATCCAGATCCTTTTCACAGTCTGGCTGCCC
Bos_taurus|6619                     GCCTGGACTGGAGGATTTGTCCACGCAACCATTCAGGTCCTCTTTACAGTCCGGCTGCCC
Bos_taurus|6624                     GCCTGGACTGGAGGATTTGTCCACGCAACCATTCAGGTCCTCTTTACAGTCCGGCTGCCC
Procavia_capensis|8766              GCCTGGACTGGAGGATTTCTCCATGCAACCGTTCAGATCCTCTTCACGGTCTGGCTGCCC
Loxodonta_africana|10360            GCTTGGACTGGAGGATTTCTCCATGCAACTGTTCAGATCCTCTTCACAGTCTGGCTGCCC
Vicugna_pacos|1942                  GCCTGGACTGGAGGATTTCTCCATGCAACCATTCAGATCCTCTTTACAGTCTGGCTGCCC
Canis_familiaris|8421               GCCTGGACTGGAGGATTTCTCCATGCAACCATTCAGATCCTCTTCACAGTCTGGCTGCCC
Felis_catus|6205                    GCCTGGACTGGAGGATTTCTCCATGCGACCATTCAGATACTCTTTACAGTCTGGCTGCCC
Ochotona_princeps|11681             GCGTGGACTGGAGGGTTTCTTCATGCCACCATCCAGATCCTCTTCACGGTCTGGCTGCCC
Rattus_norvegicus|22434             GCCTGGACTGGAGGATTTCTCCATGCAACTATTCAGATCCTCTTTACAGTGTGGCTGCCC
Mus_musculus|22917                  GCCTGGACTGGAGGATTTCTCCATGCAACTATTCAGATCCTTTTTACAGTGTGGCTGCCC
Mus_musculus|22928                  GCCTGGACTGGAGGATTTCTCCATGCAACTATTCAGATCCTTTTTACAGTGTGGCTGCCC
Oryctolagus_cuniculus|1853          GCCTGGGCTGGAGGATTTCTGCATGCAACCATCCAGATCCTCTTCACAGTCTGGCTGCCC
Oryctolagus_cuniculus|1852          GCCTGGGCTGGAGGATTTCTGCACGCAACCATCCAGATCCTCTTCACAGTCTGGCTGCCC
Ornithorhynchus_anatinus|16863      GCTTGGGGCGGGGGCTTTCTTCACGCAACCCTGCAGATTCTCTTCATGTCGCCTTTACCA
Ornithorhynchus_anatinus|16862      GCCTGGATGGGAGGCTTCTTTCACGCAAGCATCCAGGTCCTCTTCACGGTTCAGTTACCA
Ornithorhynchus_anatinus|16865      GCCTGGACGGGAGGCTTCCTTCACGCAACCATCCAGGTCCTCTTCATGGTCCAGGTGCCG
                                             .           **          **.    *                   

Procavia_capensis|16277             TTCTGTGGCTCCAATGTTATTGATCACTATTTCTGTGATATGCAACCTTTGATGAAACTT
Erinaceus_europaeus|13540           TTCTGTGGGCCCAATGTGATAGATCATTACTTCTGTGACTTGCAGCCCTTATTAAATCTT
Bos_taurus|28568                    TTCTGTGGCCCTAATGTCACTGATCATTTTATGTGTGATTTTCTCCCACTGTTGAAACTG
Dasypus_novemcinctus|13523          TTTTGTAGCCCCAACATCATTGGTCACTTTATATGTGATTTGTTTCCATTGTTGAAACTG
Mus_musculus|22888                  TTCTGTGGTCCCAATGTCATTGATCATGTGATCTGTGACTTGTTCCCGTTGTTGCAACTA
Rattus_norvegicus|22406             TTCTGTGGTCCCAATATCATTGATCATGTGATCTGTGACTTGTTCCCATTGTTGCAACTA
Mus_musculus|22846                  TTCTGTAGCTCAAATATCATTGACCACTTTATGTGTGATTTGTTTCCATTGCTGAAGCTG
Rattus_norvegicus|22366             TTCTGTAGCCCAAATATTATTGACCACTTCATGTGTGATTTGTTTCCATTGCTGAAACTG
Ochotona_princeps|15463             TTTTGTGGTTCCAATATAATTGATCACTTTATGTGTGATTTATTCCCATTGTTAAAACTG
Homo_sapiens|17660                  TTCTGTGGTCCTAATATCATAGATCACTTTATATGTGATTTGTTTCAGTTGTTGACACTT
Pan_troglodytes|8167                TTTTGTGGTCCTAATATCATAGATCACTTTATATGTGATTTGTTTCAGTTGTTGACACTT
Otolemur_garnettii|13504            TTCTGTGGTCCTAATATCATAGATCACTTTATGTGTGATTTGTTTCAGTTGCTGACACTT
Microcebus_murinus|2797             ------------------------------------------------------------
Microcebus_murinus|5059             TTTTGTGGTCCTAATATCATAGACCAATTTGTATGTGATTTGTTTCAGTTGCTGGAACTT
Microcebus_murinus|10664            TTTTGTGGTCCTAATGTCATGGACCACTTTCTATGTGATTTGTTTCAGTTGCTGGAACTT
Tupaia_belangeri|13856              TTCTGTGGCCCCAATGTCATTGATCACTTTATATGTGATTTGTTTCCATTGTTGAAACTT
Choloepus_hoffmanni|6189            TTCTGTGGCCCCAATGTCATTGATCACTTTATATGTGATTTGTTTCCATTGCTGATGCTG
Choloepus_hoffmanni|10987           TTCTGTGGCCCCAATGTCATTGATCACTTTATATGTGATTTGTTTCCATTGTTGAAACTG
Felis_catus|6208                    TTCTGTGGTCCCAATGTCATCGATCACTTCATATGTGATTTGTTCCCATTGCTGAAACTC
Canis_familiaris|28898              TTCTGTGGCCCCAATGTCATTGATCATTTTATATGCGATTTGTTTCCCTTGTTGAAACTG
Canis_familiaris|28666              TTCTGTGGCCCCAATGTCATTGATCATTTTATATGCGATTTGTTTCCCTTGTTGAAACTG
Canis_familiaris|8394               TTCTGTGGCCCCAATGTCATTGATCATTTTATATGCGATTTGTTTCCCTTGTTGAAACTG
Canis_familiaris|8407               TTCTGTGGCCTCAATGTTATTGATCACTTTATGTGTGATTTGTTTCCCTTGTTGAAACTG
Loxodonta_africana|10342            TTCTGTGGTCCCAATGTCATTGATCACTTTATGTGTGATTTATTTCCATTGCTGACACTG
Loxodonta_africana|7429             TTCTGTGGTCCCAATGTCATTGATCACTTTATATGTGATTTGTTTCAATTGCTGATACTG
Loxodonta_africana|8250             TTCTGTGGTCCCAATGTGATTGATCACTTTATATTTGATTTGTTTCAATTGCTGACACTG
Loxodonta_africana|10841            TTCTGTGGTCCCAATGTCATTGATCACTTTATGTGTGACTTGTTTCAGTTGCTGACACTG
Loxodonta_africana|7347             TTCTGTGGTCCCAATGTCATTGATCACTTTATGTGTGATTTGTTTCAACTGCTGACACTG
Loxodonta_africana|15374            TTCTGTGGTCCCAATGTCATTGATCACTTTATATGTGATTTGTTTCAACTGCTGACACTG
Loxodonta_africana|8254             TTCTGTGGTCCCCATGTCATTGATCACTTTATGTGTGATTTGTTTCAACTGCTGACATTG
Loxodonta_africana|10347            TTCTGTGGTCCCAATGTCATTGATCACTTTATGTGTGATTTGTTTCAACTGCTGACACTG
Dasypus_novemcinctus|5504           TTCTGTGGACCCAATGTCATTGATCATTTCTCCTGTGATGTCTACCCTCTGCTGAAGCTC
Dasypus_novemcinctus|6826           TTCTGTGGTCCCAATGTCATTGACCATTTCTTCTGTGATTTTGACCCTGTGCTGAAACTC
Equus_caballus|5245                 TTCTGTGCTCCCAATGTCATTGATCATTTCATCTGTGACCTTTTCCCTCTGCTAAAACTC
Echinops_telfairi|11116             TTCTGTGGTCCCAATGTGATTGACCATTTTGTCTGTGATCTTTTCCCTCTGCTAAAACTT
Echinops_telfairi|11654             TTCTGTGGTCCCAATGTGATTGACCATTTTATGTGTGATCTTTTCCCTCTGCTAAAACTC
Echinops_telfairi|10565             TTCTGTGGTCCCAATGTGATTGACCATTTTATGTGTGATCTTTTCCCTCTGCTAAAACTC
Vicugna_pacos|1925                  TTCTGTGGCCCCAATGTCATTGACCACTTCATCTGTGACCTTTTCCCTCTGCTAAAGCTC
Dasypus_novemcinctus|6644           TTTTGTGGGCCCAATGTCATTGACCATTTTTTCTGTGATTTTTTCCCTCTACTAAAACTC
Spermophilus_tridecemlineatus|10360 TTCTGTGGCCCAAATGTCATTGATCATTTCATCTGTGACCTTTTCCCCCTCCTGAAACTC
Cavia_porcellus|23431               TTCTGTGGCCCAAATGTCATTGACCATTTTATCTGTGACCTCTTCCCTCTCTTAAAACTC
Callithrix_jacchus|41201            TTCTGTGGCCCCAATGTCATTGACCATTTCATCTGTGACCTTTTCCCTCTGCTAAACCTC
Mus_musculus|22929                  TTCTGTGGCCCAAATATCATTGACCATTTTATCTGTGACCTTTTCCCGCTCTTAAAACTT
Rattus_norvegicus|22435             TTCTGTGGCCCAAATATCATTGACCATTTCATTTGTGACCTTTTCCCTCTCCTAAAACTT
Equus_caballus|5271                 TTCTGTGGCCCCAATGTCATTGACCATTTCATCTGTGACCTTTTCCCTCTGCTACAACTC
Sorex_araneus|6771                  TTCTGTGGCCCCAATGTCATTGACCACTTCATCTGTGACCTTTTCCCTCTGCTACAACTG
Sus_scrofa|9827                     TTCTGTGGCCCCAATGTCATTGACCATTTCATCTGTGACCTTTTCCCCCTGCTAAAACTC
Loxodonta_africana|10361            TTCTGTGGTCCCAATGTTATTGACCATTTTATCTGTGATCTTTTTCCTTTGCTAAAACTC
Homo_sapiens|17605                  TTCTGTGGCCCCAATGTCATTGACCATTTCATCTGTGACCTTTTCCCTCTGCTAAAACTC
Pan_troglodytes|6828                TTCTGTGGCCCCAATGTCATTGACCATTTCATCTGTGACCTTTTCCCTCTGCTAAAACTC
Canis_familiaris|8422               TTCTGCGGCCCCAATGTCATTGACCATTTCATCTGTGATCTTTTTCCTCTGCTAAAACTC
Oryctolagus_cuniculus|1850          TTCTGTGGCCCGAACATCATCGATCACTTCATCTGTGACCTTTTCCCTCTGCTGAAACTT
Otolemur_garnettii|13491            TTCTGTGGGCCCAATGTCATTGACCATTTCATCTGTGACCTCTTTCCTCTTCTGAAACTC
Microcebus_murinus|9568             TTCTGTGGCCCCAATTTCATTGACCATTTCATCTGTGACCTTTTCCCTCTGCTAAAACTC
Dasypus_novemcinctus|3289           TTTTGTGGCCCCAATATCCTTGACCATTTTGCCTGTGATCTTTACCCTCTGCTGAAGCTC
Dasypus_novemcinctus|6897           TTCTGTGGTCCCAATGTTATTGACCATTTCTTCTGTGATGTTTACCCTCTGCTGAAGCTC
Dasypus_novemcinctus|15676          TTCTGTGGTCCCAATGTCATTGACCACTTTTTCTGTGATCTTTACCCACTGCTGAAAGTT
Choloepus_hoffmanni|6218            TTCTGTGGCCCTAATGTCATTGACCACTTCTTCTGTGATCTTTACCCATTGCTGAAACTC
Spermophilus_tridecemlineatus|12911 TTCTGTGGCCCTAATGTCATTGATCACTTTATGTGTGACCTGAACCCTTTGTTCAAACTG
Bos_taurus|29294                    TTCTGTGGCTCAAATGTCATAAATCACTTTATGTGTGATCTGAACCCTTTGCTCAAACTT
Bos_taurus|27626                    TTCTGTGGCCTTAATGTCATAGACCACTTTTTGTGTGATCTGAACCCTTTGCTAAATCTT
Sus_scrofa|11423                    TTCTGTGGTCCAAATGTCATTGATCACTTTATGTGTGATCTGAATCCTTTGCTCAATCTT
Cavia_porcellus|21650               TTCTGTGGCCCAAATGTCATTGATCACTTTATGTGTGATCTGAACCCCTTGATTAACCTG
Rattus_norvegicus|22372             TTCTGTGGCCCTAATGTCATAGACCACTTTATGTGTGATCTGAACCCCTTGCTTGCTCTC
Rattus_norvegicus|22374             TTTTGTGGCCCTAATGTCATAGACCACTTTATGTGTGATCTGAACCCATTGCTTGCTCTC
Bos_taurus|29733                    TTCTGTGGCCCTAGTGTCATAGACCACTTTATGTGTGATCTGAACCCTTTGCTCAATCTT
Sus_scrofa|11396                    TTCTGTGGCCCTAATGTCATAGATCACTTTATGTGTGATCTGAACCCTCTGCTGGATCTT
Sus_scrofa|11395                    TTCTGTGGCCCTAATGTCATAGATCACTTTATGTGTGATCTGATTCCTTTGCTTAATCTG
Sus_scrofa|11400                    TTCTGTGGCCCTAATGTCATAGATCACTTTATGTGTGATCTGATTCCTTTGCTCAAACTG
Sus_scrofa|11399                    TTCTGTGGCCCTAATGTCATAGATCACTTTATGTGTGATCTGATTCCTTTACTTCATCTG
Choloepus_hoffmanni|258             TTCTGTGGCCCTAAAATCATAGATCACTTCATGTGTGATCTGATCCCTTTACTCAATCTT
Monodelphis_domestica|24688         TTTTGTGGTCCCAATGTGATCGATCACTTTATGTGTGACTTAAATCCTTTACTCACTCTT
Monodelphis_domestica|24689         TTTTGTGGTCCCAATGTTATAGATCACTTCATGTGTGACTTAAATCCTTTGCTTAATCTT
Monodelphis_domestica|24691         TTTTGTGGTCCCAATGTTATAGATCACTTTATGTGTGACTTAAATCCTTTGCTTAATCTT
Callithrix_jacchus|41212            TTCTGTGGTCCTAATGTCATAGATCACTTTATGTGTGATCTGAACCCTTTGCTCAATCTT
Homo_sapiens|17635                  TTCTGTGGTCCTAATGTCATAGATCACTTTATGTGTGATCTCTACACTTTGATCAATCTT
Equus_caballus|5278                 TTCTGTGGTCCTAATGTCATAGATCACTTTATGTGTGATCTGAATCCTTTGCTCAATCTT
Canis_familiaris|8369               TTCTGTGGCCCTAACGTCATAGATCACTTTATATGTGATCTGAATCCTTTGCTCAATCTT
Canis_familiaris|8352               TTCTGTGGCCCTAATGTCATAGATCACTTTATGTGTGATCTGAATCCTTTGCTCAATCTT
Canis_familiaris|8363               TTCTGTGGCCCTAACGTCATAGATCACTTTATGTGTGATCTGAATCCTATGCTCAATCTT
Bos_taurus|6622                     TTCTGTGGCCCTAACGTCATAGATCACTTTATGTGTGACCTGAACCCTTTGCTCAGTCTC
Mus_musculus|22922                  TTCTGTGGCCCTAACATCATAGATCATTTTATGTGTGATCTTAATCCTTTGCTCAACCTT
Rattus_norvegicus|22432             TTCTGTGGCCCTAATGTAATAGATCACTTTATGTGTGATCTTAATCCTTTGCTCAACCTT
Bos_taurus|6627                     TTCTGTGGCCCTAACGTCATAGATCACTTTATGTGTGACCTGAACCCTTTGCTCGGTCTT
Sus_scrofa|11415                    TTCTGTGGTCCTAATGTCATAGATCACTTTATGTGTGATCTGAACCCTTTGCTGGATCTT
Sus_scrofa|11413                    TTCTGTGGTCCTAACGTCATAGATCACTTTATGTGTGATCTGAACCCTTTGCTGGATCTT
Sus_scrofa|9826                     TTCTGTGGTCCTAACGTCATAGATCACTTTATGTGTGATCTGAACCCTTTGCTGGAACTT
Sus_scrofa|11406                    TTCTGTGGTCCTAACGTCATAGATCACTTTATGTGTGATCTGAACCCTTTGCTGGATCTT
Sus_scrofa|11409                    TTCTGTGGTCCTAACATCATAGATCACTTTATGTGTGATCTGAACCCTTTGCTGGATCTT
Erinaceus_europaeus|4256            TTCTGTGGTCCTAATGTCATAGATCACTTCATGTGTGACCTGAATCCTTTGCTCAATCTT
Procavia_capensis|7897              TTCTGTGGCCCTAACATCATAGATCATTTTATGTGTGATCTGAACCCTTTGCTCAATCTT
Loxodonta_africana|10358            TTCTGTGGCCCTAACATCATAGATCACTTTATGTGTGATCTGAACCCTTTGCTCGATCTT
Echinops_telfairi|7364              TTCTGTGGTCCTAACATCATCGACCACTTTATGTGTGACCTGAACCCTTTGCTCAATCTG
Loxodonta_africana|10359            TTCTGTGGTCCTAACATCATAGATCACTTTATGTGTGATCTGAACCCTTTGCTCAATCTT
Procavia_capensis|11271             TTCTGTGGCCCTAACATCATAGATCACTTCATGTGTGATCTGAACCCTTTGCTCAATCTT
Mus_musculus|22924                  TTCTGTGGCCCAAATGTCATAGATCACTTTATGTGTGATCTGAACCCTTTGCTTAACCTT
Oryctolagus_cuniculus|1855          TTCTGTGGACCTAACATCATAGATCACTTTATGTGTGATCTGAACCCTTTGCTCAATCTT
Homo_sapiens|17643                  TTCTGTGGTCCTAATGTCATAGATCACTTTATGTGTGATCTGAACCCTTTGCTCAACCTC
Oryctolagus_cuniculus|1854          TTTTGTGGCCCTAACATCATAGACCACTTTATGTGTGACCTGAACCCTTTGTTGAATCTT
Callithrix_jacchus|41203            TTCTGTGGTCCTAATGTCATAGATCATTTTATGTGTGATCTGAACCCTTTGCTCAATCTT
Spermophilus_tridecemlineatus|2389  TTCTGTGGCCCTAATGTCATCGATCACTTTATGTGTGATCTGAACCCTTTGCTCAATCTT
Felis_catus|31463                   TTCTGTGGCCCTAACGTCATAGACCACTTTATGTGTGATCTGAACCCTTTGCTCAATCTT
Canis_familiaris|8420               TTCTGTGATCCAAATGTCATAGATCATTTTATGTGTGATCTGAATCCTTTGATCAATCTT
Canis_familiaris|8433               TTTTGTGGTCCAAATGTCATAGATCATTTTATGTGTGATCTGAATCCTTTGCTCAATCTT
Macropus_eugenii|12245              TTCTGTGGTCCTAATGTCATTGACCATTTTATTTGTGATTTCTTTCCTTTGCTGAAACTT
Ornithorhynchus_anatinus|16857      TTCTGTGGCCCCAATGTGATCGATCACTTCATGTGTGATCTGTACCCTTTGCTGAAACTC
Echinops_telfairi|4282              TTCTGCGGCCCCAATATCATAGACCACTTCATGTGTGACTTGAACCCTTTGTTGAAGCTT
Rhesus_macaque|12555                TTCTGTGGCCCAAACATCATAGATCACTTCATGTGTGACTTGATCCCTCTGTTGAAACTC
Loxodonta_africana|10357            TTCTGTGGCCCCAATATCCTAGACCACTTATTGTGTGACTTGATTCCTTTATTGGAACTT
Loxodonta_africana|23520            TTCTGTGGCCCCAATGTCCTAGACCACTTCATGTGTGACTTGATCCCTTTGTTGGAACTT
Loxodonta_africana|23521            TTCTGTGGCCCCAGTGTCCTAGACCACTTCATGTGTGACTTGATCCCTTTGTTGGAACTT
Loxodonta_africana|10356            TTCTGTGGCCCCAATGTCCTAGACCACTTCATGTGTGACTTGATCCCTTTGTTGGAACTC
Choloepus_hoffmanni|440             TTCTGTGGTCCCAATGTCATAGACCATTTCATGTGTGACTTGAACCCTTTGTTAAAACTT
Oryctolagus_cuniculus|1856          TTTTGTGGTCCCAATGTCATAGACCATTTCATGTGTGACTTGAATCCTTTACTGAAACTT
Mus_musculus|22921                  TTCTGTGGTCCCAATGTCATAGACCACTTTATGTGTGACCTGACCCCTTTGCTGAAACTT
Rattus_norvegicus|22431             TTCTGTGGTCCCAATGTCATAGACCACTTTATGTGTGACCTGACCCCTTTGCTGAAACTT
Erinaceus_europaeus|4844            TTCTGTGGTCCCAATGTCATCGATCACTTCATGTGTGATTTGAATCCCCTGTTGAAACTA
Erinaceus_europaeus|2413            TTCTGTGGTCCCAATGTCATCGATCACTTCATGTGTGATTTGAATCCCCTGTTGAAACTA
Sus_scrofa|11416                    TTCTGTGGCCCCAATGTCATAGATCACTTCATGTGCGACTTGAACCCTTTGTTGAAACTA
Felis_catus|1160                    TTCTGTGGCCCCAATGTCATAGATCATTTCATGTGTGATTTGTACCCTTTATTGAAACTT
Canis_familiaris|8432               TTCTGTGGGCCCAATGTTATAGATCATTTCATGTGTGACTTAAACCCTTTGTTGAAACTT
Canis_familiaris|8419               TTCTGTGGGCCCAATGTTATAGATCATTTCATGTGTGACTTAAACCCTTTGTTGAAACTT
Monodelphis_domestica|24687         TTCTGTGGTCCCAATATTATAGATCACTTCATGTGTGACTTATTCCCTTTGCTCAATCTT
Macropus_eugenii|10461              TTCTGTGGTCCCAATGTCATAGATCATTTCATGTGTGATTTATTTCCTTTGCTCAATCTT
Monodelphis_domestica|24684         TTCTGCGGACCTAATGTCATAGATCACTTCATGTGTGACTTGAACCCTTTACTCAAACTT
Cavia_porcellus|7144                TTCTGTGGCCCAAATATCATAGACCACTTTATGTGTGACTTATACCCTTTGTTGAAACTC
Homo_sapiens|17636                  TTCTGTGGCCCCAATGTCATAGGCCACTTCATGTGTGACTTGTACCCATTGTTAAAACTT
Pan_troglodytes|6844                TTCTGTGGCCCCAATGTCATAGGCCACTTCCTGTGTGACTTGTACCCATTGTTAAAACTT
Sus_scrofa|11414                    TTCTGTGGCCCCAATGTCATAGATCACTTCATGTGTGACTTGTACCCTTTATTGAAACTT
Erinaceus_europaeus|4881            TTCTGTGGTCCCAATGTCATCGATCACTTCATGTGTGACTTGTACCCTTTGCTGAAACTC
Otolemur_garnettii|1429             TTCTGTGGCCCCAATGTCATAGACCACTTCATGTGTGACCTGTACCCTTTGCTGAACCTT
Microcebus_murinus|3048             TTCTGTGGCCCCAATGTCATAGACCACTTCATGTGTGACTTGTACCCTTTGCTGGACCTT
Bos_taurus|6619                     TTCTGTGGCCCCGATGTCATAGACCACTTCATGTGTGACTTGTACCCTTTGTTGAAACTT
Bos_taurus|6624                     TTCTGTGGCCCCGATGTCATAGACCACTTCATGTGTGACTTGTACCCTTTGTTGAAACTT
Procavia_capensis|8766              TTCTGTGGCCCCAATGTCATAGACCACTTCATGTGTGACTTGTATCCTTTGTTGAAACTT
Loxodonta_africana|10360            TTCTGTGGCCCCAATATCATAGACCACTTCATGTGTGATTTGTATCCCTTGTTGAAGCTT
Vicugna_pacos|1942                  TTCTGTGGCCCCAATGTCATAGATCACTTCATGTGTGACTTGTACCCTCTGTTGAAACTT
Canis_familiaris|8421               TTCTGTGGCCCTAATGTCATAGATCATTTCATGTGTGACTTGTACCCTTTGTTGAAACTT
Felis_catus|6205                    TTCTGTGGTCCCAATGTCATAGATCATTTCATGTGTGATTTGTACCCTTTATTGAAACTT
Ochotona_princeps|11681             TTCTGTGGCCCCAACATCATCGACCACTTCATGTGTGACTTGTACCCTCTGTTGAAACTC
Rattus_norvegicus|22434             TTCTGTGGCCCCAACATCATAGACCATTTTATGTGTGATTTGTACCCCTTGTTGGAACTT
Mus_musculus|22917                  TTCTGTGGCCCCAACATCATAGACCATTTTATGTGTGACTTGTACCCATTGTTGGAACTT
Mus_musculus|22928                  TTCTGTGGCCCCAACATCATAGACCATTTTATGTGTGACTTGTATCCATTGTTGGAACTT
Oryctolagus_cuniculus|1853          TTCTGTGGCCCCAACGTCATAGACCACTTCATGTGCGACCTGTACCCTTTGTTGAAACTT
Oryctolagus_cuniculus|1852          TTCTGTGGCCCCAATGTCATAGACCACTTCATGTGCGACCTGTACCCTTTGTTGAAACTT
Ornithorhynchus_anatinus|16863      TACTGTGGTCCCAATGTGATCGATCACTTCATGTGCGATCTGTTCCCTTTGCTGAAACTC
Ornithorhynchus_anatinus|16862      TTCTGTGGCCCCAATGTGATCGATCACTTCATCTGTGATTTGTTCCCTCTGTTGAGGCTC
Ornithorhynchus_anatinus|16865      TTCTGTGGCCGCAACACGATGGATCACTTCATGTGTGATCTATTCCCTTTGCTGACACTC
                                                                                                

Procavia_capensis|16277             GCCTACATGGATACTTATGTCATAAATCTACTCATAGTATTTAACAGTGGGGCCATATGC
Erinaceus_europaeus|13540           GCTTGTGCAGATACATTTATGGTCAACTTACTGTTGGTGTCCAACAGTGGGGCCATTTGT
Bos_taurus|28568                    GCCTGCATGGACACCCTCACCCTGGACCTCTTACTCATCCTCAACAGCAGAATGATGTGT
Dasypus_novemcinctus|13523          GCCTTCATGAATACCCACATCCTGGGACTCCTTGTCATCCTCAACAGTGGGGTGATGTGT
Mus_musculus|22888                  GCCTGCATGGACACCCATATCCTAGCTCTCTTAGTCATTCTCAACAGTGGGGTAATGTGT
Rattus_norvegicus|22406             GCCTGCACGGACACCCATATCCTGGATCTCTTAGTCATTCTCAACAGTGGGGTGATGTGT
Mus_musculus|22846                  GCCTGCATGGATACACATATCTTGGGTCTCTTAGTCATTCTGAACAGTGGGGTGATGTGT
Rattus_norvegicus|22366             GCCTGCATGGATACATATATCTTGGGTCTTTTAGTAATTTTGAATAGTGGGGTGATGTGT
Ochotona_princeps|15463             GCCTGCACAGACACTCACGTCCTTGGCCTCTTAGTCATCCTCAACAGCGGGGTGATGTGT
Homo_sapiens|17660                  GCCTGCACGGACACCCACATCCTGGGCCTCTTAGTTACCCTCAACAGTGGGATGATGTGT
Pan_troglodytes|8167                GCCTGCACGGACACCCACATCCTGGGCCTCTTAGTTACCCTCAACAGTGGGATGATGTGT
Otolemur_garnettii|13504            GCCTGCATGAACACCCACATCCTGGGCATCTTAGTCACCCTCAACAGTGGGGTGATGTGT
Microcebus_murinus|2797             ------------------------------------------------------------
Microcebus_murinus|5059             GCCTGCATGGATACCTCTATCCTGGGCCTCTTAGTCACCCTCAACAGTGGGGTGATGTGT
Microcebus_murinus|10664            GCCTGCATGGATACCTCTATCCTGGGCCTCTTAGTCACCCTCAACAGTGGGGTGATGTGT
Tupaia_belangeri|13856              GCCTGCATAGACACCCACACCCTGGGTCTCTTAGTCATCCTCAACAGTGGGGTGATGTGT
Choloepus_hoffmanni|6189            GCCTGCATGGACATGCATATCTTGGGCCTCCTAGTCATTCTCAACAGTGGGGGGATGTGT
Choloepus_hoffmanni|10987           GCCTGCATGGACACCCAGGTCCTGGGCCTCCTTGTCATTCTCAACAGTGGGGTGATGTGT
Felis_catus|6208                    GCCTGCATGGACACCCATGCCCTGGGTCTCTTAGTCATCCTCAACAGTGGGGTGATGTGT
Canis_familiaris|28898              GCCTGCATGGACACCCATACCCTGGGTCTCCTAGTCATCCTCAACAGTGGGGTGATGTGT
Canis_familiaris|28666              GCCTGCATGGACACCCATACCCTGGGTCTCCTAGTCATCCTCAACAGTGGGGTGATGTGT
Canis_familiaris|8394               GCCTGCATGGACACCCACACCCTGGGTCTCCTAGTCATCCTCAACAGTGGGGTGATGTGT
Canis_familiaris|8407               GCCTGCATGGACACCCACACCCTGGGTATCCTAGTCATCCTCAACAGTGGGGTGATGTGT
Loxodonta_africana|10342            GCCTGCATGGATACCTGCATTCTGGGCCTCTTGGTCATCCACAACAGTGGGGTGATGTGT
Loxodonta_africana|7429             GCCTGCATGGACACCCACATCCTGGGCCTTTTGGTCATTCTCAACAGTGGAGTGATGTGC
Loxodonta_africana|8250             GCCTGCATGGACACCCACATCCTGGGCCTTTTGGTCATTCTCAACAGTGGAGTGATGTGC
Loxodonta_africana|10841            GCCTGCATGGACACCTGCGTCCTGGGCCTCTTGGTCATCCTCAATAGTGGGGTGATGTGC
Loxodonta_africana|7347             GCCTGCATGGACAGCCGCATCCTGGGTTTG---GTCATCCTCAATAGTGGGGTGATGTAT
Loxodonta_africana|15374            GCCTGCATGGACACCCACATCCTGGGCTTCTTGGTCATCCTTAATAGTGGGGTGATGTGT
Loxodonta_africana|8254             GCCTGCATGGACACCCGCATCCTGGGCTTCTTGGTCATCCTCAATAGTGGCGTGATGTGT
Loxodonta_africana|10347            GCCTGCATGGACACCCGCATCCTGGGCTTCTTGGTCATCCTCAATAGTGGGGTGATGTGT
Dasypus_novemcinctus|5504           TCCTGTATTGACACTCACATCATTGGACCTTTTGTTGCCACCAACAGTGGGTTTATGTGT
Dasypus_novemcinctus|6826           TCCTGCATTGATACTCACATCCTAGGACTCTTTGTTGCTGCCAACACTGGCTTCATGTGT
Equus_caballus|5245                 TCCTGCACTGACACTCACATCTTTGGACTTTTTGTGGCTGCAAACAGTGGGCCGATGTGT
Echinops_telfairi|11116             TCCTGCACTGACACGTACATCTTTGGACTCTTTGTTACTGTCAACAGTGGACTGATGTGC
Echinops_telfairi|11654             GCTTGCATGGACACACACATCTTTGGACTCTTTGTTGCTGGCAACAGTGGACTGCTGTGT
Echinops_telfairi|10565             GCCTGCATGGACACACACATCTTTGGACTCTTTGTTGCTGCCAACAGTGGACTGATGTGT
Vicugna_pacos|1925                  TCCTGCACTGATACTCACATCTTTGGACTTTTTGTTGCTGCCAACAGTGGGCTGATGTGT
Dasypus_novemcinctus|6644           TCCTGCACTGATACTCACATCCTTGGACTCTTTGTTGCTGCCAACAGTGGGTTCATGTGT
Spermophilus_tridecemlineatus|10360 TCCTGCACAGACTCTTACATGTTTGATCTCTTTGTGGCTGCCAACAGTGGGCTGATGTGC
Cavia_porcellus|23431               TCCTGTGCTGACACCCAGGTCTTTGGACTCTTTGTTGCTGCCAACAGTGGGCTGATGTGT
Callithrix_jacchus|41201            TCCTGCACTGATACTCACATCTTCGGACTCCTTGTTGTCGCCAACAGTGGGCTGATGTGT
Mus_musculus|22929                  TCCTGCACTGACAACCACATCTTTGGACTCTTTGTTGCTGCCAACAGCGGGCTAATGTGT
Rattus_norvegicus|22435             TCCTGTACAGACAACCATATCTTTGGACTCTTTGTTGCTGCCAATAGTGGGTTAATGTGT
Equus_caballus|5271                 TCCTGCACTGATACTCACGTCCTTGGACTTTTTGTGGCTGCCAACAGTGGGCTGATGTAT
Sorex_araneus|6771                  TCCTGCACTGACACTCACATCTTTGGGCTTTTTGTTGCTGCCAACAGTGGGCTGATGTGT
Sus_scrofa|9827                     TCCTGCACTGACACTCACCTCTTTGGACTTTTTGTTGCTGCCAACAGTGGGCTGATGTGT
Loxodonta_africana|10361            TCCTGCACTGACACACACACCTTTGGACTCTTTGTTGCTGCCAACAGTGGGATGACGTGT
Homo_sapiens|17605                  TCCTGCACTGACACTCACGTCTTTGGACTCTTTGTTGCCGCCAACAGTGGGCTGATGTGT
Pan_troglodytes|6828                TCCTGCACTGACACTCACGTCTTTGGACTCTTTGTTGCCGCCAACAGTGGGCTGATGTGT
Canis_familiaris|8422               TCCTGCACTGATACTCACATCTTTGGACTTTTTGTCGCCGCCAACAGTGGGCTGATGTGT
Oryctolagus_cuniculus|1850          TCTTGCACTGACACTCACATCTTTGGACTCTTTGTTGCAGCCAACAGTGGACTGATGTGT
Otolemur_garnettii|13491            TCCTGCGCTGACACACACTTCTTTGGACTCTTTGTTGCTGCCAACAGTGGACTGATGTGC
Microcebus_murinus|9568             TCCTGCACTGACACTCATATCTTTGGACTCTTTGTTGCCGCCAACAGTGGGCTGATGTGT
Dasypus_novemcinctus|3289           TCCTGCACTGACACACACATCTTTGGCCTCTTTGTTGCTGCCAACAGTGGGTTCCTGTGT
Dasypus_novemcinctus|6897           TCCTGCAATGACCCTCACCTCATCGGACCCTTCGTTGCCACCAATAGTGGCTTCATGTGT
Dasypus_novemcinctus|15676          TCCTGCTCAGACACACACATCTTTGGCCTCTTTGTTGCTGTCAACAGTGGGTTCCTGTGT
Choloepus_hoffmanni|6218            TCCTGCACTGACACACACATCTTTGGACTATTGGTTGCCGCCAACAGTGGGTTCATGTGT
Spermophilus_tridecemlineatus|12911 GCCTGCACTGATACCCACACTCTGGGACTCTTCGTTGCTGCCAACAGTGGGTTCATCTGC
Bos_taurus|29294                    GCTTGCACTGATACAAACACTCTAGGGCTCTTTGTTGCTGCCAACAGTGGTTTAATCTGT
Bos_taurus|27626                    GCCTGCACTGATACTCACATTCTAGGACTATTTGTTGCTGCCAACAGTGGTTTCATTTGT
Sus_scrofa|11423                    GCTTGCACTGATACCCACACTCTAGGACTCTTTGTTGATCTAAACAGTGGTTTCCTATGC
Cavia_porcellus|21650               GCGTGCACTGATACCCACAGACTGCAATTATTTGGTGCTGCCAACAGTGGTTTCATCTGC
Rattus_norvegicus|22372             GCCTGTGTTGATACCCACATTCTAGGACTCTTTGTTGCTGCCAACAGTGGCTTCATCTGT
Rattus_norvegicus|22374             GCCTGTGTTGATACCCACATTCTAGGACTCTTTGTTGCTGCCAACAGTGGCTTCATCTGT
Bos_taurus|29733                    GCCTGCACTGATACCCACACTCTAGGACTCTTTGTTGCTGCCAACAGTGGGTTCATCTGT
Sus_scrofa|11396                    GCCTGCACTGACACCCATACTTTAGGGCTCTTTGTTGCTGCCAACAGTGGTTTCATCTGT
Sus_scrofa|11395                    GCCTGCACTGATACCCACACTCTAGGGCTCTTTGTTGCTGCCAACAGTGGATTCATCTGT
Sus_scrofa|11400                    GCCTGCACTGATACTCACACTCTAGGGCTCTTTGTTGCTGCCAACAGTGGATTCATCTGT
Sus_scrofa|11399                    GCTTGCACTGATACCCACACTCTAGGGCTCGTTGTTGCTGCCAACAGTGGATTCATCTGT
Choloepus_hoffmanni|258             GCCTGCACTGATACCCACACTCTAGGGCTTTTTGTAGCTGCTAACAGTGGGTTCATCTGC
Monodelphis_domestica|24688         GCCTGCACTGACACTCATACCCTTGGTCTATTTGTTGCAGCCAACAGTGGTTTCATCTGC
Monodelphis_domestica|24689         GCCTGCACTGACACTCATATCCTTGGTCTGTTTGTTGCAGCCAATAGTGGTTTCATCTGC
Monodelphis_domestica|24691         GCCTGCACTGACACTCATATCCTTGGTCTGTTTGTTGCAGCCAATAGTGGTTTCATTTGC
Callithrix_jacchus|41212            GCCTGCACTAATACCCACTCTCTAGGACTGTTTGTTGCTGCCAACAGTGGGCTCATATGC
Homo_sapiens|17635                  GCCTGCACTAATACCCACACTCTAGGACTCTTCATTGCTGCCAACAGTGGGTTCATATGC
Equus_caballus|5278                 GCCTGCACTGATACCCACACTCTAGGGCTCTTTGTTGCTGCCAACAGTGGATTAATCTGT
Canis_familiaris|8369               GCCTGCACTGATACCCACACTCTTGGGTTCTTTGTTGCTGCCAACAGTGGTTTCATCTGT
Canis_familiaris|8352               GCCTGCACTGATACCCACACTCTTGGGTTCTTTGTTGCTGCCAACAGTGGTTTCATCTGT
Canis_familiaris|8363               GCCTGCACTGATACCCACACTCTTGGGTTCTTTGTTGCTGCCAACAGTGGTTTCATCTGT
Bos_taurus|6622                     GCCTGCACTGATACCCACACTCTAGGGCTCTTTGTCGCTGCCAACAGTGGGTTCATCTGC
Mus_musculus|22922                  GTATGCACCGATACTCACACTCTTGGAATCTTTGTTGCAGCCAACAGTGGTTTTATTTGT
Rattus_norvegicus|22432             GTCTGCACCGATACACACACTCTTGGACTCTTTGTTGCAGCCAACAGTGGCTTCATTTGT
Bos_taurus|6627                     GCCTGCACTGATACGCACACGCTAGGGCTCTTCATTGCTGCCAACAGTGGCTTCATCTGT
Sus_scrofa|11415                    GCCTGCACTGATACCCACACTCTGGGGCTCTTTGTTGCTGCCAACAGTGGGTTCATCTGT
Sus_scrofa|11413                    GCCTGCACTGATACCCACACTCTGGGGCTCTTTGTTGCTGCCAACAGTGGCCTCATCTGT
Sus_scrofa|9826                     GCCTGCACTGATACCCACACTCTGGGGCTCTTTGTTGCTGCCAACAGTGGCCTCATCTGT
Sus_scrofa|11406                    GCCTGCACTGATACCCACACTCTGGGGCTCTTTGTTGCTGCCAACAGTGGTCTCATCTGT
Sus_scrofa|11409                    GCCTGCACTGATACCCACACTCTAGGGCTCTTTGTTGCTGCCAACAGTGGTCTCATCTGT
Erinaceus_europaeus|4256            GCTTGCATGGACACCCACACCCTAGGGCTTTTTGTTGCTGCCAACAGTGGATTTCTCTGT
Procavia_capensis|7897              GCCTGCACTGATACCCACACTCTAGGGCTCTTCGTTGCTGCCAACAGTGGGTTCATCTGC
Loxodonta_africana|10358            GCCTGCACTGATACTCACATTCTAGGGCTCTTTGTTGCTGCCAACAGTGGCTTCATCTGC
Echinops_telfairi|7364              GCCTGCACTGATACCCACACTCTAGGGCTCTTTGTTGCTGCCAACAGTGGGTTCCTCTGC
Loxodonta_africana|10359            GCCTGCACTGATACTCACATTCTAGGACTCTTTGTTGCTGCCAACAGTGGGTTCATCTGC
Procavia_capensis|11271             GCCTGCACTGATACCCACACTCTAGGGCTCTTCGTTGCTGCCAACAGTGGGTTCATCTGC
Mus_musculus|22924                  GCATGCACTGATACCCACATTCTGGGGCTCTTTGTTGCTGCCAACAGTGGTTTTATTTGT
Oryctolagus_cuniculus|1855          GCCTGTACTGACACCCATACTCTTGGACTCTTTGTTGCTGCTAACAGTGGATTCATCTGT
Homo_sapiens|17643                  GCCTGCACTGACACCCATATGCTGGAACTCTTCATTGCTGCCAACAGTGGATTCATCTGC
Oryctolagus_cuniculus|1854          GCCTGTACCGATACCCATACTCTTGGACTCTTTGTTGCTGCCAACAGTGGGTTCATCTGT
Callithrix_jacchus|41203            GCCTGCACTGACACCCACACACTGGGACTCTTCGTTGCTGCCAACAGTGGATTCATCTGC
Spermophilus_tridecemlineatus|2389  GTCTGCACTGACACCCACACTCTGGGGCTCTTTGTTGCTGCCAACAGTGGGTTCATCTGC
Felis_catus|31463                   GCCTGCACTGATACCCACACTCTAGGCCTCTTCGTTGCTGCCAACAGTGGATTCATCTGT
Canis_familiaris|8420               GCCTGCACTGATACCCACACTTTAGGGCTCTTCGTTGCTGCCAACAGTGGATTCATCTGT
Canis_familiaris|8433               GCCTGCACTGATACCCACACTTTAGGGCTCTTCGTTGCTGCCAACAGTGGATTCATCTGT
Macropus_eugenii|12245              GCCTGTACCGATACTCACCCCTTTGCTCTCTTTATTGCTGCCAATAGTGGCATAATGTGT
Ornithorhynchus_anatinus|16857      GCCTGCAGCGACACCCGAAACCTCGGTCTCTTTGTAGCGGCCAATAGCGGGTTGATCTGC
Echinops_telfairi|4282              GTCTGCATGGACACTCATACCCTTGGTCTCTTTGTTGCTGCCAACAGTGGATTCATATGT
Rhesus_macaque|12555                GTCTGCATGGACACTTATACCCTTGGTCTCTTTGTTGCTGGCAACAGTGGATTTGTCTGC
Loxodonta_africana|10357            GTTTGCATGGACACTCATACCTTTGGTCTCTTTGTTGCTGCTAACAGTGGATTCATATGC
Loxodonta_africana|23520            GTTTGCATGGACACTCATACTCTTGGTCTCTTTGTTGCTGCTAACAGTGGATTCATATGC
Loxodonta_africana|23521            GTTTGCATGGACACTCATACCCTTGGTCTCTTTGTTGCTGCTAACAGTGGATTCATATGC
Loxodonta_africana|10356            ATTTGCATGGGCACTCATATCCTTGGTCTCTTTGTTGCTGCCAACAGTGGATTCATATGC
Choloepus_hoffmanni|440             GTCTGCATGGATACCCATATCCTTGGTCTCTTTGTTGCTGCCAACAGTGGGTTTATCTGT
Oryctolagus_cuniculus|1856          GTCTGCATGGACACCCATACCCTTGGTCTCTTTGTAGCTGCCAACAGTGGGTTCATCTGT
Mus_musculus|22921                  GTTTGTATGGACACACACAACCTGGGTCTCTTTGTTGCTGCCAACAGTGGCTTTATCTGC
Rattus_norvegicus|22431             GTCTGTATGGACACACGCAACCTGGGTCTCTTTGTTGCTGCCAACAGTGGCTTTATCTGC
Erinaceus_europaeus|4844            GTCTGCATGGACACTCATACCCTCGGCCTCTTTGTGGCTGCCAACAGTGGGTTCATCTGT
Erinaceus_europaeus|2413            GTCTGCATGGACACTCATACCCTCGGCCTCTTTGTG------------------------
Sus_scrofa|11416                    GTCTGCATGGACACTCACACCCTTGGTCTTTTTGTTGCGGCCAATAGTGGGCTCATCTGC
Felis_catus|1160                    GTCTGCATGGACACTCATACCCTTGGTCTCTTTGTTGCTGCCAATAGTGGGTTCATCTGT
Canis_familiaris|8432               GTCTGCATGGACACTCATACCCTTGGTCTCTTTGTTGCTGCCAATAGTGGGTTCATCTGT
Canis_familiaris|8419               GTCTGCATGGACACTCATACCCTTGGTCTCTTTGTTGCTGCCAATAGTGGGTTCATCTGT
Monodelphis_domestica|24687         GCTTGTATGGATACCTATGCCCTGGGTTTCTTTGTTGCAGCCAATAGTGGGTTAATCTGC
Macropus_eugenii|10461              GTTTGCATGGATACTCATGCCTTGGGTCTACTTGTTGCAGCAAACAGTGGTTTCATCTGT
Monodelphis_domestica|24684         GTCTGTATAGACACCCATAATCTTGGCCTATTTGTTGCAGCAAATAGTGGTCTCATCTGC
Cavia_porcellus|7144                GTCTGCATGGACACTCACACTGTTGGTCTGTTTGTTGCTGCCAACAGT------------
Homo_sapiens|17636                  GTTTGCATAGACACTCATACCCTTGGTCTCTTTGTTGCTGTGAACAGTGGGTTTATCTGC
Pan_troglodytes|6844                GTTTGCATAGACACTCATACCCTTGGTCTCTTTGTTGCTGTGAACAGTGGGTTTATCTGC
Sus_scrofa|11414                    GTCTGCATGGACACTCAAACCCTTGGCCTCTTTGTTGTAGCCAACAGTGGGTTCATCTGT
Erinaceus_europaeus|4881            GTCTGCATGGACACTCAT------------------------------------------
Otolemur_garnettii|1429             GTCTGCACAGACACTCACACCCTTGGTCTCTTTGTGGCCGCCAACAGCGGGTTCATCTGC
Microcebus_murinus|3048             GTCTGCATGGACACTCATACCCTTGGTCTCTTTGTTGCTGCTAACAGCGGGTTCATCTGC
Bos_taurus|6619                     GTCTGTGTGGACACCCACATCCTTGGTCTCTTTGTTGCTGCCAACAGTGGGTTCATCTGC
Bos_taurus|6624                     GTCTGTGTGGACACCCACATCCTTGGTCTCTTTGTTGCTGCCAACAGTGGGTTCATCTGC
Procavia_capensis|8766              GTCTGCAGGGACACTAAGACCCTTGGTCTCTTTGTTGCTGCCAACAGTGGATTCATATGC
Loxodonta_africana|10360            GTCTGCATGGACACTCATACCCTTGGTCTCTTTGTTGCTGCCAATAGTGGATTCATATGC
Vicugna_pacos|1942                  GTCTGCATGGACACTCATACACTTGGTCTCTTTGTTGCAGCCAACAGTGGGCTCATCTGC
Canis_familiaris|8421               GTTTGCATGGACACTCATACCCTTGGTCTCTTTGTTGCTGTCAACAGTGGTTTCATCTGC
Felis_catus|6205                    GTCTGCATGGACACTCACACCCTTGGTCTCTTTGTTGCTGTCAACAGTGGGTTCATCTGT
Ochotona_princeps|11681             GTGTGCAGGGACACTCACCTCCTTGGTCTCTTTGTAGCTGCCAACAGTGGACTCATCTGC
Rattus_norvegicus|22434             GTCTGCATGGACACACACACCCTTGGTCTCTTTGTTGCTGCCAACAGTGGGTTCATCTGC
Mus_musculus|22917                  GTTTGCATGGACACACACACTCTTGGTCTCTTTGTTGCTGCCAACAGTGGGTTCATCTGC
Mus_musculus|22928                  GTTTGCATGGACACACACATCCTTGGTCTCTTTGTGGCTGCCAACAGTGGGTTCATCTGC
Oryctolagus_cuniculus|1853          GTCTGCACGGACACACACATCCTTGGTCTCTTTGTTGCTGCCAACAGTGGCCTCATCTGC
Oryctolagus_cuniculus|1852          GTCTGCACGGACACACACATCCTTGGTCTCTTTGTTGCTGCCAACAGTGGCCTCATCTGC
Ornithorhynchus_anatinus|16863      GCCTGCACCGACACCCACATCTTCGGTCTGCTAGCCGTGGCCAACAGCGGGGCGATGTGC
Ornithorhynchus_anatinus|16862      GCTTGCACTGACACCCAGGTCCGTGGCCTGTTGGTTGTGGCCAACAGTGGGGCGATGTGT
Ornithorhynchus_anatinus|16865      AGTTGCTCCGAAACCCAGGTCCTCGGTCTGCTCGTCGTGGCCAACAGCGGGGCCATGTGC
                                                                                                

Procavia_capensis|16277             ATGGTGAGTTTTGTCATCCTGATCATCTCCTATATTTTCATCTTACACTCTCTGAGTAAC
Erinaceus_europaeus|13540           GCAGTGAGTTTTGTCATTCTTATGTTGTCTTATGTCATCATTTTGCATTCTCTGAGGAAA
Bos_taurus|28568                    GTTACCATCTTCCGGATTCTCATCACCTCCTATGTGGTCATTCTCTGCTCTGTGAAGTCC
Dasypus_novemcinctus|13523          GTGAACATCTTCTCTGTGCTCATTGCCTCCTATGTGGTCATCCTCTGCTCCCTGAGGTCT
Mus_musculus|22888                  GTGACCATTTTCCTTATTCTCATCACTTCCTATGTAGTAATCCTCTGTTCCCTAAAGTCT
Rattus_norvegicus|22406             GTAACTATTTTCCTTATTCTCATCACTTCCTATGTAGTTATCCTCTGCTCCTTGAAGTCT
Mus_musculus|22846                  GTCTCCATTTTCCTTATTCTCATTGCTTCCTACATGGTCATTCTCTGCTCCCTTAAGTCT
Rattus_norvegicus|22366             GTTTCCATTTTCCTTATTCTCATTGCTTCCTACATTGTCATCCTATGCTCCCTTAAATCT
Ochotona_princeps|15463             GTGAGCATCTTCCTCACTCTCCTTATCTCCTATGCGTTCATCCTCTTCTCCCTGAAGTCT
Homo_sapiens|17660                  GTGGCCATCTTTCTTATCTTAATTGCGTCCTACACGGTCATCCTATGCTCCCTGAAGTCT
Pan_troglodytes|8167                GTGGCCATCTTTCTTATCTTAATTGCGTCCTACATGGTCATCCTATGCTCCCTGAAGTCT
Otolemur_garnettii|13504            ACAGCCATCTTCCTTGTCTTAATTGCTTCCTACATGATCATCCTCTGTTCCCTGAAGTCT
Microcebus_murinus|2797             ------------------------------------------------------------
Microcebus_murinus|5059             CTGACCATCTTCCTTATCCTAATTGCCTCCTACACAGTCATCCTATGTTCCCTGAAATCC
Microcebus_murinus|10664            GTGGCCATCTTCCTCATCCTAATTGCCTCCTACACTGTCATTCTATGTTCCCTGAAGTCT
Tupaia_belangeri|13856              ATAGCTATCTTCTTTATCCTAATTGCTTCATATATAGTTATCTTTTGTTCCCTGAAATCT
Choloepus_hoffmanni|6189            GTGACCATCTTCTTTATGCTCATTGCCTCCTACGTGGTCATCCTCTGCTCTCTGAGGTTT
Choloepus_hoffmanni|10987           GTGACCATCTTCTTTATGCTCATTGCCTCCTACATGGTCATCCTCTGCTCCCTGAGGTCT
Felis_catus|6208                    GTGACCATCTTCCTTATCCTCGTGGCCTCCTACGTGGTCATCCTCTGCTCCCTGAAGTCT
Canis_familiaris|28898              ATGACCATCTTCCTTATTCTCATTGCCTCCTACGTGGTCATCCTCTGCTCTCTGAAGTCT
Canis_familiaris|28666              ATGACCATCTTCCTTATTCTCATTGCCTCCTACGTGGTCATCCTCTGCTCTCTGAAGTCT
Canis_familiaris|8394               ATGACCATCTTCCTTATTCTCATTGCCTCCTACGTGGTCATCCTCTGCTCTCTGAAGTCT
Canis_familiaris|8407               ATGACCATCTTCCTTATCCTCATCACCTCCTACATGGTCATCCTCTGCTCTCTGAAGTCT
Loxodonta_africana|10342            GTGACCATCTTCCTTACCCTCATGGTCTCCTACGTGGTCATCCTCTGCTCCCTGAAGTCT
Loxodonta_africana|7429             GTGACAATATTCCTTATCCTGATTGCCTCCTATGTGGTCATCCTCTGCTCCCTGACATCT
Loxodonta_africana|8250             ATGACAATATTCCTTATCCTGATTGCCTCCTATGCAGTCATCCTCTGCTCCCTGACATCT
Loxodonta_africana|10841            GTGACCATCTTTCTTATCCTCATTGTCTCCTACATGATCATCCTCTGCTCTTTGAAGTCT
Loxodonta_africana|7347             GTGACCATCTTTCTTATCCTCATTGTCTCCTACATGATCATCCTCTGCTCCTTGAAGTCT
Loxodonta_africana|15374            GTGACCATCTTTCTTATCCTCATTGTCTCCTACATGATCATCCTCTGCTCCTTGAAGTCT
Loxodonta_africana|8254             GTGACCATCTTTCTTATCCTCATTGTCTCCTACATGATCATCCTCTGCTCCTTGAAGTCT
Loxodonta_africana|10347            GTGACCATCTTTCTTATCCTCATTGTCTCCTACATGATCATCCTCTGCTCCTTGAAGTCT
Dasypus_novemcinctus|5504           TTGCTTAGTTTTTCTATTCTTATTACTTCCTATGTCCTCATCCTTTGCTCA---------
Dasypus_novemcinctus|6826           GCGCTCATTTTTTCTATTCTTATTACCTCCTATGTCCTCATCCTTTGCACC---------
Equus_caballus|5245                 ATGCTCATTTTTTCTATTCTTATCTCCTGCTATATCCTCATCCTGTGCTCTCTAAGAAGG
Echinops_telfairi|11116             ATGCTCATTTTCTCTTTTCTGATCACCTCCTATGTAATCATTCTTTGTTCA---------
Echinops_telfairi|11654             TTGCTCATTTTCTCTTTTCTGATCACCTCTTATGGCCTCATTCTTTGCTCA---------
Echinops_telfairi|10565             ATGCTCATTTTCTCTTTTCTGGTCACCTCCTATGTCCTCATTCTTTGTTCA---------
Vicugna_pacos|1925                  ATGCTTATCTTTTCCATTCTTATCACCTCCTACATTCTCATCCTTTGCTCA---------
Dasypus_novemcinctus|6644           ATGCTCACTTTTTCTATTCTTATCACCTCCTATGTCCTAATCCTTTGCTCA---------
Spermophilus_tridecemlineatus|10360 ATGCTCATTTTTGCTATTCTCATCACCTCCTATGTCCTCATCCTTTGCTCA---------
Cavia_porcellus|23431               GTGCTCATTTTTGCTGTTCTTGTCACCTCCTATGTCCTCATCCTCTGCTCTCTGAAGACT
Callithrix_jacchus|41201            ATGCTCATTTTCTCTTTTCTTATTAGCTCATATGTCCTAATCCTCTGCTCACTAAAGACT
Mus_musculus|22929                  ATGCTAATTTTTTCTATTCTTCTCACCTCTTATGTACTCATCTTTTGCTCTCTAAAGACT
Rattus_norvegicus|22435             ATGCTAATTTTTTCTATTCTTCTCACCTCTTACGTGCTCATCTTTTGCTCTCTAAAGACT
Equus_caballus|5271                 ATGCTTATTTTTTTTATTCTTATCACCTCCTTT---------------------------
Sorex_araneus|6771                  ATGCTGATTTTCTCAATTCTCATCGCATCTTATATCCTCATCCTCTGCTCG---------
Sus_scrofa|9827                     ATGGTCATCTTTTCTATTCTTACTGCCTCCTACGTCCTCATCCTTTGCTCACTGAGAACG
Loxodonta_africana|10361            ATGCTCGTATTCTCTATTCTTATCACCTCGTATGTCCTCATCCTTTGCTCCCTAAGAACT
Homo_sapiens|17605                  ATGCTCATTTTTTCTATTCTTATTACCTCTTACGTCCTAATCCTCTGCTCA---------
Pan_troglodytes|6828                ATGCTCATTTTTTCTATTCTTATTACCTCTTACGTCCTAATCCTCTGCTCA---------
Canis_familiaris|8422               CTGCTCATTTTTTCTATTCTTGTCACCTCCTATGTCCTCATCCTTTACTCTCTAAGAACT
Oryctolagus_cuniculus|1850          CTGATCATCTTTTCCATTCTTATCACCTCCTATGTTCTCATCCTTTGCTCCCTAAAGGCT
Otolemur_garnettii|13491            ATGCTCATTTTTTCTATTCTTATCGCCTCCTATGTCCTCATCCTTTGCTCA---------
Microcebus_murinus|9568             ATGCTCATTTTTTCTATTCTTATCACCTCCTATGTCCTCATCCTTTGCTCA---------
Dasypus_novemcinctus|3289           ATGTTCTGTTTTCTTCTTCTTATCACCTCCTACGTCCACATCCTTTGGTCA---------
Dasypus_novemcinctus|6897           TTACTCAGTTTTTCTATTCTTATTACATCCTATGTCCTCATCCTTTGCTCA---------
Dasypus_novemcinctus|15676          ATGCTCAGTTTCTCTATTCTTATCACTTCCTATATCCTCATCCTTTGCTCA---------
Choloepus_hoffmanni|6218            ATGCTCAGTTTTTCTATTCTTATCACCTCCTATGTCCTCATTCTTTACTCA---------
Spermophilus_tridecemlineatus|12911 CTGTTAAACTTCCTCCTGAGGCTCATCTTTTATGTG------------TCCCTGAGGACC
Bos_taurus|29294                    CTGTTAAACTTCTTTCTCTTGCTTGTCTCCTATGTGGCCATCCTTTACTCCCCAAAGACC
Bos_taurus|27626                    CTTATAAACTTCATCCTCTTGATGGGCTCCTATGTGGTCATTCTGCACTCCCTAAGGAAC
Sus_scrofa|11423                    CTGGTAAACTTTGTCTTCTTGATTGGCTCCTATGTGCTCATCCTGCTCTCCCTAAGGACC
Cavia_porcellus|21650               CTGTTACAATTTTTCCTGCTGTTGGTCTCTTACATGGTCATCCTGCGCTCCCTAAGAACC
Rattus_norvegicus|22372             CTGTTGAACTTCCTCCTACTGCTTGTCTCCTACCTGGTCATCCTTCACTCCCTAAAGAAC
Rattus_norvegicus|22374             CTGTTAAACTTCCTCCTACTGCTTGTCTCCTACCTGGTCATCCTTCACTCCCTAAAGAAC
Bos_taurus|29733                    CTGTTAAACTTCCTTCTCTTGATGGGCTCTTATGTGGTCATTCTGCACTCCCTAAGGACC
Sus_scrofa|11396                    CTGTTAAATTTCCTCCTCTTGATGGGTTCCTATGTGGTCATCCTGAACTCACTAAGGACC
Sus_scrofa|11395                    CTGTTAATTTTCCTAATCTTGGTTGGCTCCTATGGGGTCATCCTTCACACCCTTAGCACC
Sus_scrofa|11400                    CTGTTAAACTTCCTACTCTTGCTTGGCTCCTACGGGGTGATCCTTCACACCCTTAGGACC
Sus_scrofa|11399                    CTGTTAATCTTCCTACTCTTGGTTGGATCCTATGGGGTCATCCTTAACTCCTTAAGGAAG
Choloepus_hoffmanni|258             CTGTTAAATTTCATCCTCTTGCTGGTCTCCTACGTGGTCATCCTGTACTCCCTAAGGAAC
Monodelphis_domestica|24688         TTATTAAACTTCCTCATGTTGATGGTCTCCTATGTTGTCATTCTGTGCTCTCTGAAGACT
Monodelphis_domestica|24689         TTATTAAACTTTCTCTTATTAATGGGCTCCTATGTGGTCATCTTGAGCTCTCTGAAGACT
Monodelphis_domestica|24691         TTATTAAACTTTCTCTTATTAATGGGCTCCTATGTGGTCATCTTGAGCTCTCTGAAGACT
Callithrix_jacchus|41212            CTGCTAAATTTTCTCTTGCTCCTGGTCTCCTATGTGATTATACTGTACTCCCTAAGGACC
Homo_sapiens|17635                  CTGTTAAACTGTCTCTTGCTCCTGGTCTCCTGCGTGGTCATACTGTACTCCTTAAAGACC
Equus_caballus|5278                 GTGTTAAACTTCCTCTTCTTGTTGGTCTCCTATGTGGTTATCCTGCGCTCCCTAAAGACC
Canis_familiaris|8369               GTCTTAAACTTCCTCCTCCTCATGGTTTCCTATGTGGTCATTCTGCGCTCCCTAAAGAAC
Canis_familiaris|8352               GCCTTAAACTTCCTCCTCCTCATGGTCTCCTATGTGGTCATTCTGCACTCCCTAAGGAAC
Canis_familiaris|8363               GCCTTAAACTTCCTCCTCCTCATGGTCTCCTATGTGGTCATTCTGCGCTCCCTAAGGAAC
Bos_taurus|6622                     CTATTAAACTTCCTCCTTTTGATGGTCTCCTATGTGGTCATCTTGCGTTCCCTGAGGACC
Mus_musculus|22922                  CTGCTAAACTTCCTTCTTCTATTGGTCTCCTATGTTGCCATCCTGCGCTCCCTAAAGAAC
Rattus_norvegicus|22432             CTGCTAAACTTCCTTCTTNTGTTGGTCTCCTATGTTGCCATCCTGCGCTCCCTAAAGAAC
Bos_taurus|6627                     CTGTTAAACTTCCTTCTCCTGCTGGTCTCGTACATGGTCATCTTGCGTTCCCTAAGGGCC
Sus_scrofa|11415                    CTTTTAAACTTCCTTCTCCTGCTGGTCTCCTATGTGGTCATTCTGTGCTCTCTAAGGACC
Sus_scrofa|11413                    CTTTTAAACTTCCTTCTCCTGCTGGTCTCCTATGTGGTCATTCTGCGCTCCCTAAGGACC
Sus_scrofa|9826                     CTTTTAAACTTCCTTTTCCTGCTGGTCTCCTATGTGGTCATTCTGTGCTCCCTCAGGACC
Sus_scrofa|11406                    CTTTTAAACTTCCTTCTCCTGCTGGTCTCCTATGTGGTCATTCTGCGCTCCCTAAAGACC
Sus_scrofa|11409                    CTTTTAAACTTCCTTTTCCTGCTGGTCTCCTATGTGGTCATTCTGTGCTCCCTAAGGACC
Erinaceus_europaeus|4256            GCCTTAAACTTCCTCCTCTTGATGGTTTCCTATGTGGTCATTCTATGCTCTTTAAGAACC
Procavia_capensis|7897              CTGTTAAACTTTCTCCTCTTGCTGATTTCCTATGTGGTTATCCTGTACTCTTTGAAAAAC
Loxodonta_africana|10358            TTGTTAAACTTTCTCCTCTTGCTGGCCTCCTACGTGGTCATCCTGTGCTCCTTAAGGACC
Echinops_telfairi|7364              CTGTTAAACTTTCTCCTCTTGCTAATCTCCTATGTGGTCATCCTGTGCTCTCTAAGGACC
Loxodonta_africana|10359            CTGTTAAACTTTATCCTCTTGCTGGTCTCCTATGTGGTCATCCTGTGCTCCTTAAGGACC
Procavia_capensis|11271             CTGTTAAACTTTCTCCTCTTGCTGATCTCCTATGCGGTCATCCTGAGCTCATTAAGGACC
Mus_musculus|22924                  CTGTTGAACTTCCTCCTTCTGTTGGTCTCCTATGTGGTCATTCTACGTTCATTAAGAAAC
Oryctolagus_cuniculus|1855          TTATTGAACTTCCTTCTCTTGCTGGTCTCCTATGTGGTCATCCTGCGCTCCCTAAGGTCT
Homo_sapiens|17643                  TTGTTAAACTTTGCCCTCCTGCTGGTCTCCTATGTGGTCATCTTGTGCTCCCTAAGGACT
Oryctolagus_cuniculus|1854          CTATTGAACTTCCTTCTCTTGTTGGTCTCCTATGTGGTCATCCTGCGCTCTCTAAGGACC
Callithrix_jacchus|41203            TTGTTAAACTTTGTTCTCCTGCTGATCTCCTATGTGGTCATCTTGCGCTCCCTAAGGACC
Spermophilus_tridecemlineatus|2389  CTGTTAAATTTCCTCCTCCTGATGGTCTCCTACGTGGCTATCCTGCGCTCCCTGAGGACC
Felis_catus|31463                   CTGTTAAACTTCCTCCTCTTGATGGTCTCCTATGTGGTCATTCTGCGCTCCCTAAGGAAC
Canis_familiaris|8420               CTGTTAATCTTCCTCCTCTTAATGGTCTCCTATGTGGTCATTCTATGCTCCCTCTGGAAT
Canis_familiaris|8433               CTGCTAAACTTCCTCCTCTTAATGGTCTCCTATGTGGTCATTCTACGCTCCCTCCGGAAT
Macropus_eugenii|12245              TTGCTAATATTCATTATGCTACTTACCTCTTATATTCTCATCTTTTACTCCCTGAAAACA
Ornithorhynchus_anatinus|16857      TTGTTCAATTTCTTCCTGTTGACGCTTTCCTATGTCATCATCTTACGCTCCCTGAAAACT
Echinops_telfairi|4282              TTGTTAAACTTCCTCCTCCAGAAGGTCTTCTATGTTGTCATTCTGCGGTACCTAAGGACC
Rhesus_macaque|12555                CTGTTGAACTTTCTCCTCTTGATTGTGTCTTATGTGGTCATCCTATATAATCTGAAATCT
Loxodonta_africana|10357            TTGTTAAACTTCCTCCTCTTGGTGGTCTCTTATGTGGTCATCCTGCGCTCCCTAAAGGCC
Loxodonta_africana|23520            TTGTTAAACTTCCTCCTCTTGGTGGTCTCCTACATGGTCATCCTGTGCTCCCTAAGGTCC
Loxodonta_africana|23521            TTGTTAAACTTCCTCCTCTTGGTGGTCTCCTATGTGGTCATCCTGCACTCCCTAAGGGCC
Loxodonta_africana|10356            TTGTTAAACTTCCTTCTTTTGGTGGTCTCCTATGTGGTCATCTTGCACTCCCTAAGGGCC
Choloepus_hoffmanni|440             CTGTTAAACTTCCTCCTTTTGATGGTTTCTTATGTGGCCATCCTGTATACTTTGAAATCT
Oryctolagus_cuniculus|1856          CTGTTGAACTTTTTCCTCTTGATGGCCTCTTACGTGGTCATCCTATGTACTCTGAAATCT
Mus_musculus|22921                  CTGTTAAACTTTCTACTTCTGATGATCTCTTATATAGTCATCCTCGATGCTCTAAAATCT
Rattus_norvegicus|22431             CTGTTAAACTTTCTACTTCTGATGATCTCATATGTAGTCATCCTCGATGCTCTGAAATCT
Erinaceus_europaeus|4844            TTATTAAATTTCCTCCTTTTGATGGTCTCCTATGTGGTCATCTTGCATTCCCTAAGGAAC
Erinaceus_europaeus|2413            ------------------------------------------------------------
Sus_scrofa|11416                    TTGTTAAACATCCTGTGTTTGATGGTCTCCTACGTCGTGATCCTGCACTCCCTAAGGACC
Felis_catus|1160                    TTGTTAAACTTCCTTCTTTTGGTGGTTTCCTATGTGGTCATCTTGCTCTCCCTAAAGACC
Canis_familiaris|8432               TTGTTAAACTTTCTCCTTTTGGTGGTCTCCTACATGGTCATTTTGCACTCTCTAAGGACC
Canis_familiaris|8419               TTGTTAAACTTTCTCCTTTTGGTGGTCTCCTACATGGTCATTTTGCACTCCCTAGGGACC
Monodelphis_domestica|24687         CTTTTAAACTTTCTCCTCTTGATAGCTTCCTATGTAGTCATACTGACATCCCTGAAATCT
Macropus_eugenii|10461              CTCTTGAACTTCCTTCTCTTGATGGCTTCCTATGTGGTTATCCTGACCTCCCTAAAATCT
Monodelphis_domestica|24684         CTGTTAAACTTTCTCCTTTTGATGGCTTCCTATGCTGTCATCCTTAATTCTTTGAAATCT
Cavia_porcellus|7144                ------------------------------TATGTGATCATCTTGTGTTCCCTAAGAAAC
Homo_sapiens|17636                  TTATTAAACTTCCTTATCTTGGTGGTATCCTATGTGATCATCTTGAGATCTTTAAAGAAC
Pan_troglodytes|6844                TTATTAAACTTCCTTATCTTGGTGGTATCCTATGTGATCATCTTGAGATCTTTAAAGAAC
Sus_scrofa|11414                    CTACTTAATTTGCTCCTCTTGTTGGTCTCATATGCAGTTATCTTGTGCTCCCTAAAGCAC
Erinaceus_europaeus|4881            ------------------------------------------------------------
Otolemur_garnettii|1429             CTGCTGAACTTCCTCCTCTTG---------------------------------------
Microcebus_murinus|3048             CTGTTAAGCTTCTTCCTCTTG---------------------------------------
Bos_taurus|6619                     CTGTTAAACTTCCTGCTCCTGTTGGTCTCCTATGTAGTCATCTTGAGCTCCCTAAAGAGC
Bos_taurus|6624                     CTGTTAAACTTCCTCCTCCTGTTGGTCTCCTATGTGGTCATCTTGAGCTCCCTAAAGAGC
Procavia_capensis|8766              TTGTTAAACTTCCTCCTCTTGATGGTCTCATATGTGGTCATTCTGCACTCCCTAAGGACC
Loxodonta_africana|10360            TTGTTAAACTTCCTCCTCTTGATGGTCTCCTATGTGGTCATCCTGCACTCTCTAAGGGCC
Vicugna_pacos|1942                  CTGTTAAACTTCCTCCTCTTG---------------------------------------
Canis_familiaris|8421               CTTTTAAACTTCCTCCTATTGGTGGTGTCCTATGTGGTCATCCTGTACTCCCTAAAGAAC
Felis_catus|6205                    CTTTTAAACTTCCTCCTCTTG---------------------------------------
Ochotona_princeps|11681             CTGTTAAATTTCCTGCTGTTGGTGTGTTCCTATGTGATCATCTTGTGCACTCTAAGGAGC
Rattus_norvegicus|22434             CTATTTAACTTCCTGCTCTTGATGGGATCCTATGTGATCATCTTGCGCTCTCTGAAGAAC
Mus_musculus|22917                  CTATTTAATTTCCTGCTCTTGATGGGATCCTATGTGATCATCTTGCGCTCTTTAAAGAAC
Mus_musculus|22928                  CTATTTAATTTCCTGCTCTTGATGGGATCCTATGTGATCATCTTGCGCTCTTTAAAGAAC
Oryctolagus_cuniculus|1853          CTGTTGAATTTTCTCCTCTTGGTGGCTTCCTATGTGATCATCTTGCGTGCTCTAAAGAAC
Oryctolagus_cuniculus|1852          CTGTTGAATTTTCTCCTCTTGGTGGCTTCCTATGTGATCATCTTGCGTGCTCTAAAGAAC
Ornithorhynchus_anatinus|16863      ACTTTGAGTTTTTTTCTTTTGGTCATTTCTTACGTCGTCATCTTCCGTTCCCTGAAAAAT
Ornithorhynchus_anatinus|16862      ACTTTAAGTTTTCTCCTACTGGTCTTTTCTTATGTCATCATCTGGAGCTCCTTGAGGACT
Ornithorhynchus_anatinus|16865      ATGTTAAGTTTTTTCCTTTTGGTGGTTTCTTACATTGTCATCTTGCATTCCCTGAAAGCT
                                                                                                

Procavia_capensis|16277             AAGAGCGCAGAAGGAAGAAAGAAAGCCCTCTCTACCTGTACCTCCCACATTATCGTTCTG
Erinaceus_europaeus|13540           CACAGTGCTGAAGGGAGGAGAAAAGCCCTCTCCACTTGTGTCTCCCACATCACTGTGGTC
Bos_taurus|28568                    TGCAGCTCCAAAGGGTGGCGTAAAGCCCTCTCCACCTGTGGCTCTCACCTCATGGTGGTC
Dasypus_novemcinctus|13523          TGCAGCTCTGAAAGGTGGCACAAAGCTCTCTCCACCTGTGGCTCACACCTCATCATGGTT
Mus_musculus|22888                  TCCAGCTCTGAAGGAAGGCGGAAAGCTCTCTCCACATGTAGCTCTCACTTCACAGTGGTT
Rattus_norvegicus|22406             CGCAGCTCTGAAGGAAGACGCAAAGCTCTCTCCACATGTAGTTCTCACTTCACAGTGGTT
Mus_musculus|22846                  TATAGTTCTGAAGGGAGACGCAAAGCCCTCTCTACATGTAGCTCACATTTCACAGTGGTT
Rattus_norvegicus|22366             TATAGTTCTGAAGGGAGACGCAAAGCTCTCTCTACATGTAGCTCACATTTCACAGTGGTT
Ochotona_princeps|15463             TGCAGCTCAGAAGGCCGGCGCAAAGCCTTCTCCACCTGTGGCTCCCACCTCATGGTGGTT
Homo_sapiens|17660                  TACAGCTCTAAAGGGCGGCACAAAGCCCTCTCTACCTGCAGCTCCCACCTCACGGTGGTT
Pan_troglodytes|8167                TACAGCTCTAAAGGGCGGCACAAAGCCCTCTCTACCTGCAGCTCCCACCTCACGGTGGTT
Otolemur_garnettii|13504            TATAGCTCTGAAGGACAGCGCAAAGCCCTCTCCACCTGTGCCTCCCACCTCACGGTGGTC
Microcebus_murinus|2797             ------------------------------------------------------------
Microcebus_murinus|5059             TGTAGCTCTGAAGGGCGGCGCAAAGCCCTCTCCACCTGTGGCTCCCACCTCACAGTGGTT
Microcebus_murinus|10664            CACAGCTCTGAAGGGCGGCGCAAAGCCCTCTCCACCTGCAGCTCCCACCTCACAGTGGTT
Tupaia_belangeri|13856              TACAGTTCTGAAGGGCAGCTCAAAGCCCTCTCCACCTGTGGCTCCCACCTCACAGTGGTC
Choloepus_hoffmanni|6189            TGCAGTTCTGAACGGAGGCGCAAAGCCCTCTCCACCTGTGGCTCTCACCTCACAGTGGTC
Choloepus_hoffmanni|10987           TGCAGCTCTGAAGGGCGGTTCAAAGCCCTCTCCACCTGTGGCTCTCACCTCACAGTGGTC
Felis_catus|6208                    TGCAGCTCTGCGGGGCGGCGCAAAGCCCTGTCGACCTGTGGCTCCCACCTCACTGTGGTC
Canis_familiaris|28898              TGCAGCTCTGAAGGGTGGCGCAAAGCCATCTCCACCTGTGGCTCCCACCTCACCGTGGTT
Canis_familiaris|28666              TGCAGCTCTGAAGGGCGGCGCAAAGCCATCTCCACCTGTGGCTCCCACCTCACCGTGGTT
Canis_familiaris|8394               TGCAGCTCTGAAGGGCGGCGCAAAGCCTTCTCCACCTGTGGCTCCCACCTCACCGTGGTT
Canis_familiaris|8407               TGCAGCTCTGAAGGGCGGCGCAAAGCCTTCTCCACCTGTGGCTCCCACCTCACCGTGGTT
Loxodonta_africana|10342            TGCAGCTCTGAAGGGTGGCGCAAAGCCCTCTCCAGCTGTGGCTCCCACCTCACAGTGATT
Loxodonta_africana|7429             TGCAGCTCTGAAGGGCGGTACAAAGCTCTCTCCACTTGTGGTTCCCACCTCATGGTGGTC
Loxodonta_africana|8250             TGCAGCTCTGAAGGGCGGTACAAAGCTCTCTCCACTTGTGGTTCCCACCTCATGGTGGTC
Loxodonta_africana|10841            TATAGCTCTGAAGGATGGCGCAAAGCCCTGTCTACCTGTGGCTCCCACCTCACAGTGATT
Loxodonta_africana|7347             TGTAGCTCTGAAGGGCAACACAAAGCCCTGTGTACCTGTGGCTCCCACCTCACAGTGATC
Loxodonta_africana|15374            TGTAGCTCTGAAGGGCGACACAAAGCCCTGTCTACCTGTGGCTCCCATCTCACAGTGATC
Loxodonta_africana|8254             TGTAGCTCTGAAGGGCGACACAAAGCCCTGTCTACCTGTGGCTCCCATCTCACAGTGATC
Loxodonta_africana|10347            TGTAGCTCTGAAGGGCGACACAAAGCCCTGTCTACCTGTGGCTCCCACCTCACAGTGATC
Dasypus_novemcinctus|5504           ---------------CGACGGAAGGCTTTCTCTACCTGTGCCTCACATATTACTGTGGTT
Dasypus_novemcinctus|6826           ---------------CGGCGGAAGGCTCTCTCTACCTGTGCCCCACATATTACCGTGGTC
Equus_caballus|5245                 CACAGCACTGAAGGACAGCAGAAGGCTCTCTCCACCTGCACCTCCCATGTTACTGTAGTC
Echinops_telfairi|11116             ---------------CAACAAAAGGCACTTTCCACCTGTACAACCCATATTACTGTAGTG
Echinops_telfairi|11654             ---------------CAACAAAAGGCTCTTTCCACTTGTACATCCCATATTACTGTAGTC
Echinops_telfairi|10565             ---------------CAGCAGAAGGCTCTTTCCACCTGTGCCTCCCATATTACGGTAGTG
Vicugna_pacos|1925                  ---------------CAACGGAAGGCTCTCTCCACGTGTGCCTCCCATGTTACTGTAGTC
Dasypus_novemcinctus|6644           ---------------CAGCGAAAGGCTCTCTCCACCTGTGCCTCCCATATTACTGTAGTC
Spermophilus_tridecemlineatus|10360 ---------------CAGAAGAAAGCTCTCTCCACCTGTGCCGCCCACATTGCTGTAGTC
Cavia_porcellus|23431               CGCAGCACCGCAGAACAGTGGAAGGCTCTGTCCACCTGTGCTGCCCACATCACTGTGGTC
Callithrix_jacchus|41201            CACAGCACAGAAGGACAGCGGAAGGCTCTCTCTACCTGCACCTCTCATATCACTGTAGTC
Mus_musculus|22929                  CATAGCACTGAAGAACAGCTGAAGGCTCTCTCCACCTGTGCCTCCCATATTACAGTGGTC
Rattus_norvegicus|22435             CACAGCACTGAAGAACAGCTGAAGGCTCTTTCCACCTGTGCTTCCCATATTACAGTGGTC
Equus_caballus|5271                 ------------------------------------------------------------
Sorex_araneus|6771                  ---------------CAGTGGAAGGCTCTCTCTACCTGTGCCTCTCATGTTACTGTCGTC
Sus_scrofa|9827                     CACAGCCCTGAGGGACAGCGGAAAGCTCTCTCCACCTGTGCCTCCCATGTTACCGTAGTC
Loxodonta_africana|10361            TACAGCTCTGAAGGGCAACGGAAGGCTCTTTCCACCTGTGCCTCCCATATTACTGTAGTC
Homo_sapiens|17605                  ---------------CAGCGGAAGGCTCTCTCTACCTGCGCCTTCCATATCACTGTAGTC
Pan_troglodytes|6828                ---------------CAGCGGAAGGCTCTCTCTACCTGCGCCTCCCATATCACTGTAGTC
Canis_familiaris|8422               CACAGTACTAAAGGACAGCGTAAGGCTCTCTCTACCTGTGCCTCCCATGTTACAGTAGTT
Oryctolagus_cuniculus|1850          CACAAAGTTGAAGAACAGCAAAAGGCTCTCTCGACCTGTGCCTCCCACATCACTGTAGTC
Otolemur_garnettii|13491            ---------------CAACGGAAGGCTTTCTCCACCTGTGCCTCCCATATCACTGTAGTC
Microcebus_murinus|9568             ---------------CAGCGGAAGGCTCTCTCCACCTGTGCCTCCCATATCACTGTAGTC
Dasypus_novemcinctus|3289           ---------------CAACAGAAGGCTCTCTCCACCTGCGCTTCACATATTTCTGTGGTT
Dasypus_novemcinctus|6897           ---------------CGGCGGAAAGCTCTCTCCACGTGTGCCTCACATATTATTGTGGTT
Dasypus_novemcinctus|15676          ---------------CGGCGGAAGGCTCTCTCCACTTGTGCCTCACATATTACTGTCGTT
Choloepus_hoffmanni|6218            ---------------CGGCAGAAGGCTCTCTCAACCTGTGCCTCCCATATTACTGTGGTT
Spermophilus_tridecemlineatus|12911 CACAGCCTGGAGAGTGGGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Bos_taurus|29294                    TACAGTTTGGAGGCAGGACACAAAGCCCTCTCCACCTGCATCTCCCACGTCACAGTGGTT
Bos_taurus|27626                    CACAGTTTGGAGGCAGGGCGCAAGGCCCTCTCCACTTGTGTCTCCCACATCACAGTTGTC
Sus_scrofa|11423                    CACAGCTTGGAGGCTAGGTACAAGGCCCTCTCCACTTGTGTTTCCCACATCATAGTTGTC
Cavia_porcellus|21650               CACAGGCTGGAGGGAAGGAGCAAAGCTCTCTCCACCTGTGCCTCTCACATCACAGTGGTT
Rattus_norvegicus|22372             CACAGTGCAGAAGGAAGGCGCAAAGCTCTCTCTACCTGCGTTTCTCACATTACAGTGGTG
Rattus_norvegicus|22374             CACAGTGCAGAAGGAAGGCGCAAAGCTCTCTCTACCTGTGTTTCTCACATTACAGTGGTG
Bos_taurus|29733                    TACAGCTTGGAGGCGAGGCAAAAAGCCCTCTCCACCTGCATCTCCCACATCACAGCAGTT
Sus_scrofa|11396                    CAGAGCTTGGAGGCAAGGCAAAAAGCCCTCTCTACCTGTGTCTCCCACATCACAGCAGTC
Sus_scrofa|11395                    CAAAGCTTGGAGGCCAGACGCAAAGCCCTCTCTACCTGTGTCTCCCACATCACAGCAGTT
Sus_scrofa|11400                    CAAAGCTTGGAGGCCAGACGCAAAGCCCTCTCTACCTGTGTCTCCCACATCACAGCAGTT
Sus_scrofa|11399                    CAATGCTTGGAGGCCAGACGCAAAGCCCTCTCTACCTGTGTCTCCCACATCACAGCAGTT
Choloepus_hoffmanni|258             CACAGTTTGGATGGTAGGCATAAAGCCCTGTCCACCTGTGTCTCCCACGTCTCAGTGGTT
Monodelphis_domestica|24688         CACAGTGTGGAGGGGAGACGTAAGGCCCTCTCCACCTGTGGGTCCCACATCACTGTAGTT
Monodelphis_domestica|24689         CACAGTGTGGAGGGGAGACGCAAGGCCCTCTCCACTTGTGGCTCCCACATCACTGTAGTT
Monodelphis_domestica|24691         CACAGTATGGAGGGGAGATGCAAGGCCCTTTCCACTTGTGGTTCCCACATCACTGTAGTT
Callithrix_jacchus|41212            CACAGCTTGGAGGCAAGGCACAAAGCCCTCTCTACCTGTATCTCCCACATCACAGTTGTC
Homo_sapiens|17635                  CACAGCTTAGAGGCAAGGCACGAAGCCCTCTCTACCTGTGTCTCCCACATCACAGTTGTC
Equus_caballus|5278                 TACAGCTCAGAGGCAAGGCGCAAAGCACTGTCCACCTGTGTCTCCCACATCACAGTGGTC
Canis_familiaris|8369               CACAGCTTGGAGGCGAGGCGCAAAGCCCTCTCCACCTGTGTCTCTCACATCACAGTGGTC
Canis_familiaris|8352               CACAGCTTGGAGGCGAGACTCAAAGCCCTCTCCACCTGTGTCTCCCACATCACAGTGGTC
Canis_familiaris|8363               CACAGCTTGGAGGCGAAGCGCAAAGCCCTCTCCACCTGTGTCTCCCACATCACAGTGGTC
Bos_taurus|6622                     CACAGCTTAGAGGCAAGGCGCAAGGCTCTCTCCACCTGTGTCTCCCACATCACCGTGGTT
Mus_musculus|22922                  CACAGTGCAGAGGGAAGGCGCAAAGCCCTCTCTACCTGTATTTCACACATAACAGTGGTT
Rattus_norvegicus|22432             CACAGTGCAGAGGGAAGGCGCAAAGCCCTCTCTACCTGTATTTCACACATAACAGTAGTT
Bos_taurus|6627                     TACAGCTTGGAAGCAAGACGAAAAGCCCTCTCCACCTGCATCTCCCACATCACAGTGGTC
Sus_scrofa|11415                    TACAGCTTGGAGGCGAGGCGCAAAGCCCTCTCCACCTGTGTTTCCCACATCACTGTAGTT
Sus_scrofa|11413                    TACAGCTTGGAGGCTAGGCACAAAGCCCTCTCCACCTGCATCTCCCACATCACAGTGGTT
Sus_scrofa|9826                     TACAGCTTGGAGGCGAGGCACAAAGCCCTCTCCACCTGCATCTCCCACATCACAGTGGTT
Sus_scrofa|11406                    TATAGCTTGGAGGCAAGGCACAAAGCCCTCTCCACCTGCATCTCCCACATCACAGTGGTT
Sus_scrofa|11409                    TACAGCTTGGAGGCAAGGCACAAAGCCCTCTCCACCTGCATCTCCCACATCACAGTGGTT
Erinaceus_europaeus|4256            AAAAGCTTAGAGGCCAGGCACAAAGCCCTCTCCACCTGTATTTCCCACATTACTGTGGTG
Procavia_capensis|7897              CACAGCTTAGAAGGGAGGCGTAAAGCCCTCTCAACCTGTGTTTCCCACATCACAGTGGTT
Loxodonta_africana|10358            CACAGCTTAGAGGGGAGGCGTAAAGCTCTCTCAACTTGTGTTTCCCACATCACAGTGGTC
Echinops_telfairi|7364              CATAGCTTGGAGGGGAGGCGTAAAGCTCTCTCAACATGTGTTTCCCACATCACAGTGGTC
Loxodonta_africana|10359            CACAGCTTAGAGGGGAGGCGTAAAGCTCTCTCAACTTGTGTTTCCCACATCACAGTGGTT
Procavia_capensis|11271             CATAGCTTGGAGGGAAGGCGGAAAGCCCTCTCAACTTGTGTTTCTCACATCACAGTGGTT
Mus_musculus|22924                  CACAGTGCAGAGGGGAGGCGCAAAGCCCTCTCCACTTGTGTCTCCCACATAACAGTTGTT
Oryctolagus_cuniculus|1855          CACAGCTTGGAGGGAAGGCGGAAAGCCCTCTCCACCTGTGTTTCCCACATCACAGTGGTT
Homo_sapiens|17643                  CATAGCTTGGAGGCAAGGCACAAAGCCCTCTCCACCTGTGTCTCCCACATCACGGTTGTC
Oryctolagus_cuniculus|1854          CACAGTTTGGAGAGCAGGCGGAAAGCCCTCTCTACCTGTGTTTCCCACATCACAGTGGTT
Callithrix_jacchus|41203            CACCGCTTGGAGGCAAGGCGCAAAGCCCTCTCCACCTGTGTCTCCCACGTCACAGTTGTT
Spermophilus_tridecemlineatus|2389  CACAGCCTGGAGAGTAGGCGCAAAGCCCTGTCCACCTGTGTCTCCCACATCACAGTGGTT
Felis_catus|31463                   CACAGCTTGGAGGCAAGGCGCAAAGCCCTCTCCACCTGTGCCTCCCACATCACGGTGGTC
Canis_familiaris|8420               CACAACTTGGAGGCAAAGCGCAAAGCCCTCTCCACCTGTGTCTCCCACATCACAGTGGTT
Canis_familiaris|8433               CACAACTTGGAGGCAAAGCGCAAAGCCCTCTCCACCTGTGTCTCCCACATCACAGTGGTC
Macropus_eugenii|12245              CATAATTCAGAAGGAAGGCAAAAAGCCCTCTCTACCTGTGTTTCCCACATTACTGTGGTC
Ornithorhynchus_anatinus|16857      CACAGCTTGGAAGGGAGACGCAGAGCCCTCTCCACCTGCATCTCCCACATCACTGTTGTT
Echinops_telfairi|4282              CACAGCCTCGAGGGTAGGCGCAAAGCTCTCTCCACC------------------------
Rhesus_macaque|12555                CACAGCTTGGAGGGGAGGCGCAAAGCCCTCTCCACCTGTGTATCTCATATCACTGTAGTC
Loxodonta_africana|10357            CATAGCTTGGAGGGGAGGCGCAAAGCCCTTTCCACCTGTGCCTCTCACATCACAGTGGTC
Loxodonta_africana|23520            CATAGCTTGGAGGGGAGGCGCAAAGCCCTTTCCACCTGTGCCTCTCACATCGCAGTGGTC
Loxodonta_africana|23521            CATAGCTTGGAGGGGAGGCGCAAAGCCCTTTCCACCTGTGCCTCTCACATCACAGTGGTC
Loxodonta_africana|10356            CATAGCTTGGAAGGGAGGTGCAAAGCCCTTTCCACCTGTGTCTCTCACATCACAGTAGTC
Choloepus_hoffmanni|440             CACAGCTTGGAGGGGAGACGCAAAGCCCTGTCCGCCTGTATCTCACACATCACTGTGGTC
Oryctolagus_cuniculus|1856          CACAGCTTGGAGGGAAGACGCAAAGCCCTCTCCACCTGTGTCTCTCATATCACCGTGGTC
Mus_musculus|22921                  CACAGCAAGGAGGGAAGGTGCAAAGCCCTCTCCACCTGTGTCTCTCACATTACTGTGGTC
Rattus_norvegicus|22431             CACAGCAAGGAGGGAAGGCGCAAAGCCCTCTCTACTTGTGTCTCTCACATTACTGTGGTC
Erinaceus_europaeus|4844            TATAGCTTGGAGGGAAGGCACAAAGCTCTTTCCACCTGTGTCTCTCACATCACCGTGGTC
Erinaceus_europaeus|2413            ------------------------------------------------------------
Sus_scrofa|11416                    TACAGCTTGGAGGGGAGACGCAAAGCCCTCTCTACCTGTGCTTCTCACATCTCCGTGGTC
Felis_catus|1160                    TATAGCTTGGAGGGGAGACGCAAAGCCCTCTCTACCTGCGTCTCTCACATCACCGTGGTC
Canis_familiaris|8432               TACAGCTTGGAGGGGAGACGTAAAGCCCTCTCTACCTGTGTCTCTCACATCACCGTGGTC
Canis_familiaris|8419               TACAGCTTGGAGGGGAGACGTAAAGCCCTCTCTACCTGTGTCTCTCACATCACTGTGGTC
Monodelphis_domestica|24687         CATAGTCAGAAGGGGAGGCTCAAAGCCCTCTCCACCTGTGTCTCCCATATCACAGTAGTC
Macropus_eugenii|10461              CGCAGTCTGGAAGGGAGACTCAAAGCCCTCTCTACCTGTGTCTCCCATATAACTGTGGTC
Monodelphis_domestica|24684         CACAGCCTAGAAGGCAGACGCAAAGCCCTCTCGACTTGTGTGTCTCACATTACTGTTGTT
Cavia_porcellus|7144                TATAGCTTAGATGGGAGGAAGAAAGCCCTCTCCACCTGTGTATCCCATATTACAGTGGTT
Homo_sapiens|17636                  AATAGCTTGGAGGGGAGGTGTAAAGCCCTCTCCACCTGTATTTCTCACATCATAGTAGTT
Pan_troglodytes|6844                AATAGCTTGGAGGGGAGGTGTAAAGCCCTCTCCACCTGTATTTCTCACATCATAGTAGTT
Sus_scrofa|11414                    TATAGCTTGGAGGGTAGGCGCAAAGCCCTTTCCACTTGTGTCTCTCACATCACTGTAGTT
Erinaceus_europaeus|4881            ------------------------------------------------------------
Otolemur_garnettii|1429             ------------------------------------------------------------
Microcebus_murinus|3048             ------------------------------------------------------------
Bos_taurus|6619                     TATAGCCTGGAGGGGAGACGCAGAGCCCTCTCTACGTGTGTCTCTCACATCACAGTAGTT
Bos_taurus|6624                     TATAGCCTGGAGGGGAGACGCAGAGCCCTCTCTACGTGTGTCTCTCACATCACAGTAGTT
Procavia_capensis|8766              CGTAGCTTGGAGGGGAGGCACAAAGCTCTCTCCACGTGTGTCTCTCACATCACAGTGGTT
Loxodonta_africana|10360            CACAGCTTGGAGGGAAGGCACAAAGCCCTTTCCACCTGTGTCTCTCACATCACAGTTGTC
Vicugna_pacos|1942                  ------------------------------------------------------------
Canis_familiaris|8421               TATAGCTTGGAGGGGAGGCGCAAAGCACTTTCCACCTGTGTCTCTCACATTACAGTGGTT
Felis_catus|6205                    ------------------------------------------------------------
Ochotona_princeps|11681             TACAGCGTGGAAGGCAGGCGTAAAGCCCTCTCCACCTGTGTCTCTCACATCACAGTGGTT
Rattus_norvegicus|22434             TATAGCTTAGAGGGCAGGCGCAAAGCCCTCTCCACCTGTGTGTCTCACATCACAGTGGTA
Mus_musculus|22917                  TATAGCTTAGAAGGCAGGCGCAAAGCTCTCTCCACCTGTGTGTCACACATCACAGTAGTT
Mus_musculus|22928                  TATAGCTTAGAGGGCAGGCGCAAAGCCCTCTCCACCTGTGTGTCTCATATCACAGTGGTA
Oryctolagus_cuniculus|1853          TATAGCCTGGAGGGGAGGCGCAAAGCCCTCTCCACCTGTGTATCTCACATCACCGTGGTT
Oryctolagus_cuniculus|1852          TATAGCCTGGAGGGGAGGCGCAAAGCCCTCTCCACCTGTGTATCTCACATCACCGTGGTT
Ornithorhynchus_anatinus|16863      CAGAGTTCTCCAGGGAGACGCAAAGCTCTTTCCACTTGCGTCTCCCACGTCATCGTTGTG
Ornithorhynchus_anatinus|16862      CACAGTTCTGCAGGGAGACGGAAAGCCCTCTCTACCTGTGTCTCCCACATTGTCGTGGTC
Ornithorhynchus_anatinus|16865      CACGTTTCTTCAGGGAGACGCAAGGCCCTTTCGACTTGTGTCTCCCACATCACCGTGGTC
                                                                                                

Procavia_capensis|16277             ATCTTATTCTTTGTTCCGTGTATAGTCACGTACATGCGCTCTCCGATCACTTTTCCAGTG
Erinaceus_europaeus|13540           ATCATGTTCTTTGTTCCTTGTATATTTATCTACACGCGCCCTGCAACCACCTTCCCCATG
Bos_taurus|28568                    ATTATGTTCTTTGTGCCTTGCATTTTCTTGTTTTTGAGGCCTGTGGTCACTTACCTAATA
Dasypus_novemcinctus|13523          GACTTGTTCTTTGTGCCATGTATCTTCCTGTACATGTGGCCTATTGCCACTTACCCCATA
Mus_musculus|22888                  GTGTTGTTCTTTGTACCTTGTATTATCTTGTACATGAGGCCTGTGGTCACTTATCCTATA
Rattus_norvegicus|22406             GTGCTGTTCTTTGTACCTTGTATCTTCTTGTACATGAGGCCTGTGGTCACTTACCCTGTA
Mus_musculus|22846                  GTATTGTTTTTTGTGCCATGTATTTTCTTATATATGAGGCCTGTGGTGACATTCCCAATA
Rattus_norvegicus|22366             GTGTTGTTTTTTGTGCCATGTATTTTCTTATATATGAGGCCTGTGGTGACATTTCCAATA
Ochotona_princeps|15463             GTGTTGTTCTTTGTGCCCTGCATTTTCCTGTACATGAGGCCCGTGGTCACTTACCCCATA
Homo_sapiens|17660                  GTATTGTTCTTTGTCCCCTGTATTTTCTTGTACATGAGGCCTGTGGTCACTCACCCCATA
Pan_troglodytes|8167                GTATTGTTCTTTGTCCCCTGTATTTTCTTGTACATGAGGCCTGTGGTCACTCACCCCATA
Otolemur_garnettii|13504            ATCTTGTTCTTTGTGCCGTGTATTTTTTTGTACATGATGCCTGTGGTCACTTATCCCATA
Microcebus_murinus|2797             ------------------------------------------------------------
Microcebus_murinus|5059             GTGTTGTTCTTCGTGCCGTGTATTTTCTTGTACATGAGGCCTGTAGTCACTTACCCTATT
Microcebus_murinus|10664            GTGTTGTTCTTCGTGCCATGTATTTTCTTGTACATGAGGCCTGTAGTCACTTACCCTATT
Tupaia_belangeri|13856              ATGTTGTTTTTTGTGCCATGTATTTTCTTGTATGTGAGACCTGTGGCTACCTACCCCATA
Choloepus_hoffmanni|6189            GTCTTGTTCTTTGTGCCCTGTATCTTCTTGTACATGAGGCCTGTGGCCACTTACCCCATA
Choloepus_hoffmanni|10987           GTCTTGTTCTTTGTGCCATGTATCTTCTTGTACATGAGGCCTGTGGCCACTCACCCCATA
Felis_catus|6208                    ATCTTGTTCTTCGTGCCCTGCATTTTCCTGTACGTGCGGCCTGTGGCCACTTACCCCATA
Canis_familiaris|28898              GTCTTGTTCTTTGTGCCATGCATTTTCCTGTACGTGCGGCCTGTGGCCACCTACCCCATT
Canis_familiaris|28666              GTCTTGTTCTTTGTGCCATGCATTTTCCTGTACGTGCGGCCTGTGGCCACCTACCCCATT
Canis_familiaris|8394               GTCTTGTTCTTTGTGCCATGCATTTTCCTGTACGTGCGGCCTGTGGCCACCTACCCCATT
Canis_familiaris|8407               GTCTTGTTCTTTGTGCCATGCATTTTCCTATATGTGCGGCCTGTGGCCACGTACCCCATT
Loxodonta_africana|10342            GTCTTGTTCTTTGTGCCATGCATTTTCTTGTATGTAAGACCATTGGCCACTTATCCCATA
Loxodonta_africana|7429             GTCTTGTTCTTTGTGCCATGCATTTTCTTGTATGTAAGACCTGTCACCACTTATCCCATA
Loxodonta_africana|8250             GTCTTGTTCTTTGTGCCATGCATTTTCTTGTATGTAAGACCTGTGACCACTTATCCCATA
Loxodonta_africana|10841            GTCTTGTTCTTTGTGCCATTTGTTTTCTTG---GTAACACCTGTGGCCACTTATCCCATA
Loxodonta_africana|7347             GTCTTGTTCTTTGTGCCATGCATTTTC---TTCGTAAAGCCTGTGGCCACTTATCCCATA
Loxodonta_africana|15374            GTCTTGTTCTTTGAGCCATGCATTCTCTTCTATGTAAGGCCTGTGGCCACTTATCCCATA
Loxodonta_africana|8254             ATCTTTTTCTTTGTGCCATGCATTTTCTTCTATGTGAGGCCTGTGGCCACTTATCCCATA
Loxodonta_africana|10347            GTCTTGTTCTTTGTGCCATGCATTTTCTTCTATGTAAGGCCTGTGGCCACTTATCCCATA
Dasypus_novemcinctus|5504           GTCTTATTCTTCGTGCCCTGTTTATTTGTGTATCTTCGACCCATGAGCACCTCCCACATT
Dasypus_novemcinctus|6826           ATCTTACTTTTTGTGCCCTGTATGTTTATATACCTTCGGCCCACGGGCACCTTTCCCATT
Equus_caballus|5245                 ATTCTATTATTTGTCCCCTGTATATTTGTGTACCTTCGGCCCATGATCAACTTCCCCATT
Echinops_telfairi|11116             ACCTTATTCTTTGTACCCTGCATATTTGTGTACCTGCGACCCACAATCACCTTCTCCATT
Echinops_telfairi|11654             ACCTTATTCTTTGTACCCTGTATATTTGTGTACCTTCGACCCACAATCACCTTCCCCATT
Echinops_telfairi|10565             ACCTTATTCTTTGTACCCTGTATATTTGTATACCTTCGACCCACAATCACCTTGCCCATT
Vicugna_pacos|1925                  GCCCTGTTCTTTGTACCCTGTATATTCGTGTACCTTCGGCCCATGGTCACCTTCCCTACT
Dasypus_novemcinctus|6644           ACCTTATTCTTTGTGCCCTGTATATTCGTGTACCTTCGGCCCATGAGCACCTTCCCCATT
Spermophilus_tridecemlineatus|10360 ATCCTCTTCTTTGTACCTTGTATATTCATGTACTTTCGGCCCATGGTCATCTTTCCCATT
Cavia_porcellus|23431               ATCTTGTTCTTTGTGCCCTGTATATTCGTGTACCTTCGGCCCATGGTCACCTTCCCCATT
Callithrix_jacchus|41201            GTCCTGTTCTTTGTTCCCTGTCTGTTCGTGTACCTTCGTCCCGTGATCACCTTCCCTATT
Mus_musculus|22929                  CTCTTATTCTTTGTACCCTGCATATTCGTTTACCTTAGGCCCATGGTCATCTTCCCCTTT
Rattus_norvegicus|22435             CTCCTATTCTTTGTACCCTGCATATTCGTTTACCTTAGGCCCACAGTCATCTTCCCCTTT
Equus_caballus|5271                 ------------------------------------------------------------
Sorex_araneus|6771                  GTCCTATTCTTTGTGCCTTGTATATTTGTGTACCTTCGGCCTATGGTCACCTTCCCCATT
Sus_scrofa|9827                     ATCCTGTTCTTTGTACCGTGTATGTTCGTGTACCTTCGGCCCATGACCACCTTCCCCATT
Loxodonta_africana|10361            GTCTTATTCTTTGTACCCTGTATATTTGTGCACCTTCGGCCCATGGTCACCTTCCCCATT
Homo_sapiens|17605                  GTCCTATTCTTTGTTCCCTGTATATTGGTGTACCTTCGACCCATGATCACCTTCCCTATT
Pan_troglodytes|6828                GTCCTATTCTTTGTTCCCTGTATATTGGTGTACCTTCGACCCATGATCACCTTCCCTACT
Canis_familiaris|8422               GTCCTATTCTTTGTACCCTGTATATTCGTGTACCTTAGGCCCATGGTCACCTTCCCCATC
Oryctolagus_cuniculus|1850          ATCCTGTTCTTTGTACCATGTATATTTGTATACCTTCGGCCCATGATCACCTTCTCCATT
Otolemur_garnettii|13491            GTCCTATTCTTTGTACCCTGTATATTCGTGTACCTTCGGCCCATGATCACCTTCCCCATT
Microcebus_murinus|9568             GTCCTATTCTTTGTACCCTGTATATTCGTGTACCTTCGGCCCATGATCACCTTCCCCGTT
Dasypus_novemcinctus|3289           GTCTTATTCTTTGTGCCCTGTATATTTGTATACCTTCGACCCATGACCACCTTCCCCATT
Dasypus_novemcinctus|6897           GTCTTATTCTTTGTGCCTTGCATATTTGTGTACATCCGGCCCATGAGCACTTTCCCCATT
Dasypus_novemcinctus|15676          GTCTTATTCTTTGTACCCTGTACATTTGAATACCTTCGACCCATGACTACTTTCCCCTTT
Choloepus_hoffmanni|6218            GTATTATTCTTTGTGCCCTGCATATTTGTATACCTTCGTCCCATGACCACCTTCCCCATT
Spermophilus_tridecemlineatus|12911 NNNNNNTTCTTTGTTCCCTGCATATTTGTGTACATGAGACCTCCAGCTAATTTACCCATT
Bos_taurus|29294                    GTCTTATTCTTTGTGCCCTGCACATTTGTGTACATGAGACCTGCAGCTACTTTACCTATT
Bos_taurus|27626                    ACCATGCTCCTTGTGCCCTGCATTTTTGTATATCTGAGACCACCAGTTTCTTTACCAATT
Sus_scrofa|11423                    ATCCTATTCTTTGTGCCCTGCATATTTGTGTACCTGAGACCTGCAGCTAATTTACCTATT
Cavia_porcellus|21650               GTCTTATACTTTGTCCCCTGCATCATTGTATATGTGAGGCCGGCAGTTACTTTACCCATT
Rattus_norvegicus|22372             GTTTTATTTTTTGTGCCCGGCATATTTGTATACATGCGACCTGCAGCTACATTACCCATT
Rattus_norvegicus|22374             GTTTTATTTTTTGTGCCCTGCATATTTGTGTATATGCGACCTGCAGCTACATTACCGATT
Bos_taurus|29733                    GTCTTCTTCTTCATGCCCTGCATATTTGTGTACCTGAGACCCGCAGCTACTTTACCTCTT
Sus_scrofa|11396                    ATCTTATTCTTCGTGCCCTGCATATTTGTGTACATGAGACCAGCAGCTACTTTACCTATT
Sus_scrofa|11395                    GTCATCTTCTTTGTGCCCTGCATATTTGAGTACATGCGACCAGCAGTTACTTTACCTTTT
Sus_scrofa|11400                    GTCATATTCTTTGTGCCCTGCATATTTGTATACATGCGACCAGCAGTTACTTTACCCTTT
Sus_scrofa|11399                    GTCATCTTCTTTGTGCCCTGCATATTTGAGTACATGCGACCAGCAGTTACTTTACCCATT
Choloepus_hoffmanni|258             GTCTTGTTTTTTGTGCCTTGCATATTTGTGTACATGAGGCCTGCAGCTACTCTATCCATT
Monodelphis_domestica|24688         GTTTTATTCTTTGTTCCCTGTATTTTTGTCTACATGCGGCCTGCAGCAACCTTTCCCATT
Monodelphis_domestica|24689         GTTTTATTCTTTGTCCCTTGTATTTTTGTCTACATGAGGCCTGCAACAACCTTTCCCTTT
Monodelphis_domestica|24691         GTTTTATTCTTTGTCCCTTGTATTTTTGTCTACATGAGGCCTGCAACAACCTTTCCCATT
Callithrix_jacchus|41212            ATCTTAATCTTTGTGCCCTGCATATTTGTGTACATGAGACCTGCAGCTACTTTGCCTATT
Homo_sapiens|17635                  ATCTTATCCTTTATACCCTGCATATTTGTGTACATGAGACCTCCAGCTACTTTACCCATT
Equus_caballus|5278                 ATCTTATTCTTTGTGCCATGCATTTTTGTGTACATGAGACCTGCAGCTACGTTACCAATT
Canis_familiaris|8369               GTCCTATTCTTTGTGCCCTGCATATTTGTGTACATGAGACCCGCAGCTACTTTATCCATT
Canis_familiaris|8352               GTCTTATTCTTTGTGCCCTGTATATTTGTGTACATGAGACCTGCAGCTACTTTACCTATT
Canis_familiaris|8363               GTCCTATTCTTTGTGCCCTGCATATTTGTGTACATGAGACCCGCAGCTACTTTACCTATT
Bos_taurus|6622                     GTCTTATTCTTCGTGCCCTGTGTATTTGTGTACATGCGACCTGCAGCTACTTTATCAATT
Mus_musculus|22922                  GTCTTATTCTTTGTGCCTTGCATATTTGTATACATGAGACCTGTAGCTACCTTACCCATT
Rattus_norvegicus|22432             GTCTTGTTCTTTGTGCCTTGCATATTTGTATACATGAGACCTGTAGCTACCTTACCCATT
Bos_taurus|6627                     ATTTTATACTTCGTGCCCTGCATATTTGTGTACATGAGACCTGCAGCTACCTTAGCTGTT
Sus_scrofa|11415                    GTGTTATACTTTGTGCCCTGTATATTTGTGTACACGAGACCTGCAGCTACTTTACCAATT
Sus_scrofa|11413                    GTCTTATTCTTTGTGCCTTGTATATTTGTGTACCTGAGACCTGCCAGTACTTTATCAATT
Sus_scrofa|9826                     GTCTTATTCTTTTTGCCTTGTATATTTGTGTACCTGAGACCTGCAGGTACTTTATCAATT
Sus_scrofa|11406                    GTCTTATTCTTTGTGCCTTGTATATTTGTGTACCTGAGACCTGCAGGTACTTTATCAATT
Sus_scrofa|11409                    GTCTTATTCTTTGTGCCTTGTATATTTGTGTACCTGAGACCTGCAGGTACTTTATCAATT
Erinaceus_europaeus|4256            GTACTATTCTTTGTGCCTTGCATATTTGTGTACATGAGACCTGCCGTTACTTTACCCATG
Procavia_capensis|7897              GTCTTATACTTTGTGCCCTGCATATTTGTGTACATGAGGCCGGCAGCTACCTTATCGGTT
Loxodonta_africana|10358            GTCTTATTCTTTGTGCCCTCCATATTTGTGTATGTGAGACCCACAGGTACTTTATCTGTT
Echinops_telfairi|7364              GTCTTATTCTTTGTGCCCTGCATCTTTGTGTACATGAGACCTGCAACCACTTTAGCTGTT
Loxodonta_africana|10359            GTCTTATTCTTTGTGCCCTGCATATTTGTGTATATGAGACCTGCAACTACTTTATCTGTT
Procavia_capensis|11271             GTCTTATTCTTTGTGCCCTGTGTATTTGTGTACATGAGACCTGCAACTACTTTATCTGTT
Mus_musculus|22924                  GTCTTGTTTTTCGTACCCTGCATTTTTGTGTACATGAGACCTTCAGCCACTTTGTCTATT
Oryctolagus_cuniculus|1855          GTCTTGTTCTTTGTCCCCTGCATATTTGTGTACATGAGACCTGCAGCTACTTTACCTATT
Homo_sapiens|17643                  ATCTTATTCTTTGTGCCCTGCATATTTGTGTACATGAGACCTGCAGCTACTTTACCTATT
Oryctolagus_cuniculus|1854          GTCTTGTTCTTTGTCCCCTGCATATTTGTGTACATGAGACCTGCAGCTACTTTAACCATT
Callithrix_jacchus|41203            GTCTTATTCTTTGTGCCCTGCATATTTGTGTACATGAGACCTGTAGCTACTTTATCTATT
Spermophilus_tridecemlineatus|2389  GTCCTCTTCTTTGTTCCCTGCATATTTGTGTACATGAGACCTGCAGTCATATTACCCATT
Felis_catus|31463                   GTCTTATTCTTTGTGCCCTGCATATTTGTGTATATGAGGCCTGCAGCTACTTTATCTATT
Canis_familiaris|8420               GTCCTATTCTTTGTGCCCTGCATATTTGTGTACATGAGACCCGCAGCTACGTTATCCATT
Canis_familiaris|8433               GTCCTATTCTTTGTGCCCTGCATATTTGTGTACATGAGACCCGCAGCTACATTATCCATT
Macropus_eugenii|12245              ATCTTGTTTTTTGTGCCCTGTATATTTGTCTATCTTCGGCCCATGGCCAACTTCCCCATT
Ornithorhynchus_anatinus|16857      GTCTTATCCTTTATTCCCTGCATATTTGTGTATATGCGACCCATGACCACTTTGCCTGTG
Echinops_telfairi|4282              ------------------------------------------------------------
Rhesus_macaque|12555                ATCTTGTTCTTTGTGCCCTGCATATTTGTGTATCTACGTCCAGCAACCACCTTCTCCATT
Loxodonta_africana|10357            TTCTTACTCTTTGTGCCCTGCATATTTGTGTATCTGCGGCCAGTGACTACCTTCTCCATT
Loxodonta_africana|23520            GTTTTAATCTTTGTGCCCTGCATGTTTGTGTATCTGCGCCCAGCAACTACCTTCTCCATT
Loxodonta_africana|23521            ATTTTACTCTTTGTGCCCTGCATATTTGTGTATCTGCGCCCAGCAACTACCTTCTCCATT
Loxodonta_africana|10356            ATCTTATTCTTTGTGCCCTGCATATTTGTGTATCTGCGGCCAGTGACTACCTTCTCCATT
Choloepus_hoffmanni|440             ATCTTATTCTTTGTGCCCTGCATATTTGTGTATCTTCGCCCAGTGATCACCTTCCCCATT
Oryctolagus_cuniculus|1856          ATCTTATTCTTTGTTCCCTGCATATTTGTATACCTGCGCCCAGTGACCACCTTCTCCATT
Mus_musculus|22921                  ATCTTATTCTTTGTGCCTTGCATATTTGTGTATCTTCGCCCAGTAATTACCTTCTCTATT
Rattus_norvegicus|22431             ATCTTATTCTTCGTGCCTTGCATATTTGTGTATCTGCGCCCAGTAATGACCTTCTCTATT
Erinaceus_europaeus|4844            GTTTTATTCTTTGTGCCATGCATATTCGTATACCTGCGCCCAGCAGTCACCTTCTCTATT
Erinaceus_europaeus|2413            ------------------------------------------------------------
Sus_scrofa|11416                    ATTTTATTCTTTGTGCCCTGCATATTTGTGTATCTGCGTCCAGTGAGAACCTTTTCCATT
Felis_catus|1160                    ATTTTCTTCTTTGTGCCCTGCTTATTTGTATATCTGCGCCCAGTGATCACCTTTTCCATT
Canis_familiaris|8432               ATTTTATTCTTTGTGCCCTGTATATTTGTGTATTTGCGTCCAGCGATCACCTTTTCCATT
Canis_familiaris|8419               ATTTTATTCTTTGTGCCCTGTATATTTGTCTATTTGCGTCCAGCGATCACCTTTTCCATT
Monodelphis_domestica|24687         CTATTATTCTTTATTCCTTGTATATTTGTATATCTCCGGCCAATGGTCATCTTCCCTATT
Macropus_eugenii|10461              CTCTTATTCTTTATTCCTTGTATATTTGTGTACCTCAGGCCAATGATCATCTTCTCCATT
Monodelphis_domestica|24684         GTCCTATTTTTTGTGCCTTGTATATTTGTGTATTTGAGGCCTGTGGTAATTCTGCCCATA
Cavia_porcellus|7144                GTTATATCCTTCATGCCTTGCACATTTGTGTATCTGCGCCCAATGACCACTTTACCAATT
Homo_sapiens|17636                  GTCTTATTCTTTGTGCCCTGTATATTTGTGTATCTGCGCTCAGTGACCACTCTGCCCATT
Pan_troglodytes|6844                GTCTTATTCTTTGTGCCCTGTATATTTGTGTATCTGCGCGCAGTGACCACTCTGCCCATT
Sus_scrofa|11414                    GTCTTATCTTTTGTGCCCTGTATCTTTGTGTATCTGCGCCCAGCGACCACTCTGCCCATT
Erinaceus_europaeus|4881            ------------------------------------------------------------
Otolemur_garnettii|1429             ------------------------------------------------------------
Microcebus_murinus|3048             ------------------------------------------------------------
Bos_taurus|6619                     GTCTTATTCTTTGTGCCCTGTATCTTTGTGTATCTTCGCCCAGTCACCACTCTGCCCATT
Bos_taurus|6624                     GTCTTATTCTTTGTGCCCTGTATCTTTGTGTATCTTCGCCCAGTCACCACTCTGCCCATT
Procavia_capensis|8766              GTCTTATTCTTTCTGCCATGTATATTTGTATATCTGCGCCCAGTGACCACTCTGCCCGTA
Loxodonta_africana|10360            ATCTTATGCTTTGTGCCCTGCATATTTGTGTATCTGCGCCCAGTGACGACTCTGCCCATA
Vicugna_pacos|1942                  ------------------------------------------------------------
Canis_familiaris|8421               GTCTTGTTCTTTGTGCCCTGCATATTTGTGTATCTGCGTCCAGTGACCACTCTGCCCATT
Felis_catus|6205                    ------------------------------------------------------------
Ochotona_princeps|11681             GTGTTATGTTTTGTGCCCTGCATATTTGTGTATCTGCGTCCAGTGACCACTCTGTCCATT
Rattus_norvegicus|22434             GTTTTATTCTTTATTCCTTGCATATTTGTGTATCTACGCCCAGTGACCACTCTGCCACTT
Mus_musculus|22917                  GTTTTATCCTTTATTCCTTGCATATTTGTATATCTACGTCCAGTGACCACTCTGCCAATT
Mus_musculus|22928                  GTTTTATTCTTTATTCCTTGCATATTTGTATATCTACGTCCAGTGACCACTTTGCCACTT
Oryctolagus_cuniculus|1853          GTCTTATTTTTCATACCCTGCATATTTGTGTATCTGCGCCCAGTGACCACTCTCTCTACT
Oryctolagus_cuniculus|1852          GTCTTATGTTTTTTGCCCTGCATATTTGTGTATCTGCGCCCAGTGACCACTCTCTCTATT
Ornithorhynchus_anatinus|16863      ATCTTCTTCTTTTTCCCCTGCATTTTCACATACATGAGGCCCGTGTCCACCTTCCCAATA
Ornithorhynchus_anatinus|16862      ATTTTGTTCTTCTTTCCATGTATTTTCATGTACATGAGGCCCGTGTACACTCTTCCTATG
Ornithorhynchus_anatinus|16865      ATCTTATTCTTTGTCCCTGCTATATTCGTGTATGTACGGCCTGTGGCCACCCACCCCATG
                                                                                                

Procavia_capensis|16277             GACAAG------------------------------------------------------
Erinaceus_europaeus|13540           GATAAAATGATAACTGTGTTTTATACAATCGGAACCCCTCTGTTCAATCCCCTGATTTAT
Bos_taurus|28568                    GAGAATGTGATGGCTGTGTCTTTTACCATCATTGCTCCCATGTTAAATCCCCTGATCTAT
Dasypus_novemcinctus|13523          GACAAGGCAATGATAGTGATCTTCACCATTGTAGAACCCATGTTAAATCCCTTAATCTAC
Mus_musculus|22888                  GATAATGCAATGGCTCTGTGTGCTACAATTTTTGAACCAATGTTAAATCCTTTAATCTAT
Rattus_norvegicus|22406             GACAATATAATGGCTCTGTGTGCTACCATTGTTGAACCAATGTTAAATCCTTTGATCTAC
Mus_musculus|22846                  GACAAAGCAATGGCTGTGTCATTTACTATTGTTGAACCGATGTTAAATCCTTTGATCTAC
Rattus_norvegicus|22366             GACAAAGCAATGGCTGTGTCCTTTACAATTGTTGAACCAATGTTAAATCCTTTGATCTAC
Ochotona_princeps|15463             GACAAGGTGATGGCTGTGTGTTTTACTGTTGTTGAACCCATGTTAAACCCTTTGATCTAC
Homo_sapiens|17660                  GACAAGGCAATGGCTGTGTCAGACTCAATCATCACACCCATGTTAAATCCCTTGATCTAT
Pan_troglodytes|8167                GACAAGGCAATGGCTGTGTCAGACTCAATCATCACACCCATGTTAAATCCCTTGATCTAT
Otolemur_garnettii|13504            GACAAGGCAATGGTTGTGTCTGATTCAATCATTACACCCATGTTAAACCCCTTGATCTAC
Microcebus_murinus|2797             ------------------------------------------------------------
Microcebus_murinus|5059             GACAAGGCAATGGTTGTGTCTGATTCAATCATCACACCCATGCTAAATCCCTTGATCTAC
Microcebus_murinus|10664            GACAAAGCAATGGTTGTGTCTGATTCAATCATCACACCCATGCTAAATCCGTTGATCTAC
Tupaia_belangeri|13856              GACAAGGCTATGACACTGTTTGATACAATCATTCCACCCATGTTAAATCCCTTGATCTAC
Choloepus_hoffmanni|6189            GACAAGGCAATGGTTGTGAACTTCACCATTGTAGAACCCATGTTAAACCCCTTGATCTAC
Choloepus_hoffmanni|10987           GATAAGGCAATGGCTGTGTCCTCTTCAATTGTTGAACCCATGTTAAACCCCTTGATGTAT
Felis_catus|6208                    GACAAGGCAATGGCCGTGTCTGATTCCATCATCACGCCCATGTTAAACCCCCTGATCTAC
Canis_familiaris|28898              GACAAGGCAATGGCTGTGTCTGATTCCATCATCACACCCATGTTAAATCCTTTGATCTAC
Canis_familiaris|28666              GACAAGGCAATGGCTGTGTCTGATTCCATCATCACACCCATGTTAAATCCCTTGATCTAC
Canis_familiaris|8394               GACAAGGCAATGGCTGTGTCTGATTCCATCATCACACCCATGTTAAATCCCTTGATCTAC
Canis_familiaris|8407               GACAAGGCAATGGCTGTGTCTTTTACCATTGTTACACCCATGTTAAATCCCTTGATCTAC
Loxodonta_africana|10342            GACAAAGCAATGGCTGTGTCCTTTACCATTATTGCACCCATGTTAAATCCCTTGATCTAC
Loxodonta_africana|7429             GACAAGGCAATGGCTGTGTTGGAGGCCATCATCACACCCATGTTGAATCCCTTGATCTAT
Loxodonta_africana|8250             GACAAGGCAATGGCTGTGTTGGGGGCCATCATCACACCCATGTTGAATCCCTTGATCTAT
Loxodonta_africana|10841            GACAAGGCAATGGCTATGTCGGAGTCTATCATCACACCCATGTTAAATTCCTTGATCTAC
Loxodonta_africana|7347             GACAAGGCAATGGCTGTGTCG---AATATCATCACACCCATGTTAAATCCCTTAATCTAC
Loxodonta_africana|15374            GACAAGGCAATGGCTGTTTCG---GATATCATCATACCCATGTTAAATCCCTTAATCTAC
Loxodonta_africana|8254             GACAAGGCAATGGCTGTGTCG---GATATCATCACACCCATGTTAAATCCCTTAATCTAC
Loxodonta_africana|10347            GACAAGGCAATGGCTGTGTCG---GATATCATCACACCCATGTTAAATCCCTTAATCTAC
Dasypus_novemcinctus|5504           GATAAAGTAGTGGCAGTATTTTATAGCATGATAACACCCATGTTAAACCCTTTAATCTAC
Dasypus_novemcinctus|6826           GATAAAGCAGTGGCTGTATTTTATACGATGATCACACCCATGTTAAACCCTTTAATCTAC
Equus_caballus|5245                 GATAAAGTGGTGGTTGTGTTTTATACTATGCTAATGCCCATGTTAAACCCTTTAATCTAC
Echinops_telfairi|11116             GACAAAGCAGTGGCTGTGTTTTATACTACGGTCACCCCCATGTTAAACCCTCTAATCTAC
Echinops_telfairi|11654             GACAAAGCAGTGGCTGTGTTTTACACTATGGTCACTCCCATGCTAAACCCTCTAATCTAC
Echinops_telfairi|10565             GACAAAGCAGTGGCTGTGTTTTACACTATGGTCACCCCCATGTTAAACCCTCTAATCTAC
Vicugna_pacos|1925                  GATAAAGCGGTGGCTGTGTTTTATACCATAGTAACACCCATGTTAAACCCTTTAATCTAC
Dasypus_novemcinctus|6644           GATAAAGCAGTGGCTGTGTTTTATACTATGATACCACCCATGTTAAACCCTTTAATCTAT
Spermophilus_tridecemlineatus|10360 GACAAAGTGGTGGCTGTGTTTTCTACTATGGTGTCACCCATGTTAAACCCTTTAATCTAC
Cavia_porcellus|23431               GATAAGGCAGTGGCTGTGTTTTATACTGTGGTGACCCCCATGTTGAACCCTTTAATCTAC
Callithrix_jacchus|41201            GATAAAGCCGTGTCTGTGTTTTTTACTGTGGCAACACCCATGTTAAACCCTTTAATCTAC
Mus_musculus|22929                  GACAAAGCTGTGGCTGTGTTCTATACTGTGATAACACCCATGCTAAACCCTTTAATTTAC
Rattus_norvegicus|22435             GACAAAGCTGTGGCTGTGTTCTATACTGTGATAACACCCATGCTAAACCCTTTAATCTAC
Equus_caballus|5271                 ------------------------------------------------------------
Sorex_araneus|6771                  GATAAAGCAGTGGCTGTATTTTATACGATGATAACCCCTATGCTAAATCCATTAATCTAT
Sus_scrofa|9827                     GATAAAGCGGTGGCTGTGTTTTACACTGTGGTAACACCCATGTTAAACCCTTTAATCTAC
Loxodonta_africana|10361            GATAAAGCAGTAGCCGTGTTTTATACTATGGTAACCCCCATGTTAAACCGTTTAATCTAC
Homo_sapiens|17605                  GATAAAGCTGTGTCTGTGTTTTATACTGTGGTAACACCCATGTTAAACCCTTTAATCTAC
Pan_troglodytes|6828                GATAAAGCTGTGTCTGTGTTTTATACTGTGGTAACACCCATGTTAAACCCTTTAATCTAC
Canis_familiaris|8422               GACAAAGCAGTGGCTGTGTTTTATACTATGATAACACCCATGTTAAATCCTTTAATCTAT
Oryctolagus_cuniculus|1850          GACAAAGCAGTGGCTGTGTTTTATACTATGGTAACACCCATGCTAAACCCTTTAATCTAT
Otolemur_garnettii|13491            GATAAAGCTGTGGCTGTGTTTTATACCATGGTCACACCCATGTTAAACCCCTTAATCTAT
Microcebus_murinus|9568             GATAAAGCTGTGGCCGTATTTTATACGATGGTGACACCTATGCTAAACCCTTTAATCTAT
Dasypus_novemcinctus|3289           GATAAAGCTGTGGCTGTATTTTACACTATGATAACACCCATGTTAAACCCTCTGATTTAC
Dasypus_novemcinctus|6897           GACAAAGCATTGGCTGTATTTTATGTTCTAGTAACACCCATGTTAAACCCTTTAATCTAC
Dasypus_novemcinctus|15676          GATAAATCATTGGCTGTATTTTACACTATGATAACACCCATGTTAAACCCTTTAATCTAT
Choloepus_hoffmanni|6218            GATAAAGCAGTGGCTGTGTTTTATACTATGATAACACCAATGTTAAACCCTTTAATCTAC
Spermophilus_tridecemlineatus|12911 GATAAAGCAGTCGCTGTATTCTATACCATGATAACTCCCATGTTAAATCCTGTGATCTAC
Bos_taurus|29294                    GATAAAGCAGTTGCTGTATTCCACACTATGATAACTCCCATGTTAAATCCCTTAATTTAT
Bos_taurus|27626                    GATAAAGCAGTGGCTGTATTCTACACTATGATAACTCCCATGTTAAATCCATTCATCTAT
Sus_scrofa|11423                    GACAAAGCAGTTACTGTATTCTACACTATGATAACTCCCATGTTAAATCCCTTAATCTAT
Cavia_porcellus|21650               GATAAGGCAGTTGCTGTGTTCTACACCATGATAACTCCCATGTTAAACCCCTTAATCTAT
Rattus_norvegicus|22372             GATAAAGCAGTTGCTATTTTTTATACTATAATAACTCCCATGTTAAACCCATTAATCTAC
Rattus_norvegicus|22374             GATAAAGCAGTTGCTATTTTTTATACTATGATAACTCCTATGCTAAACCCATTAATCTAC
Bos_taurus|29733                    GATAAAGCAGTGGCTGTATTTTACACTATGATAACTCCCATGTTAAATCCCTTAATCTAT
Sus_scrofa|11396                    GATAAAGCTGTCGCTGTATTCTACACTATGATAACTCCCATGTTAAACCCCTTAATCTAT
Sus_scrofa|11395                    GATAGAGCAGTTGCTGTATTCTGCACTATGATAACTCCCATGTTAAACCCCTTAATCTAT
Sus_scrofa|11400                    GATAAAGCAGTTGCTGTATTCTACAGTATGATAACTCCCATGTTAAATCCCTTAATCTAT
Sus_scrofa|11399                    GATAAAGCAGTTGCTGTCTTCTACACTATGATAACTCCCATGTTAAATCCCTTAATCTAC
Choloepus_hoffmanni|258             GATAAAGCAGTTGCTGTATTCTACACTAACATAACTCCTATGTTAAATGCCTTAATTTAT
Monodelphis_domestica|24688         GATAAAGCTATTGCAGTCTTCTACACAATTATTACCCCCATGCTAAACCCTTTAATCTAC
Monodelphis_domestica|24689         GATAAAGCTGTTGTAGTGTTTTACACAATGATAACACCCATGTTAAACCCTTTAATCTAC
Monodelphis_domestica|24691         GATAAAGCTGTTGCAGTGTTTTACACAATGATAACACCTATGTTAAACCCTTTAATCTAC
Callithrix_jacchus|41212            GATAAAGCAGTTGCTGTATTCTACACTATGATAACTCCAATGTTAAACCCCTTAATCTAT
Homo_sapiens|17635                  GATAAAGCAGTTGCTGTATTCTACACTATGATAACTTCTATGTTAAACCCCTTAATCTAC
Equus_caballus|5278                 GATAAGGCAGTTGCTGTATTCTATACTATGATAACCCCCATGTTAAATCCCTTGATCTAT
Canis_familiaris|8369               GATAAAGCAGTTGCAGTGTTCTATACTACAATAACTCCCATGTTAAATCCTTTAATCTAT
Canis_familiaris|8352               GATAAAGCAGTTGCAGTTTTCTACACTATGATAACACCCATGTTAAATCCCTTAATATAT
Canis_familiaris|8363               GATAAAGCAGTTGCAGTTTTCTACACTATGATAACACCCATGTTAAATCCCTTAATCTAT
Bos_taurus|6622                     GATAAAGCAGTTGCTTTATTCTACACTATCATCACTCCCATGTTAAATCCCTTAATCTAT
Mus_musculus|22922                  GATAAAGCAGTTGCTATGTTCTATACTATGATAACTCCCATGTTGAACCCCTTAATCTAT
Rattus_norvegicus|22432             GATAAAGCAGTTGCTATGTTCTATACTATGATAACACCCATGTTAAACCCCCTAATATAC
Bos_taurus|6627                     GATAAAGCAGTTGCTGTATTTTATACTGTGATAACTCCCATGTTAAATCCCTTAATCTAT
Sus_scrofa|11415                    GATAAAGCAGTTGCTGTATTCTACACTATGATCACTCCCATGTTGAATCCCTTAATCTAT
Sus_scrofa|11413                    GACAAAGCAGTTGCTTTATTCTATGCTATCATAACCCCCATGTTAAATCCCTTAATCTAT
Sus_scrofa|9826                     GACAAAGCAGTTGCTTTATTCTACACTACCATAACCCTCATGTTAAATCCCTTAATCTAT
Sus_scrofa|11406                    GACAAAGCAGTTGCTTTATTCTACACTACCATAACCCTCATGTTAAATCCCTTAATCTAT
Sus_scrofa|11409                    GACAAAGCAGTTGCTTTATTCTACACTACCATAACCCTCATGTTAAATCCCTTAATCTAT
Erinaceus_europaeus|4256            GATAAAGCCGTGGCTGTCTTCTACACTATGATAACTCCTATGTTAAATCCTTTAATCTAT
Procavia_capensis|7897              GACAAAGCAGTTGCTGTATTCTATACCATCATAACTCCAATATTAAATCCTTTAATATAT
Loxodonta_africana|10358            GACAAAGCAGTTGCTGTATTCTACACCATCATAACTCCAATGTTAAATCCTTTAATATAT
Echinops_telfairi|7364              GATAAGGCAGTTGCTGTATTCTACACCATCATAACTCCTATGCTAAACCCCTTAATCTAT
Loxodonta_africana|10359            GACAAAGCAGTTGCTGTATTCTACACCATCATAACTCCAATGTTAAATCCCTTAATCTAT
Procavia_capensis|11271             GACAAAGCTGTTGCTGTATTCTACACCATCATAACTCCCATGTTAAATCCCTTAATCTAT
Mus_musculus|22924                  GATAAAGCAGTTGCTGTCTTCTACACTATGATAACTCCCTTGTTAAATCCTTTAATCTAC
Oryctolagus_cuniculus|1855          GATAAAGCAGTGGCTATATTCTACACTATGATAACTCCTGTACTGAATCCCTTAATCTAC
Homo_sapiens|17643                  GATAAAGCAGTTGCTATATTCTACACTATGATAACTCCTATGTTAAACCCCTTAATCTAT
Oryctolagus_cuniculus|1854          GATAAAGCAGTTGCTGTATTCTACACTATCATAACTCCCATGTTAAATCCTTTAATCTAC
Callithrix_jacchus|41203            GATAAAGCAGTTGCTATATTCTACACTATGATAACTCCTATGTTAAACCCCTTAATCTAT
Spermophilus_tridecemlineatus|2389  GATAAAGCAGTTGCTGTATTCTACACCATGATAACTCCCATGTTAAATCCCTTAATCTAT
Felis_catus|31463                   GATAAAGCAGTGGCAGTGTTCTACACTATTATAACTCCCATGCTAAACCCGCTAATCTAT
Canis_familiaris|8420               AATAAGGCAGTTGCAGTGTTCTACACTATTATAACTCCCATGTTAAACCCCTTAATCTAT
Canis_familiaris|8433               GATAAAGCAGTTGCAGTGTTCTACACTATTATAACTCCCATGTTAAACCCCTTAATCTAT
Macropus_eugenii|12245              GATAAAGCCATGGCTATATTTTACACTATGGTAACCCCTATGTTAAACCCATTAATCTAT
Ornithorhynchus_anatinus|16857      GATAAAACCGTGGCTGTGTTTTATACCGTGGTAGCCCCCATGCTAAACCCCCTAATCTAT
Echinops_telfairi|4282              ------------------------------------------------------------
Rhesus_macaque|12555                GACAAAGCGGTAGCTGTGTTTTATACCATGATAACTCCTATGTTAAACCCTTTAATCTAC
Loxodonta_africana|10357            GATAAAGCTGTGACTGTCTTTTATACCATGATCACTCCCATGTTAAACCCCTTAATCTAT
Loxodonta_africana|23520            GATAAAGCTGTGACTGTCTTTTATACCATGATCACGCCCATGTTAAACCCCTTAATCTAT
Loxodonta_africana|23521            GATAAAGCTGTGGCTGTCTTTTATACCATGATCACTCCTATGTTAAACCCCTTAATCTAT
Loxodonta_africana|10356            GATAAAGCTGTGGCTGTCTTTTATACCATGATCACTCCCATGTTAAATCCCTTAATATAC
Choloepus_hoffmanni|440             GATAAAGCAGTAGCTGTGTTTTATACCATGATAACTCCCATGTTAAACCCCTTGATCTAC
Oryctolagus_cuniculus|1856          GACAAAGCTGTGGCTGTGTTTTATACCATGATAACTCCTATGTTAAACCCTTTAATCTAT
Mus_musculus|22921                  GATAAAGCGGTGGCTGTATTTTATACCATGATTACTCCTATGTTAAACCCCTTAATCTAC
Rattus_norvegicus|22431             GATAAAGCGGTGGCTGTATTTTATACCATGATAACTCCTATGCTAAACCCCTTGATTTAT
Erinaceus_europaeus|4844            GATAAAGCTGTGGCTGTGTTTTATACAATGATAACTCCCATGTTAAATCCTCTAATCTAC
Erinaceus_europaeus|2413            ------------------------------------------------------------
Sus_scrofa|11416                    GATAAAGTTGTGGCTGTGTTTTATACCATGATAACACCTATGTTGAACCCTTTAATCTAC
Felis_catus|1160                    GATAAAGCTGTGGCTGTGTTTTATACCATGATAACTCCTATGTTAAACCCTTTAATCTAT
Canis_familiaris|8432               GATAAAGCTGTGGCTGTGTTTTACACCATGATAACTCCTATGTTAAACCCTTTAATCTAC
Canis_familiaris|8419               GATAAAGCTGTGGCTGTGTTTTACACCATGATAACTCCTATGTTAAACCCTTTAATCTAC
Monodelphis_domestica|24687         GATAAGGCTATCGCAGTTTTTTATTCAATGATAACCCCTATGTTAAACCCCTTAATCTAC
Macropus_eugenii|10461              GATAAGACTGTGACTGTTTTTTATTCAATGATAACCCCCATGTTAAACCCTTTAATCTAT
Monodelphis_domestica|24684         GATAAAGCTGTGGCTGTATTTTATACTCTTGTAGCCCCCATGTTACACCCCCTGATCTAT
Cavia_porcellus|7144                GATAAAGCTGTTGCTGTTTTTTATACCATGGTGACACCTATGTTAAACCCTTTAATATAC
Homo_sapiens|17636                  GATAAAGCTGTTGCTGTATTTTATACTATGGTGGTCCCAATGTTAAATCCCGTGGTCTAC
Pan_troglodytes|6844                GATAAAGCTGTTGCTGTATTTTATACTATGGTGGCCCCAATGTTAAATCCCTTGGTCTAC
Sus_scrofa|11414                    GATAAAGCTGTTGCTGTCTTTTACACTATGGTGGCCCCTATGTTAAATCCCTTAATCTAT
Erinaceus_europaeus|4881            ------------------------------------------------------------
Otolemur_garnettii|1429             ------------------------------------------------------------
Microcebus_murinus|3048             ------------------------------------------------------------
Bos_taurus|6619                     GATAAAGCTGTTGCTGTCTTTTACACTATGGTGGCCCCTATGTTAAATCCTTTAATATAT
Bos_taurus|6624                     GATAAAGCTGTTGCTGTCTTTTACACTATGGTGGCCCCTATGTTAAATCCTTTAATATAT
Procavia_capensis|8766              GATAAAGCTGTGGCTGTCTTTTATACTATAGTGGCCCCCATGTTAAATCCTTTAATTTAT
Loxodonta_africana|10360            GATAAAGCTGTGGCTGTCTTTTATACTATGATGGCTCCTATGTTAAATCCCTTAATTTAT
Vicugna_pacos|1942                  ------------------------------------------------------------
Canis_familiaris|8421               GATAAAGCTGTTGCTGTCTTTTACACTATGGTGGTCCCTATGTTAAATCCCTTAATCTAC
Felis_catus|6205                    ------------------------------------------------------------
Ochotona_princeps|11681             GATAAAGCAGTTGCTGTATTTTATACTGTGCTGGCACCTTTGTTAAATCCTTTAATCTAC
Rattus_norvegicus|22434             GATAAAGGTGTTGCTGTCTTTTATACTATGGTGGTTCCTATGATGAATCCTTTAATCTAC
Mus_musculus|22917                  GATAAAGCTGTTGCAGTCTTTTATACTTTGGTGGCCCCTCTACTGAATCCTTTAATCTAC
Mus_musculus|22928                  GATAAAGGTGTTGCTGTGTTTTATACTATGGTGGCTCCTATGCTGAATCCTTTAATCTAC
Oryctolagus_cuniculus|1853          GATAAAGCTGTTGCTGTATTTTATACTATGGTGGCCCCTATGTTAAATCCTTTAATCTAC
Oryctolagus_cuniculus|1852          GATAAAGCTGTTGCTGTATTTTATACAGTGATGGCCCCTATGTTAAATCCTTTAATCTAC
Ornithorhynchus_anatinus|16863      GATAAGTCGGTGGCTGTATTTTTTACCATCATCACCCCTATATTAAATCCCATAGTTTAC
Ornithorhynchus_anatinus|16862      GACAAGTCGGTGGCCATATTTTATACTATTGTCACCCCCATGTTGAACCCCGTCATCTAC
Ornithorhynchus_anatinus|16865      GACAAGTATGTGGCTGTATTTTACACGCTCATCACCCCTATGTTAAACCCATTCATCTAC
                                                                                                

Procavia_capensis|16277             ------------------------------------------------------------
Erinaceus_europaeus|13540           ACACTAAGGAATGCTGAAATGAAAAATGCTATGAGAAAGCTCTGGAACAAG---------
Bos_taurus|28568                    ACCTTGAGGAACACAGAGGTAAAAAATGGCATGAGGAAACTGTGGATGAAA---------
Dasypus_novemcinctus|13523          ACTCTGAGGAATACAGAGGTGAAAAATGACATGAGAAAACTTTGGATGAAG---------
Mus_musculus|22888                  AGCTTGAGAAATGCAGAAGTGAAACATGCTCTGAGGAAACTGTGGATGAAA---------
Rattus_norvegicus|22406             AGTTTGAGGAATGCAGAAGTAAAACAGGCTCTGAGGAAACTGTGGATGAAA---------
Mus_musculus|22846                  ACCTTGAGAAATACAGAGGTAAAATATGCTATAAAGAACATGTGCAGAAAA---------
Rattus_norvegicus|22366             ACATTGAGAAATGCAGAGGTAAAATATGCTATAAAGAATATGTGTAGAAAA---------
Ochotona_princeps|15463             ACCTTGAGGAATGCAGAAGTGAGAAAAGCCATGAAGAAATTGTGGTTG------------
Homo_sapiens|17660                  ACACTGAGGAATGCAGAGGTGAAAAGTGCCATGAAGAAACTCTGGATGAAA---------
Pan_troglodytes|8167                ACACTGAGGAATGCAGAGGTGAAAAGTGCCATGAAGAAACTCTGGATGAAA---------
Otolemur_garnettii|13504            ACACTGAGGAACACAGAGGTGAAGAATGCTATGAAGAAACTTTGG---------------
Microcebus_murinus|2797             ------------------------------------------------------------
Microcebus_murinus|5059             ACCCTGAGGAATGCAGAGGTGAAAACTGCCATGAAGAAACTTTGGATGAAA---------
Microcebus_murinus|10664            TCCCTGAGGAATGCAGAGGTGAAAACTGCCATGAAGAAACTTTGGATGAAA---------
Tupaia_belangeri|13856              ACTTTGAGGAATTCAGAGGTGAAAAATGCCATGAAAAAACTATGGATGAAA---------
Choloepus_hoffmanni|6189            GCCCTGATGAATGCGGAGGTGAAAAATGCCATGAGGAAACTTTGGATGAAG---------
Choloepus_hoffmanni|10987           ACCCTGAGGAATGCAGAGGTGAAAAATGCCATTAGGAAGCTTTGGTTGAAA---------
Felis_catus|6208                    ACCCTGAGGAACGCAGAGGTGAAAACTGCCATGGGGAAACTGTGGGGGAAA---------
Canis_familiaris|28898              ACCCTGAGGAATTCAGAGGTGATAAATGCCATGAGGAAACTGGGGAAACAA---------
Canis_familiaris|28666              ACCCTGAGGAATTCAGAGATAGACTTTTGTCTTATTTATGCTTGGCATCTGTTAGGTTTC
Canis_familiaris|8394               ACCCTGAGGAATTCAGAGGTGAAAAATGCCATGAGGAAACTGGGGAAACAA---------
Canis_familiaris|8407               ACCCTGAGGAATTCAGAGGTGAAAAATGCCGTGAGGAAACTGGTGAAACAA---------
Loxodonta_africana|10342            ACCCTGAGGAATGCAGAGGTAAAAAATACTATGAAGAAACTCTGGAAGAGG---------
Loxodonta_africana|7429             ACTCTGAGGAATGTAGAGGTAAAAAATGCCATGAAGAAACTTTGG---------------
Loxodonta_africana|8250             ACTCTGAGGAATGTAGAGGTAAAAAATGCCATGAAGAAACTTTGG---------------
Loxodonta_africana|10841            ATCCTGAGAAGCACAGAGGTGAAAAATACCATGAAGAAACTTTGGATGCAA---------
Loxodonta_africana|7347             ACCCTGAGGAATGCAGAGGTGAAAAATGTCATGAAGAAACTTTGGATTCAA---------
Loxodonta_africana|15374            ACCCTGAGGAATGCAGAGGTCAAAAATGCCATGAAGAAACTTTGGATTCAA---------
Loxodonta_africana|8254             ACCCTGAGGAATGCAGAGGTGAAAAATGCCATGAAGAAACTTTGG---------------
Loxodonta_africana|10347            ACCCTGAGGAATGCAGAGGTGAAAAATGCCATGAAGAAACTTTGG---------------
Dasypus_novemcinctus|5504           ACACTTAGAAATGCAGAAGTGAAAAAGGCAATGAGGACACTCTGGAGCAGA---------
Dasypus_novemcinctus|6826           ACACTCAGAAATGCAGAGGTGAAAAATGCAATGAGGAAGCTCTGGAGCCAA---------
Equus_caballus|5245                 ACTGTCAGAAACTCAGAGGTAAAAAATGCCATGAGGAAGCTTTGG---------------
Echinops_telfairi|11116             ACCCTCAGAAATGCAGAGGTGAAAAACGCAATGAGGAAGCTCTGGAGTCAC---------
Echinops_telfairi|11654             ACCCTCAGAAATGCAGAGGTGAAAAATGCAATGAGGAAGCTCTGGAGCCAC---------
Echinops_telfairi|10565             ACCCTCAGAAATGCAGAGGTGAAAAACGCAATGAGGAAGCTCTGGAGTCAC---------
Vicugna_pacos|1925                  ACCCTCAGAAACTCAGAGGTGAAAAATGCCATGAGGAGACTCTGGGGCCAA---------
Dasypus_novemcinctus|6644           ACCCTTAGAAATGCAGAGGTGAAAAATGCCATGAAGCAGCTCTGGAGCCAA---------
Spermophilus_tridecemlineatus|10360 ACCCTCAGAAACACAGAAGTGAAAAATGCTATTAGGAAACTCTGGGGCCAA---------
Cavia_porcellus|23431               ACCCTCAGAAACACGGAGGTGAAAAATGCTATCAAGAAACTCTGGAGCCAA---------
Callithrix_jacchus|41201            ACCCTCAGAAATGCAGAAGTGAAAAATGCCATGAAGAAGCTCTGGAACCAA---------
Mus_musculus|22929                  ACCCTCAGGAACACAGAAGTGAAAAATGCCATGAGAAAACTCTGGAACCAA---------
Rattus_norvegicus|22435             ACCCTCAGGAACACAGAGGTGAAAAATGCCATGAGAAAACTCTGGAACCAA---------
Equus_caballus|5271                 ------------------------------------------------------------
Sorex_araneus|6771                  ACCCTCAGAAACTCAGAGGTGAAAAATGCCATGAGAAAGCTTTGGAGCCAA---------
Sus_scrofa|9827                     ACCCTCAGAAACTCAGAGGTGAAAAATGCCATGAGGAAGCTCTGGAGCCCA---------
Loxodonta_africana|10361            ACCCTCAGAAATGCAGAGGTGAAAAATGCGATGAGGAAGCTCTGCAGCCAA---------
Homo_sapiens|17605                  ACCCTCAGAAACACAGAGGTGAAAAATGCCATGAAGCAGCTCTGGAGCCAA---------
Pan_troglodytes|6828                ACCCTCAGAAACACAGAGGTGAAAAATGCCATGAAGCAGCTCTGGAGCCAA---------
Canis_familiaris|8422               ACCCTCAGAAACTCAGAAGTGAAAAATGCCATGAGGAAGCTCTGGAGCCAC---------
Oryctolagus_cuniculus|1850          ACTCTTAGAAATTCAGAGGTGAAAAATGCCATGCGGAAGCTCTGGAGCCAA---------
Otolemur_garnettii|13491            ACCCTCAGAAACGCAGAGGTGAAAAATGCCATGAGGAAGTTGTGGTCCCAG---------
Microcebus_murinus|9568             ACCCTCAGAAACACAGAGGTGAAAAATGCCATGAGGAAGCTCTGGTGCCAA---------
Dasypus_novemcinctus|3289           ACCGTCAGAAATGCAGAGGTGAAAAATGCCATGAGGAAGCTCTGCAGCAAA---------
Dasypus_novemcinctus|6897           ACCCTCAGAAATGCAGAGGTGAAAAATGCAATGAAGAAGCTCTGGAGCCAA---------
Dasypus_novemcinctus|15676          ACCCTCAGAAATGCAGAGGTGAAAAATGCCATGAGGAAACTCTGGTGTCAA---------
Choloepus_hoffmanni|6218            ACACTCAGAAATGCAGAGGTGAAAAATGCAATGAGGAAGCTCTGGAGCCAA---------
Spermophilus_tridecemlineatus|12911 ACTTTGAGAAATGCTCAGATGAAAGATGCTATGAGAAAATTGTTTAGCAGA---------
Bos_taurus|29294                    ACCTTGAGAAATGACCAGATGAAAAATGCCATTAAGAAATTATGCAGTAGGAAAGTTATA
Bos_taurus|27626                    ACCTTGAGAAATGCCCAGATGAAAAATGCCATTAGGAATTTGTATAATAGA---------
Sus_scrofa|11423                    ACCCTGAGAAATGCCCAGATGAAAAATGCCATTAAGAATTTGTGTAGTCAG---------
Cavia_porcellus|21650               ACTTTAAGAAATGCTCAGATGAAAAATGCCATTAAGAAGCTATGTAGCTGT---------
Rattus_norvegicus|22372             ACCTTAAGAAATGCTCAGATGAAAAATGCCATTTGGAAATTGTTTAGTACA---------
Rattus_norvegicus|22374             ACTTTAAGAAATGCTCAGATGAAAAATGCCATTTGGAAGTTGTTTAGTACA---------
Bos_taurus|29733                    ACCTTGAGAAATGACCAGATGAAAAATGCCATTTGGAAGTTGTTTAGTTGG---------
Sus_scrofa|11396                    ACCTTGAGAAATGCCCAGATGAAAAATGCTATTAGGAAATTGTGTAGTAGG---------
Sus_scrofa|11395                    ACCTTGAGAAATGCCCAGCTGAAAAATGCCATTAGGAAATTGTTTAGTAGG---------
Sus_scrofa|11400                    ACCCTGAGAAATGCCCAGCTGAAAAATGCCGTTAGGAAACTCTTTCATAGG---------
Sus_scrofa|11399                    ACCTTGAGAAATGCCCAGCTGAAAAATGCCATTAGGAAATTGTTTAGTAGG---------
Choloepus_hoffmanni|258             ACCTTAAGAAATGATCAGATGAAAAATGCTATCAGGAAATTGTGCAGTAGG---------
Monodelphis_domestica|24688         ACACTGAGAAATGCCCAAATGAAAAATGCCATCAGGAAGTTATGCAGCCAG---------
Monodelphis_domestica|24689         ACGCTGAGAAATGCCCAAATGAAAAATGCTATCAGGAAGTTATTCAGTAAA---------
Monodelphis_domestica|24691         ACACTGAGAAATGCCCAAATGAAAAATGCTATCAGGAAGTTATGCAGAAAA---------
Callithrix_jacchus|41212            ACCCTGAGGAATGCTCAGATGAAAAATGCCATTAGGAAATTGTATAGTAGA---------
Homo_sapiens|17635                  ACCTTGAGGAATGCTCAAATGAAAAATGCCATTAGGAAATTGTGTAGTAGG---------
Equus_caballus|5278                 ACCTTGAGAAATGATCAGATGAAAAATGCCATTAAAAAATTG------------------
Canis_familiaris|8369               ACCTTGAGAAATGACCAGATGAAAAATGCCATTAGGAAACTGTGTAAAAATTTACTTGGG
Canis_familiaris|8352               GCCTTGAGAAATGATCAGATGAAAAATGCCATTAGGAAATTGTGCAGTAGA---------
Canis_familiaris|8363               GCCTTGAGAAATGATCAGATGCAAAAAGCCATTAGGAAATTGTGCAGTAGA---------
Bos_taurus|6622                     ACTTTGAGAAATGCCCAGATGAAAAATGCCATTAGGAAATTGTGTAGTAGA---------
Mus_musculus|22922                  ACCTTAAGAAATGCTCAGATGAAAGATGCCATTAAGAAATTGGGTAGCACT---------
Rattus_norvegicus|22432             ACCTTAAGAAATGCTCAAATGAAAGATGCTATTAAGAAATTGGGTAGCACT---------
Bos_taurus|6627                     ACCTTGAGAAATGCCCAGATGGAAAATGCCATTAGGAAATTGTGTAGTAGG---------
Sus_scrofa|11415                    ACCTTGAGAAATGCCCAGATGGAAACTGCCATTAGGAAATTGTGGAATAGA---------
Sus_scrofa|11413                    ACCTTGAGAAATGCCCAGATGAAAAATGCCATTAGGAAATTGTGTGGCTGG---------
Sus_scrofa|9826                     ACCTTGAGAAATGCCCAGATGAAAAATGCCATTAGGAAATTG------------------
Sus_scrofa|11406                    ACCTTGAGAAATGCCCAGATGAAAAATGCCATTAGGAAATTGTGTGGCAGG---------
Sus_scrofa|11409                    ACCTTGAGAAATGCCCAGATGAAAAATGCCATTAGGAAATTGTGTGGCAGG---------
Erinaceus_europaeus|4256            ACATTGAGAAATGCCCAGATGAAGAATGCTATTGGAAAATTGTTTAATATT---------
Procavia_capensis|7897              ACCTTCAGAAATTCCCAGATGAAAAATGCCATTGTGAAACTCTGCAGCAGA---------
Loxodonta_africana|10358            ACCTTCAGAAATGCCCAGATGAAAAATGCCCTTGTGAAATTGTGCAGCAGG---------
Echinops_telfairi|7364              ACCTTCAGAAATGCCCAGATGAAAGATGCCATT---ATGCTGTGCATTAGG---------
Loxodonta_africana|10359            ACCTTGAGAAATGCCCAGATGAAAAATGCCATCAGGAAATTGTGTAGCAGG---------
Procavia_capensis|11271             ACCTTGAGAAATGCCCAGATGAAAAATGCCATTAGGAAATTATGCAGCAGG---------
Mus_musculus|22924                  ACCTTGAGAAATGCTCAGATGAAAGATGCCATTAAGAAATTGTGTAGATGG---------
Oryctolagus_cuniculus|1855          ACCTTGAGAAATGCCCAAATGAAAAATGCCATTAGGAAATTGTGTAGTAGG---------
Homo_sapiens|17643                  ACCTTGAAGAATGCCCAGATGAAAAATGCCATCAGGAAATTGTGTAGTAGA---------
Oryctolagus_cuniculus|1854          ACATTGAGAAATGTTCAGATGAAAAATGCCATAAGGAAATTGTGTAGCAAG---------
Callithrix_jacchus|41203            ACCTTGAGGAATGCCCAGATGAAAAATGCCATTTGGAAACTGTGTAGTAGA---------
Spermophilus_tridecemlineatus|2389  ACCTTG------------------------------------------------------
Felis_catus|31463                   ACTTTGAGAAATGCCCAGATGAAAAATGCCATTAGTAAATTGTGCCGCAGG---------
Canis_familiaris|8420               ACCTTGAGAAATGCCCAAATGAAGAATGCTATTAGGAAATTATGTAGTAAG---------
Canis_familiaris|8433               ACCTTGAGAAATGCCCAAATGAAAAATGCTATTAGGAAATTGTGTAGTAAG---------
Macropus_eugenii|12245              AGCCTGAGAAATGCAGAGGTGAAAAGTGCCATGAGGAAGTTATGGAGAGAA---------
Ornithorhynchus_anatinus|16857      ACGCTGAGAAATGCAGAGGTGAAAAATGCCATGAGGAAACTATGCAGAAGA---------
Echinops_telfairi|4282              ------------------------------------------------------------
Rhesus_macaque|12555                ACCCTTAGAAATGCAGAGGTGAAAAATGCTATGAAGATGCTCATGGTTAAT---------
Loxodonta_africana|10357            ACCCTTAGAAATGCAGAAGTGAAAAATGCTATGAAGAAGCTCTGGCATCAA---------
Loxodonta_africana|23520            ACCCTTAGAAATTCAGAAGTGAAAAATGCTATGAAGAAGCTCTGGCATCAA---------
Loxodonta_africana|23521            ACTCTTAGAAATGCAGAAGTGAAAAATGCTGTGAAGAAGCTCTGGGGTCCG---------
Loxodonta_africana|10356            AGCCTTAGAAACACAGAAGTGAAAAATGCTATGAAGAAGTTG------------------
Choloepus_hoffmanni|440             ACTCTCAGGAATGCAGAGGTGAAAAATGGCATGAGGAAGCTCCAGGGTGAA---------
Oryctolagus_cuniculus|1856          ACCCTCAGAAATGCAGAGGTGAAAAATGCTATGAAGAATCTCTGGGCCAAA---------
Mus_musculus|22921                  ACTCTCAGAAATACTGAGGTTAAAAATGCTATGAAGAAACTCTGTATCAAA---------
Rattus_norvegicus|22431             ACCCTCAGAAATACTGAGGTGAAAAATGCTATGAAGAAACTCTGTGTCCAA---------
Erinaceus_europaeus|4844            ACCCTCAGGAATTCAGAGGTGAAAAATGCTATGAAGATGTTCTGGCAAAAG---------
Erinaceus_europaeus|2413            ------------------------------------------------------------
Sus_scrofa|11416                    ACTCTCCGAAATGCAGAAGTGAAAAATGCTATGAAGCAGCTTTGGATCAAA---------
Felis_catus|1160                    ACGTTGAGAAATTCAGAGGTGAAAAGTGCCATAAAGAAGCTCCGGATCAAA---------
Canis_familiaris|8432               ACCTTGAGAAATGCAGAGGTGAAAAATGCTATAAAGAAGCTCTGGATC------------
Canis_familiaris|8419               ACCTTGAGAAATGCAGAGGTGAAAAATGCTATAAAGAAGCTCTGG---------------
Monodelphis_domestica|24687         ACTTTGAGAAATAAGGAGGTAAAGGTTGCCATGAGGAATTTATGGAGTCAT---------
Macropus_eugenii|10461              ACTTTGAGGAATACAGAGGTAAAGATTGCTATGAGAAATTTATGGAGTCAA---------
Monodelphis_domestica|24684         ACACTGAGAAATGCAGAGGTGAAAAATGCCATGAAGAAACTCTGGAAAAAA---------
Cavia_porcellus|7144                ACTCTCAGAAATGCTGAGGTAAAGAATGCATTATGGAAACTCTGGAGGAGA---------
Homo_sapiens|17636                  ACACTCAGAAATGCTGAGGTAAAAAGTGCAATAAGGAAGCTTTGGAGAAAA---------
Pan_troglodytes|6844                ACACTCAGAAATGCTGAGGTAAAAAGTGCAATAAGGAAGTTTTGGAGAAAA---------
Sus_scrofa|11414                    ACCCTCAGAAATGCTGAGGTAAAAAATGCTATGAGGAAACTCTGGAGGAAG---------
Erinaceus_europaeus|4881            ------------------------------------------------------------
Otolemur_garnettii|1429             ------------------------------------------------------------
Microcebus_murinus|3048             ------------------------------------------------------------
Bos_taurus|6619                     ACCCTCAGAAATACCGAGGTAAAATGTGCTATGAAGAAACTCTGGAAGAAA---------
Bos_taurus|6624                     ACCCTCAGAAATACCGAGGTAAAATGTGCTATGAAGAAACTCTGGAAGAAA---------
Procavia_capensis|8766              ACTCTCAGAAATACTGAGGTTAAAACAGCCATGAAGAAACTCTGGAGCAAA---------
Loxodonta_africana|10360            ACTCTCAGAAATACTGAGATTAAAACTGCCATGAGGAAGCTCTGGAGCAAA---------
Vicugna_pacos|1942                  ------------------------------------------------------------
Canis_familiaris|8421               ACCCTCAGAAATGTTGAGGTAAAAAATGCTATGAGGAAGCTCTGGAGAAAA---------
Felis_catus|6205                    ------------------------------------------------------------
Ochotona_princeps|11681             ACCCTCAGAAATGCAGAGATAAAAAATGCGATAAGGAAGCTGTTGAGGAAA---------
Rattus_norvegicus|22434             ACTCTTAGGAATGCTGAGGTTAAAAATGCAATAAAGAAGCTCTGGAGAAAA---------
Mus_musculus|22917                  ACCCTCAGAAATTCTGAGGTAAAAAATGCAATAAAGAAGCTCTGGAGGAAA---------
Mus_musculus|22928                  ACCCTCAGGAATGCTGAAGTAAAAAATGCAATCAAGAAGCTCTGGAGAAAA---------
Oryctolagus_cuniculus|1853          ACTCTCAGAAATGCTGAGGTAAAAAATGCAATAAAGAAACTCTGGAGGAGA---------
Oryctolagus_cuniculus|1852          ACTCTCAGAAATGCTGAGGTAAAAAATGCAATAAAGAAACTCTTGAGGAAC---------
Ornithorhynchus_anatinus|16863      ACTGTGAGAAATGCAGAGGTGAAAAGTGCCATGAGGAAGTTATGGAGCCCC---------
Ornithorhynchus_anatinus|16862      ACCGTGAGAAACGCAGAGGTGAAAAATGCCATGAAGAAGCTGTGGAGCAGG---------
Ornithorhynchus_anatinus|16865      ACAGTGAGGAACTCAGAGGTGAAAAATGCCATGATGAAACTATGGAACAGA---------
                                                                                                

Procavia_capensis|16277             ------------------------------------------------------------
Erinaceus_europaeus|13540           ------AATTTG------ATCTCAGATGAGAAAATG------------------------
Bos_taurus|28568                    ------CAAGGAGCCATAATATCTGCAAATTGGTTATATAATTCT---------------
Dasypus_novemcinctus|13523          ------CAAGAGGCCTTGGTTGGTAAG---------------------------------
Mus_musculus|22888                  ------AGGGGACCT---------------------------------------------
Rattus_norvegicus|22406             ------AGAGGACCT---------------------------------------------
Mus_musculus|22846                  ------------------CAGGGGTCCCAC------------------------------
Rattus_norvegicus|22366             ------------------CAGGGGTGCCAC------------------------------
Ochotona_princeps|15463             ------------------------------------------------------------
Homo_sapiens|17660                  ------TGGGAGGCTTTGGCTGGGAAA---------------------------------
Pan_troglodytes|8167                ------TGGGAGGCTTTGGTTGGAAAA---------------------------------
Otolemur_garnettii|13504            ------------------------------------------------------------
Microcebus_murinus|2797             ------------------------------------------------------------
Microcebus_murinus|5059             ------CAGGGG------ACATTGGATGGCAAA---------------------------
Microcebus_murinus|10664            ------CAGGGG------ACATTGGATGGCAAA---------------------------
Tupaia_belangeri|13856              ------CAAAAGATTGTGGTTGGTAGG---------------------------------
Choloepus_hoffmanni|6189            ------CAAGAGACTTCAGTTGGCAAG---------------------------------
Choloepus_hoffmanni|10987           ------CAAGTA------ACCATGGGTGGTCAC---------------------------
Felis_catus|6208                    ------GGGGGGGCTTTTGTTGGCAGGTGC------------------------------
Canis_familiaris|28898              ------------------AGTCTTGGAAAAGAAATTAACTGGCCTTACCTCAGA------
Canis_familiaris|28666              CATAAAGATCTG------TTGAATGATTATAGAATG------------------------
Canis_familiaris|8394               ------AGACTTTTTCACTCTTTACAAAATTCCCTATGT---------------------
Canis_familiaris|8407               ------GGGATCCTGGGCATC---------------------------------------
Loxodonta_africana|10342            ------CAACAA------ATCCTG------------------------------------
Loxodonta_africana|7429             ------------------------------------------------------------
Loxodonta_africana|8250             ------------------------------------------------------------
Loxodonta_africana|10841            ------TTGAAGGCAGTGAATGATGAAGATAAG---------------------------
Loxodonta_africana|7347             ------CGAGAGACTTTAGTTGGCAAG---------------------------------
Loxodonta_africana|15374            ------------------ATACTTGTTCAAAATGACTCAAAA------------------
Loxodonta_africana|8254             ------------------------------------------------------------
Loxodonta_africana|10347            ------------------------------------------------------------
Dasypus_novemcinctus|5504           ------AGCATG------ATGTCATGTAACAAATCATGTAAA------------------
Dasypus_novemcinctus|6826           ---------------ATAATTTGGGTGTGTAAA---------------------------
Equus_caballus|5245                 ------------------------------------------------------------
Echinops_telfairi|11116             ------AGAATA------ATCTTAAGCAAATATCCAGTATAC------------------
Echinops_telfairi|11654             ------AGAGTG------ATTTTAAGTAAACATTCAAATAAT------------------
Echinops_telfairi|10565             ------AGAATA------ATCTTAAGTAAATATCCAGTATAC------------------
Vicugna_pacos|1925                  ------AGAGTA------ACCTTGGGTAACAATTCAGAG---------------------
Dasypus_novemcinctus|6644           ------AGTGGT------CTCTTAGGTAACAATTCAGAT---------------------
Spermophilus_tridecemlineatus|10360 ------AGAATC------ATCTTGGGCAACAATTCATATGAA------------------
Cavia_porcellus|23431               ------AGAATA------ATCTCAGATAGTAAT---------------------------
Callithrix_jacchus|41201            ---------ATA------ATCTGGGATAACAATTTGTGCGAT------------------
Mus_musculus|22929                  ------AGAAAA------CCTGGGAAAAGATTTACA------------------------
Rattus_norvegicus|22435             ------AGAAAA------CCTAGAAAAAGATTTACA------------------------
Equus_caballus|5271                 ------------------------------------------------------------
Sorex_araneus|6771                  ------AGAGTA------ATCTTGGATAACAATTCATGTGGGTAC---------------
Sus_scrofa|9827                     ------AAAGTA------ACCTTGGATAACAAT---------------------------
Loxodonta_africana|10361            ------AGAGAG------ATCTTAAGTAAACATTTA------------------------
Homo_sapiens|17605                  ---------ATA------ATCTGGGGTAACAATTTGTGTGAT------------------
Pan_troglodytes|6828                ---------ATA------ATCTGGGGTAACAATTTGTGTGAT------------------
Canis_familiaris|8422               ------AAAGTA------ATCTTGGGTAATAACAAT------------------------
Oryctolagus_cuniculus|1850          ------ACAGCA------GTCTTGGGAAACAATTTG------------------------
Otolemur_garnettii|13491            ------AGAATA------ATCTTAGGTAACAATCTGTGTGAA------------------
Microcebus_murinus|9568             ------AGTGTA------ATCTTGGGTAATAATTTGTGTGCA------------------
Dasypus_novemcinctus|3289           ------ATTGTA------ATCAGGGGTAATAATTCATGTAAA------------------
Dasypus_novemcinctus|6897           ---------ATG------ATATTGCGTAACCCATGTAAAAAG------------------
Dasypus_novemcinctus|15676          ------AGAGTG------ATCTTGGACAACAAATCATATAAA------------------
Choloepus_hoffmanni|6218            ------AGAGAG------ATCTTGGTTAACAATTCAGGTAAC------------------
Spermophilus_tridecemlineatus|12911 ------AAATTG------CTTGATAAA---------------------------------
Bos_taurus|29294                    ATTTTTAAAATG------CTAAGTAGTTTGGTTTTGAGC---------------------
Bos_taurus|27626                    ------AAATCT------ATTTCAGGTGATAAACTAGGAATTTTTTTCTAC---------
Sus_scrofa|11423                    ------AAAGCT------ATATCAGGTGATAAC---------------------------
Cavia_porcellus|21650               ------AATGCT------CTTTCAGATGACAAA---------------------------
Rattus_norvegicus|22372             ------AACATT------AATTCAGATGAAAAA---------------------------
Rattus_norvegicus|22374             ------AAAGTT------CAGTCAGATGACATA---------------------------
Bos_taurus|29733                    ------AAAGCT------ATTACAGATAGTGTAAACAAA---------------------
Sus_scrofa|11396                    ------AAACTG------ATTTCAGGTGAAATA---------------------------
Sus_scrofa|11395                    ------AAAGTC------ATTTCAAGTGAAATA---------------------------
Sus_scrofa|11400                    ------AATGCT------ATTTCAGGTGAAATA---------------------------
Sus_scrofa|11399                    ------AAAGTC------ATTTCAACAAGAGATAAAGAA---------------------
Choloepus_hoffmanni|258             ------AAAGTT------GTTTCATACAAA------------------------------
Monodelphis_domestica|24688         ------AATGATGCTGTTGTTAGCTAT---------------------------------
Monodelphis_domestica|24689         ------AAGGAGACTTTGCTTAAC------------------------------------
Monodelphis_domestica|24691         ------AAGGAGACTTTGGTTAACCAG---------------------------------
Callithrix_jacchus|41212            ------AAAGCT------ATTTCAAGTGCCAAATCA------------------------
Homo_sapiens|17635                  ------AAAGCT------ATTTCAAGTGTCAAA---------------------------
Equus_caballus|5278                 ------------------------------------------------------------
Canis_familiaris|8369               GGCTTCAGAATCCTATCATTGTCATGTCAC------------------------------
Canis_familiaris|8352               ------AAAGAAGATTTCCTAGATAAAAAGGACATC------------------------
Canis_familiaris|8363               ------AAAGTTATTTCAGTTTGCCTGAAA------------------------------
Bos_taurus|6622                     ------GTCGGGTTTAGTTTTACTAGCTTCAACCAGTTACATGAATTCACAGGTTTTTCT
Mus_musculus|22922                  ------AAAATT------CTTTCAAGTAATAAA---------------------------
Rattus_norvegicus|22432             ------AAAATT------CTTTCAAGTAATAAA---------------------------
Bos_taurus|6627                     ------AAAGTT------ACTTCAGATTTTTCATCTAACAAAATGAAAGAATATACAGTC
Sus_scrofa|11415                    ------AAAGCC------ATTTCAGGTGACAGA---------------------------
Sus_scrofa|11413                    ------AAAGCT------ATCTTAGGTGACAAA---------------------------
Sus_scrofa|9826                     ------------------------------------------------------------
Sus_scrofa|11406                    ------AAAGCG------ATCTTA------------------------------------
Sus_scrofa|11409                    ------AAAGCG------ATCTTAGGTGACAAA---------------------------
Erinaceus_europaeus|4256            ------AAAGTT------ATTTCAAATGAAAGG---------------------------
Procavia_capensis|7897              ------AAATCT------ATTTCAGAT---------------------------------
Loxodonta_africana|10358            ------AAATCT------ATTTCAGATGACAAA---------------------------
Echinops_telfairi|7364              ------AAAATG------ATTCCAGGTAGCAAA---------------------------
Loxodonta_africana|10359            ------AAAGCT------ATTTCAAGTGACAAA---------------------------
Procavia_capensis|11271             ------AAAACT------ATTTCAGGTGAC------------------------------
Mus_musculus|22924                  ------AAAGATGATGTTATTTCCATCAACAAA---------------------------
Oryctolagus_cuniculus|1855          ------AATGCC------ACTTCAGTTGACAAA---------------------------
Homo_sapiens|17643                  ------AAGGAC------ATTTCAGGTGACAAA---------------------------
Oryctolagus_cuniculus|1854          ------AAAACT------ATTTCAAATGAC------------------------------
Callithrix_jacchus|41203            ------AAGGTC------ATTTCAGGTAATGAAGTTTCCATCATGTTTCCAAATATAACG
Spermophilus_tridecemlineatus|2389  ------------------------------------------------------------
Felis_catus|31463                   ------AAAGCT------ATTTCAGGGGAGAAA---------------------------
Canis_familiaris|8420               ------AAAGCT------ATTTCAGGTTCAGAACCATTTTTTATTGCTAAT---------
Canis_familiaris|8433               ------AAAGCT------ATTTCAGAAAAGAGAAAATATAAC------------------
Macropus_eugenii|12245              ------AAATTT------GCCTGGAATACCAAA---------------------------
Ornithorhynchus_anatinus|16857      ------AAAGTG------TCAAGCCACAAGATAAATGGTCCAAAA---------------
Echinops_telfairi|4282              ------------------------------------------------------------
Rhesus_macaque|12555                ------ATAATC------CTTAAGACAAACAAGAAA------------------------
Loxodonta_africana|10357            ------AAACTG------ACTTCAAGT---------------------------------
Loxodonta_africana|23520            ------------------AAAAATGACTTCAAG---------------------------
Loxodonta_africana|23521            ------AAAGCG------ACCTCAAGTGAGAAG---------------------------
Loxodonta_africana|10356            ------------------------------------------------------------
Choloepus_hoffmanni|440             ------ATGGTG------ATTTCAACT---------------------------------
Oryctolagus_cuniculus|1856          ------AGAAAA------CTTAAAAATAAAAACCCA------------------------
Mus_musculus|22921                  ------GTTGAT------------------------------------------------
Rattus_norvegicus|22431             ------------------GTTGATTTAAAT------------------------------
Erinaceus_europaeus|4844            ------GTGAAT------------------------------------------------
Erinaceus_europaeus|2413            ------------------------------------------------------------
Sus_scrofa|11416                    ------AGTTTT------ATTTACTTCTTCACAAAGCACTCA------------------
Felis_catus|1160                    ------------------------------------------------------------
Canis_familiaris|8432               ------------------------------------------------------------
Canis_familiaris|8419               ------------------------------------------------------------
Monodelphis_domestica|24687         ------AGAATT------GTCTCATGTAAGAAA---------------------------
Macropus_eugenii|10461              ------AGAATG------ATCTCATGT---------------------------------
Monodelphis_domestica|24684         ------AATATA------TCTTCAAGTGAGAAA---------------------------
Cavia_porcellus|7144                ------AAAGTG------ACTTCAGATAGG------------------------------
Homo_sapiens|17636                  ------AAAGTG------ACTTCAGATAATGAT---------------------------
Pan_troglodytes|6844                ------AAAGTG------ACTTCAGATAATGAT---------------------------
Sus_scrofa|11414                    ------AAAGTG------ACTTCAAATAATGAT---------------------------
Erinaceus_europaeus|4881            ------------------------------------------------------------
Otolemur_garnettii|1429             ------------------------------------------------------------
Microcebus_murinus|3048             ------------------------------------------------------------
Bos_taurus|6619                     ------AAAGTG------CGTTCAGAC------------TTACTGTCTCCCATCTCTCAC
Bos_taurus|6624                     ------AAAGTG------CGTTCAGATAATAGAAATGAGGTAATGGAACTGGTGATATTT
Procavia_capensis|8766              ------AAAGTG------ACTTCAGACGAGTCA---------------------------
Loxodonta_africana|10360            ------AAAGTG------ATTTCAGCTGAT------------------------------
Vicugna_pacos|1942                  ------------------------------------------------------------
Canis_familiaris|8421               ------AAAGTG------ACTTCAGATAATGAATTACAA---------------------
Felis_catus|6205                    ------------------------------------------------------------
Ochotona_princeps|11681             ------AAAGGG------AACTCA------------------------------------
Rattus_norvegicus|22434             ------AAAAAG------ATAACTGATTCTGAA---------------------------
Mus_musculus|22917                  ------AAAATA------------------------------------------------
Mus_musculus|22928                  ------AAAGTA------ACTTCAGATAGTAAT---------------------------
Oryctolagus_cuniculus|1853          ------AAAGTG------GCTACAGAGAGTAAC---------------------------
Oryctolagus_cuniculus|1852          ------AGAATG------AATTCAGATAGGAAC---------------------------
Ornithorhynchus_anatinus|16863      ------AAAGCG------ACTTCAGGTTGCAAA---------------------------
Ornithorhynchus_anatinus|16862      ------AAAGTG------AAA---------------------------------------
Ornithorhynchus_anatinus|16865      ------AAAGTG------AAA---------------------------------------
                                                                                                

Procavia_capensis|16277             ------------------------
Erinaceus_europaeus|13540           ---------------------TGA
Bos_taurus|28568                    ------------------------
Dasypus_novemcinctus|13523          ---------------------TAA
Mus_musculus|22888                  ---------------------TGA
Rattus_norvegicus|22406             ---------------------TGA
Mus_musculus|22846                  ---------------------TAA
Rattus_norvegicus|22366             ---------------------TAA
Ochotona_princeps|15463             ------------------------
Homo_sapiens|17660                  ---------------------TAA
Pan_troglodytes|8167                ---------------------TAA
Otolemur_garnettii|13504            ------------------------
Microcebus_murinus|2797             ------------------------
Microcebus_murinus|5059             ---------------------TAA
Microcebus_murinus|10664            ---------------------TAA
Tupaia_belangeri|13856              ---------------------TAA
Choloepus_hoffmanni|6189            ---------------------TAA
Choloepus_hoffmanni|10987           ---------------------TAG
Felis_catus|6208                    ------------------------
Canis_familiaris|28898              ------------------------
Canis_familiaris|28666              ------------------------
Canis_familiaris|8394               ------------------------
Canis_familiaris|8407               ------------------------
Loxodonta_africana|10342            ------------------------
Loxodonta_africana|7429             ------------------------
Loxodonta_africana|8250             ------------------------
Loxodonta_africana|10841            ------------------------
Loxodonta_africana|7347             ---------------------TAA
Loxodonta_africana|15374            ------------------------
Loxodonta_africana|8254             ------------------------
Loxodonta_africana|10347            ------------------------
Dasypus_novemcinctus|5504           ---------------------TAG
Dasypus_novemcinctus|6826           ---------------------TAA
Equus_caballus|5245                 ------------------------
Echinops_telfairi|11116             ------------------------
Echinops_telfairi|11654             ---------------------TAG
Echinops_telfairi|10565             ------------------------
Vicugna_pacos|1925                  ---------------------TAG
Dasypus_novemcinctus|6644           ---------------------TAG
Spermophilus_tridecemlineatus|10360 ---------------------TAG
Cavia_porcellus|23431               ------------------------
Callithrix_jacchus|41201            ---------------------TAG
Mus_musculus|22929                  ---------------------TGA
Rattus_norvegicus|22435             ---------------------TGA
Equus_caballus|5271                 ------------------------
Sorex_araneus|6771                  ------------------------
Sus_scrofa|9827                     ------------------------
Loxodonta_africana|10361            ------------------------
Homo_sapiens|17605                  ---------------------TAG
Pan_troglodytes|6828                ---------------------TAG
Canis_familiaris|8422               ------------------------
Oryctolagus_cuniculus|1850          ------------------------
Otolemur_garnettii|13491            ---------------------TAG
Microcebus_murinus|9568             ---------------------TAG
Dasypus_novemcinctus|3289           ---------------------TAG
Dasypus_novemcinctus|6897           ------------------------
Dasypus_novemcinctus|15676          ---------------------TAG
Choloepus_hoffmanni|6218            ---------------------TAG
Spermophilus_tridecemlineatus|12911 ---------------------TGA
Bos_taurus|29294                    ------------------------
Bos_taurus|27626                    ------------------------
Sus_scrofa|11423                    ---------------------TAA
Cavia_porcellus|21650               ---------------------TAA
Rattus_norvegicus|22372             ---------------------TAA
Rattus_norvegicus|22374             ---------------------TAA
Bos_taurus|29733                    ------------------------
Sus_scrofa|11396                    ---------------------TAA
Sus_scrofa|11395                    ---------------------TAA
Sus_scrofa|11400                    ---------------------TAA
Sus_scrofa|11399                    ------------------------
Choloepus_hoffmanni|258             ---------------------TAA
Monodelphis_domestica|24688         ---------------------TAA
Monodelphis_domestica|24689         ------------------------
Monodelphis_domestica|24691         ---------------------TAA
Callithrix_jacchus|41212            ------------------------
Homo_sapiens|17635                  ---------------------TAA
Equus_caballus|5278                 ------------------------
Canis_familiaris|8369               ------------------------
Canis_familiaris|8352               ------------------------
Canis_familiaris|8363               ---------------------TAA
Bos_taurus|6622                     TCTAATGACAAA------------
Mus_musculus|22922                  ---------------------TGA
Rattus_norvegicus|22432             ---------------------TGA
Bos_taurus|6627                     ATACTCCATAAAGAAATTTCC---
Sus_scrofa|11415                    ---------------------TAA
Sus_scrofa|11413                    ---------------------TAA
Sus_scrofa|9826                     ------------------------
Sus_scrofa|11406                    ------------------------
Sus_scrofa|11409                    ---------------------TAA
Erinaceus_europaeus|4256            ------------------------
Procavia_capensis|7897              ---------------------TAA
Loxodonta_africana|10358            ------------------------
Echinops_telfairi|7364              ---------------------TAA
Loxodonta_africana|10359            ------------------------
Procavia_capensis|11271             ---------------------TAA
Mus_musculus|22924                  ---------------------TAA
Oryctolagus_cuniculus|1855          ---------------------TAA
Homo_sapiens|17643                  ---------------------TAA
Oryctolagus_cuniculus|1854          ---------------------TAA
Callithrix_jacchus|41203            ATTATTGCCACAAGG------TAG
Spermophilus_tridecemlineatus|2389  ------------------------
Felis_catus|31463                   ---------------------TAA
Canis_familiaris|8420               ------------------------
Canis_familiaris|8433               ------------------------
Macropus_eugenii|12245              ---------------------TAA
Ornithorhynchus_anatinus|16857      ------------------------
Echinops_telfairi|4282              ------------------------
Rhesus_macaque|12555                ------------------------
Loxodonta_africana|10357            ------------------------
Loxodonta_africana|23520            ---------------------TAA
Loxodonta_africana|23521            ---------------------TAA
Loxodonta_africana|10356            ------------------------
Choloepus_hoffmanni|440             ------------------------
Oryctolagus_cuniculus|1856          ------------------------
Mus_musculus|22921                  ---------------------TAA
Rattus_norvegicus|22431             ---------------------TGA
Erinaceus_europaeus|4844            ------------------------
Erinaceus_europaeus|2413            ------------------------
Sus_scrofa|11416                    ------------------------
Felis_catus|1160                    ------------------------
Canis_familiaris|8432               ---------------------TAA
Canis_familiaris|8419               ------------------------
Monodelphis_domestica|24687         ---------------------TAA
Macropus_eugenii|10461              ------------------------
Monodelphis_domestica|24684         ---------------------TGA
Cavia_porcellus|7144                ------------------------
Homo_sapiens|17636                  ---------------------TAA
Pan_troglodytes|6844                ---------------------TAA
Sus_scrofa|11414                    ---------------------TAA
Erinaceus_europaeus|4881            ------------------------
Otolemur_garnettii|1429             ------------------------
Microcebus_murinus|3048             ------------------------
Bos_taurus|6619                     TCTCCTTATCAT------------
Bos_taurus|6624                     ATTAAAAAAACA------------
Procavia_capensis|8766              ------------------------
Loxodonta_africana|10360            ---------------------TGA
Vicugna_pacos|1942                  ------------------------
Canis_familiaris|8421               ------------------------
Felis_catus|6205                    ------------------------
Ochotona_princeps|11681             ------------------------
Rattus_norvegicus|22434             ------------------------
Mus_musculus|22917                  ---------------------TAA
Mus_musculus|22928                  ---------------------TAA
Oryctolagus_cuniculus|1853          ---------------------TGA
Oryctolagus_cuniculus|1852          ---------------------TAA
Ornithorhynchus_anatinus|16863      ------------------------
Ornithorhynchus_anatinus|16862      ------------------------
Ornithorhynchus_anatinus|16865      ------------------------
                                                            

multiple sequence alignment in CLUSTALW format


Procavia_capensis|15234             -------------------------------------------------------MKLNC
Erinaceus_europaeus|11142           ------------------------------------------------------------
Bos_taurus|2072                     -------------------------------------------------------MGNPN
Dasypus_novemcinctus|11961          --------------------------------------------------------MGQN
Mus_musculus|36989                  -------------------------------------------------------MENAN
Rattus_norvegicus|30188             -------------------------------------------------------MENAK
Mus_musculus|25916                  -------------------------------------------------------MMNKN
Rattus_norvegicus|30154             -------------------------------------------------------MMNKN
Ochotona_princeps|13479             ------------------------------------------------------------
Homo_sapiens|10775                  -------------------------------------------------------MENQN
Pan_troglodytes|209                 -------------------------------------------------------MENQN
Otolemur_garnettii|11628            -------------------------------------------------------MENPN
Microcebus_murinus|2378             -------------------------------------------------------MENKN
Microcebus_murinus|4300             -------------------------------------------------------MENKN
Microcebus_murinus|9050             -------------------------------------------------------MENKS
Tupaia_belangeri|12023              -------------------------------------------------------MENKN
Choloepus_hoffmanni|5461            -------------------------------------------------------MGNQN
Choloepus_hoffmanni|9704            -------------------------------------------------------MGNQN
Felis_catus|4991                    -------------------------------------------------------MENPN
Canis_familiaris|25272              ------------------------------------------------------YMENPK
Canis_familiaris|10031              -------------------------------------------------------MENPK
Canis_familiaris|4423               -------------------------------------------------------MENPK
Canis_familiaris|8914               -------------------------------------------------------MENPR
Loxodonta_africana|23767            -------------------------------------------------------NQNQN
Loxodonta_africana|24556            -------------------------------------------------------MGNQN
Loxodonta_africana|24428            -------------------------------------------------------MGNQN
Loxodonta_africana|951              -------------------------------------------------------MRNQN
Loxodonta_africana|18776            -------------------------------------------------------MGNQN
Loxodonta_africana|18052            -------------------------------------------------------MGNQN
Loxodonta_africana|24432            -------------------------------------------------------MGNQN
Loxodonta_africana|23808            -------------------------------------------------------MGNQN
Dasypus_novemcinctus|4872           --------------------------------IDLPNHNPYAICRYINYPNTKLDLEQVK
Dasypus_novemcinctus|6033           ------------------------------------------------------------
Equus_caballus|4812                 ----------------------------------------------------------MN
Echinops_telfairi|8774              --VYKEDQPSLGFLHSGFPVLQEITLTKIILLISIYLSHHNPCIICRTNPNATLDVAREN
Echinops_telfairi|9190              ------------------------------------------------------------
Echinops_telfairi|8335              -----TKTIFQGLSLSFPSVLQKQTTLTESIPLISIYLSHIPCIICRTNPNAILGCRQEN
Vicugna_pacos|1793                  ---------------------------------IYPPSCNPAIYREIRYPNAELDSERMN
Dasypus_novemcinctus|5871           ----------------------------------TDLMPCSPCAFCRTNYPNAKLDLEQN
Spermophilus_tridecemlineatus|9303  ----TNSIAWLSLEFFVLFSVLQKILFQVISFFKPPNLNICTIHRSINHTNTIVDLEQVN
Cavia_porcellus|18544               -------------------------------------------------------MEPLN
Callithrix_jacchus|32658            ---------------------------------YYRKKCLTCQHHKKINYPNAKLDKQVN
Mus_musculus|34387                  -------------------------------------------------------MKQIN
Rattus_norvegicus|31149             -------------------------------------------------------MKQMN
Equus_caballus|5487                 -------------------------------------------------------MELMS
Sorex_araneus|6023                  TNNIALLSLEFICSGFSLVFQKIILTQIVRLIKIRLLHCNLCTHRYIEYPNAKLEFEQMN
Sus_scrofa|13979                    -------------------------------------------------------TEQMN
Loxodonta_africana|23917            -------------------------------------------------------MERVN
Homo_sapiens|37106                  --------------------------------MYVSNCNPCAIHRKINYPNTKLDFEQVN
Pan_troglodytes|12105               --------------------------------MYVSNCNPCAIHRKINYPNTKLDFKQVN
Canis_familiaris|904                -------------------------------------------LRQFCLNVVLSSTEQMN
Oryctolagus_cuniculus|13489         -------------------------------------------------------QNEMN
Otolemur_garnettii|11618            --TNNMTPVSLGFICLRIPSVVQKIILTEVIFLFMMYVPNYSPCPIFRINNTSLDLEQVN
Microcebus_murinus|8112             ------------------------------------------------------------
Dasypus_novemcinctus|2903           ------------------------------------------------------------
Dasypus_novemcinctus|6096           ------------------------------------------------------------
Dasypus_novemcinctus|13854          ------------------------------------------------------------
Choloepus_hoffmanni|5486            ---------------------------------IYLPPCNPCAVCRINYPKAKLNSWQVK
Spermophilus_tridecemlineatus|11578 -------------------------------------------------------METTN
Bos_taurus|3111                     -------------------------------------------------------HMENR
Bos_taurus|1601                     -------------------------------------------------------MENRS
Sus_scrofa|15419                    -------------------------------------------------------MENRN
Cavia_porcellus|17088               -------------------------------------------------------MENRN
Rattus_norvegicus|30159             -------------------------------------------------------MEIRN
Rattus_norvegicus|30160             -------------------------------------------------------METSN
Bos_taurus|1907                     ------------------------------------------------------------
Sus_scrofa|15393                    -------------------------------------------------------METRN
Sus_scrofa|15392                    -------------------------------------------------------METKN
Sus_scrofa|15397                    -------------------------------------------------------RETRN
Sus_scrofa|15396                    -------------------------------------------------------METRN
Choloepus_hoffmanni|222             ------------------------------------------------------------
Monodelphis_domestica|14059         -------------------------------------------------------MDNGK
Monodelphis_domestica|14062         -------------------------------------------------------MDNRN
Monodelphis_domestica|14073         -------------------------------------------------------MDNRN
Callithrix_jacchus|32668            -------------------------------------------------------MPNKN
Homo_sapiens|39125                  -------------------------------------------------------MANRN
Equus_caballus|5700                 -------------------------------------------------------MENMN
Canis_familiaris|1255               -------------------------------------------------------MEIRN
Canis_familiaris|327                -------------------------------------------------------MENRN
Canis_familiaris|1093               ----------------------------------------------------YEIMGNRN
Bos_taurus|18706                    -----------------------------------------------------MKPMNRN
Mus_musculus|13070                  -------------------------------------------------------MENQN
Rattus_norvegicus|31148             -------------------------------------------------------MENQN
Bos_taurus|18713                    -------------------------------------------------------MENRN
Sus_scrofa|15412                    -------------------------------------------------------IKNMN
Sus_scrofa|15410                    -------------------------------------------------------MENRN
Sus_scrofa|13978                    -------------------------------------------------------MENRN
Sus_scrofa|15403                    -------------------------------------------------------MENRN
Sus_scrofa|15406                    -------------------------------------------------------MENRN
Erinaceus_europaeus|3494            -------------------------------------------------------MENRN
Procavia_capensis|7410              ----------------------------------------------------VKYMENKN
Loxodonta_africana|23895            -------------------------------------------------------MENKN
Echinops_telfairi|5825              ------------------------------------------------------------
Loxodonta_africana|808              --------------------------------------------------------MESR
Procavia_capensis|10537             ----------------------------------------------------KEYMERRN
Mus_musculus|11744                  -------------------------------------------------------MEIRS
Oryctolagus_cuniculus|13484         -------------------------------------------------------MENRN
Homo_sapiens|10681                  -------------------------------------------------------MENRN
Oryctolagus_cuniculus|13485         -------------------------------------------------------MEKRN
Callithrix_jacchus|32659            ----------------------------------------------------MKHMENRN
Spermophilus_tridecemlineatus|2147  ------------------------------------------------------------
Felis_catus|4858                    ----------------------------------------------------VKRMEKRN
Canis_familiaris|361                -------------------------------------------------------MEIRN
Canis_familiaris|3371               ---------------------------------------------------QVKHMEIRN
Macropus_eugenii|11133              ------------------------------------------------------------
Ornithorhynchus_anatinus|12697      -------------------------------------------------------MENEN
Echinops_telfairi|3435              -------------------------------------------------------MARIN
Rhesus_macaque|14921                -------------------------------------------------------MMRMN
Loxodonta_africana|23889            ----------------------------------------------------------MN
Loxodonta_africana|25373            -------------------------------------------------------AVKKM
Loxodonta_africana|25375            -------------------------------------------------------MKRMN
Loxodonta_africana|23886            ----------------------------------------------------------MN
Choloepus_hoffmanni|389             -------------------------------------------------------MERMN
Oryctolagus_cuniculus|23570         -------------------------------------------------------IMRMH
Mus_musculus|25089                  ----------------------------------------------------------MN
Rattus_norvegicus|31147             ----------------------------------------------------------MN
Erinaceus_europaeus|3972            -------------------------------------------------------VAAMN
Erinaceus_europaeus|1970            -------------------------------------------------------VAAMN
Sus_scrofa|15413                    -------------------------------------------------------MERTN
Felis_catus|7080                    -------------------------------------------------------MKKMN
Canis_familiaris|8998               ----------------------------------------------------------MN
Canis_familiaris|8954               -------------------------------------------------------MEKMN
Monodelphis_domestica|14053         -------------------------------------------------------MKSIN
Macropus_eugenii|9520               ------------------------------------------------------------
Monodelphis_domestica|14044         -------------------------------------------------------MDNGN
Cavia_porcellus|5546                --------------------------------------------------MHTECMENNR
Homo_sapiens|10675                  -------------------------------------------------------MEKKK
Pan_troglodytes|33591               -------------------------------------------------------MEKKK
Sus_scrofa|15411                    -------------------------------------------------------MEKKR
Erinaceus_europaeus|4004            -------------------------------------------------------MENKR
Otolemur_garnettii|1223             -------------------------------------------------------MENKR
Microcebus_murinus|2587             -------------------------------------------------------MEMKR
Bos_taurus|18699                    -----------------------------------------------------TMMANER
Bos_taurus|18708                    ---------------------------------------------------------NER
Procavia_capensis|8213              -------------------------------------------------------MENNR
Loxodonta_africana|23908            -------------------------------------------------------MENNR
Vicugna_pacos|1809                  -------------------------------------------------------MEEER
Canis_familiaris|851                -------------------------------------------------------MENKR
Felis_catus|7936                    -------------------------------------------------------MENKR
Ochotona_princeps|10193             -------------------------------------------------------MENKR
Rattus_norvegicus|13129             -------------------------------------------------------MENRR
Mus_musculus|25090                  -------------------------------------------------MNDTEHMENKR
Mus_musculus|36987                  -------------------------------------------------------MENKR
Oryctolagus_cuniculus|13486         -------------------------------------------------------MENKR
Oryctolagus_cuniculus|13487         -------------------------------------------------------MENKR
Ornithorhynchus_anatinus|12702      -------------------------------------------------------MENRK
Ornithorhynchus_anatinus|12701      -------------------------------------------------------MEKKN
Ornithorhynchus_anatinus|12703      -----------------------------------------------------MEQMENH
                                                                                                

Procavia_capensis|15234             SVTEFILSGLTQDAVKEKKVLVVFLFLYLATLLANLLIVMTMRYSRMLGGPMYFFLFYLS
Erinaceus_europaeus|11142  &nbs