Orthologs Set ID: EOG4006CT


Orthology Database
OrthoDB4
Gene Symbol(s)
LOC100437797,IPI00698934.4,LOC617297

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Bos taurus 29448
Bos taurus 6014
Canis familiaris 12298
Pongo abelii 5019
Tursiops truncatus 16932

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Bos taurus 6014 ENSBTAT00000045473 617297 ENSBTAG00000045599 LOC617297 bosTau4
Bos taurus 29448 ENSBTAT00000047482 617297 ENSBTAG00000033379 IPI00698934.4 bosTau4
Canis familiaris 12298 ENSCAFT00000037637 485353 ENSCAFG00000024368 canFam2
Pongo abelii 5019 ENSPPYT00000004205 100437797 ENSPPYG00000003528 LOC100437797 ponAbe2
Tursiops truncatus 16932 ENSTTRT00000003234 101320902 ENSTTRG00000003235 turTru1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Bos taurus 867 ENSBTAP00000044688 617297 ENSBTAG00000033379 IPI00698934.4 bosTau4
Bos taurus 12426 ENSBTAP00000042860 617297 ENSBTAG00000045599 LOC617297 bosTau4
Canis familiaris 10455 ENSCAFP00000033181 485353 ENSCAFG00000024368 canFam2
Pongo abelii 21451 ENSPPYP00000004047 100437797 ENSPPYG00000003528 LOC100437797 ponAbe2
Tursiops truncatus 16034 ENSTTRP00000003032 101320902 ENSTTRG00000003235 turTru1

multiple sequence alignment in CLUSTALW format


Canis_familiaris|12298   CCACAGCTGGGATTCATTTCTATGGCTGGAGGAAACTGGACAAGAGTTGAGGAATTTATC
Pongo_abelii|5019        ---------ATGCCCATACTTATGGCTATAGGAAACTGGACAGAAATAAGTGAATTTATC
Bos_taurus|29448         ------TTCATTCCTATATTTATGGCTGAAGGAAACTGGACAAGAGTTAATGAGTTTATC
Bos_taurus|6014          ------TTCATTCCTATATTTATGGCTGAAGGAAACTGGACAAGAGTTAATGAGTTTATC
Tursiops_truncatus|16932 ---------ATTCCTATAACAATGGCTGAAGGAAACTGGACAAGAGTTAGTGAGTTTATC
                                  .     **:  :******. *************..*.*:.. **.******

Canis_familiaris|12298   CTCATGAGCTTCTCTTCTCTACCTACTGAAATACAATTGTTACTCTTCCTGACATTCCTA
Pongo_abelii|5019        CTCATGAGCTTCTCTTCCCTGCCTACTGAAATACAGTCATTGCTCTTCCTGACATTTCTA
Bos_taurus|29448         CTCATGAGTTTCTCTTCCTTACCTACTGAAATACAGTCATTACTCTTCCTGACATTTCTA
Bos_taurus|6014          CTCATGAGTTTCTCTTCCTTACCTACTGAAATACAGTCATTACTCTTCCTGACATTTCTA
Tursiops_truncatus|16932 CTCATGAGTTTCTCTTCCCTACCTAGTGAAATACAGTCATTACTCTTCCTGATATTTTTA
                         ******** ********  *.**** *********.* .**.********** ***  **

Canis_familiaris|12298   ATCATCTACCTGGTCACCCTGATGGGAAACACCCTCATCATTCTGGTTACTTTGGCTGAT
Pongo_abelii|5019        ACCATATATCTGGTCACTCTGATGGGAAACAGCCTCATCATTCTGGTTACCCTAGCTGAC
Bos_taurus|29448         TTCATCTACCTGGTCACTCTGCTGGGAAACAGCCTCATCATTCTGGTTACCTTGGCTGAC
Bos_taurus|6014          TTCATCTACCTGGTCACTCTGCTGGGAAACAGCCTCATCATTCTGGTTACCTTGGCTGAC
Tursiops_truncatus|16932 ATCATCTACCTAGTCACCCTGCTGGGAAACAGCCTCATCATTCTGGTTGCCTTGGCTGAC
                         : ***.** **.***** ***.********* ****************.*  *.***** 

Canis_familiaris|12298   CCCATGCTGCACAGTCCCATGTACTTCTTCCTCAGGAACTTGTCCTTCTTGGAGATTGGC
Pongo_abelii|5019        CCCATGCTACACAACCCCATGTACTTCTTCCTCAGAAACTTATCTTTCCTGGAGATTGGC
Bos_taurus|29448         CCCATGCTGCACAGCCCCATGTACTTCTTCCTCAGGAACTTGTCCTTCTTAGAGATTGGC
Bos_taurus|6014          CCCATGCTGCACAGCCCCATGTACTTCTTCCTCAGGAACTTGTCCTTCTTAGAGATTGGC
Tursiops_truncatus|16932 CCCATGCTGCACAGCCCCATGTACTTCTTCCTCAGGAACTTGTCTTTCATAGAGATTGGC
                         ********.****. ********************.*****.** *** *.*********

Canis_familiaris|12298   TTCAACCTAGTCATTGTGCCCAAGATGCTGGGGACCCTGCTTGCCTGGGACACAACCATC
Pongo_abelii|5019        TTCAACCTAGTCATTGTGCCCAAAATGCTGGGGACCCTGCTTGCCCAGGACACAACCATC
Bos_taurus|29448         TTCAATTTAGCTATTGTGCCCAAGATGCTGGGGACCCTGATTGCCCAGGACACAACCATC
Bos_taurus|6014          TTCAATTTAGCTATTGTGCCCAAGATGCTGGGGACCCTGATTGCCCAGGACACAACCATC
Tursiops_truncatus|16932 TTCAACCTAGTCATTGTGCCCAAGATGCTGGGGACCCTGATTGCCCAGGACACAACCATC
                         *****  ***  ***********.***************.***** .*************

Canis_familiaris|12298   TCCTTTCTTGGCTGTGCCACACAGATGTATTTCTTCTTCTTCTTTGGAGGTGCTGAATGC
Pongo_abelii|5019        TCCTTCCTTGGCTGTGCCACTCAGATGTATTTCTTCTTCTTCTTTGGGGTAGCTGAATGC
Bos_taurus|29448         TCCTTTCTTGGCTGTGCCACTCAGATGTATTTCTTCTTCTTCTTTGGGGTTTCTGAATGC
Bos_taurus|6014          TCCTTTCTTGGCTGTGCCACTCAGATGTATTTCTTCTTCTTCTTTGGGGTTTCTGAATGC
Tursiops_truncatus|16932 TCCTTTCTTGGCTGTGCCACTCAGATGTATTTCTTCTTCTTCTTTGGGGTTTTTGAATGT
                         ***** **************:**************************.* :  ****** 

Canis_familiaris|12298   TTCCTCCTGGCCACCATGGCATATGACCGCTATGTAGCCATCTGCAGTCCCTTGCACTAC
Pongo_abelii|5019        TTCCTCCTGGCCACCATGGCATATGACCGCTATGTGGCCATCTGCAGTCCCTTGCACTAC
Bos_taurus|29448         TCCCTCCTGGCCACCATGGCCTATGACCGCTATGTAGCCATCTGCAGTCCCTTGCACTAC
Bos_taurus|6014          TCCCTCCTGGCCACCATGGCCTATGACCGCTATGTAGCCATCTGCAGTCCCTTGCACTAC
Tursiops_truncatus|16932 TTCCTCCTGGCCACAATGGCATATGACCGCTATGTAGCCATCTGCAATCCCTTGCACTAC
                         * ************.*****.**************.**********.*************

Canis_familiaris|12298   CCAGTCATCATGAACCAAAAGACACGTGCCAAATTGGCTGTCGCTTCTTGGTTTCCAGGC
Pongo_abelii|5019        CCAGTCATCATGAACCAAAGGACACGGGCCAAACTGGCTGCTGCCTCCTGGTTCCCAGGC
Bos_taurus|29448         CCAGTCATCATGAACCCAAGGACACGTGCCAAACTGGCAGCTGTCTCCTGGTTTCCAGGC
Bos_taurus|6014          CCAGTCATCATGAACCCAAGGACACGTGCCAAACTGGCAGCTGTCTCCTGGTTTCCAGGC
Tursiops_truncatus|16932 CCAGTCATCATGAACCCTAAGACATGGGCAAAACTGGCTGTTGCCTCCTGGTTTCCAGGC
                         ****************.:*.**** * **.*** ****:*  *  ** ***** ******

Canis_familiaris|12298   TTTCCTGTTGCTACCGTGCAGACCACGTGGCTCTTCAGTTTTCCATTCTGTGGCACCAAC
Pongo_abelii|5019        TTCCCTGTAGCTACTGTGCAGACCACATGGCTCTTCAGTTTTCCATTTTGTGGCACCAAC
Bos_taurus|29448         ATTCCTGTAGCTACTGTGCAGACCACATGGCTCTTCAGCTTTCCATTCTGTGGTAGCAAC
Bos_taurus|6014          ATTCCTGTAGCTACTGTGCAGACCACATGGCTCTTCAGCTTTCCATTCTGTGGTAGCAAC
Tursiops_truncatus|16932 ATTCCCATGGCTACTGTGCAGACCACATGGCTCTTCAGCTTTCCATTCTGTGGCACC---
                         :* ** .* ***** ***********.*********** ******** ***** * *   

Canis_familiaris|12298   AAGGTGAACCACTTCTTCTGTGACAGCCCACCTGTGTTGAGGCTGGTCTGTGCAGACACA
Pongo_abelii|5019        AAGGTGAACCACTTCTTCTGTGACAGCCCACCTGTGCTGAGGCTGATTTGTGCAGACACA
Bos_taurus|29448         AATGTGAACCACTTCTTCTGTGACAGCCCACCTGTGCTGAGGCTGGTCTGTGCAGACACA
Bos_taurus|6014          AATGTGAACCACTTCTTCTGTGACAGCCCACCTGTGCTGAGGCTGGTCTGTGCAGACACA
Tursiops_truncatus|16932 AAGGTGAATCACTTCTTCTGTGACAGCCCACCTGTGCTGAGGCTGGTCTGTGCAGACACG
                         ** ***** *************************** ********.* ***********.

Canis_familiaris|12298   GCACTGTTTGAAATCTATGCAATTGTTGGAACCATTCTGGTCGTCATGACACCCTGCTTG
Pongo_abelii|5019        GCACTGTTTGAGATCTACGCCATCGTCGGAACCATTCTGGTGGTCATGATCCCCTGCTTG
Bos_taurus|29448         GCACTGTTTGAGATCTATGCCATTATTGGAACCATTCTATTTGTCATGATTCCCTGCTTG
Bos_taurus|6014          GCACTGTTTGAGATCTATGCCATTATTGGAACCATTCTATTTGTCATGATTCCCTGCTTG
Tursiops_truncatus|16932 GCACTGTTTGAGATCTATGCCATTGTTGGAACCATTCTGGTCGTCATGATACCCTGCTTG
                         ***********.***** **.** .* ***********. * *******  *********

Canis_familiaris|12298   CTGATCCTGTGCTCCTATACTCGCATTGCTGCTGCCATCCTCAAAATTCCATCAGCTAAA
Pongo_abelii|5019        CTGATCTTGTGTTCCTATACTCGCATTGCTGCTGCCATCCTCAAGATCCCATCAGCTAAA
Bos_taurus|29448         CTGATCCTATGTTCCTACACTTGCATTGCTGCTGCCATCCTGAATATTCCATCGGCAAAG
Bos_taurus|6014          CTGATCCTATGTTCCTACACTTGCATTGCTGCTGCCATCCTGAATATTCCATCGGCAAAG
Tursiops_truncatus|16932 CTGATCCTATGTTCCTACACTTGCATCATTGCTGCCATCCTCAAGATTCCATCAGCTAAA
                         ****** *.** ***** *** **** . ************ ** ** *****.**:**.

Canis_familiaris|12298   GGGAAGCATAAAGCCTTCTCTACATGCTCCTCTCACCTCCTTGTTGTGTCCCTGTTCTAT
Pongo_abelii|5019        GGGAAGCATAAAGCCTTCTCTACGTGCTCCTCACACCTCCTTGTTGTCTCTCTTTTCTAT
Bos_taurus|29448         GGGAAGCGTAAAGCCTTCTCTACCTGCTCCTCTCACCTGCTCGTCGTCTCCCTTTTCTAT
Bos_taurus|6014          GGGAAGCGTAAAGCCTTCTCTACCTGCTCCTCTCACCTGCTCGTCGTCTCCCTTTTCTAT
Tursiops_truncatus|16932 GGGAAGCACAAAGCCTTCTCTACCTGCTCCTCCCACCTCCTTGTTGTCTCCCTTTTCTAT
                         *******. ************** ******** ***** ** ** ** ** ** ******

Canis_familiaris|12298   GTATCTTTAAGCCTCACCTACTTCCGGCCTAAATCCAATAATTCTCCTGAAAGCAAAAAG
Pongo_abelii|5019        GTATCTTCTAGCTTCACCTACTTCCGGCCTAAATCAAATAATTCTCCTGAGAGCAAGAAG
Bos_taurus|29448         GTATCTTTAAGCCTTGTCTACTTCCGTCCAAAGTCCAATAATTCTCCTGAAAGCAAGAAA
Bos_taurus|6014          GTATCTTTAAGCCTTGTCTACTTCCGTCCAAAGTCCAATAATTCTCCTGAAAGCAAGAAA
Tursiops_truncatus|16932 GTATCTTTAAGCCTCATCTATTTCCACCCTAAGTCCAATAATTCTCCTGAGAGCAAGAAG
                         ******* :*** * . *** ****. **:**.**.**************.*****.**.

Canis_familiaris|12298   CTGCTGTCATTGTCCTACACTGTTGTGACTCCCATGTTGAACCCCATCATTTATAGCCTG
Pongo_abelii|5019        TTGTTATCATTGTCCTACACTGTTGTGACTCCCATGTTGAACCCCATTATCTACAGCTTG
Bos_taurus|29448         GTGCTATCACTGTCCTACACTGTTGTGACTCCCATGTTGAATCCCATCATCTACAGCCTG
Bos_taurus|6014          GTGCTATCACTGTCCTACACTGTTGTGACTCCCATGTTGAATCCCATCATCTACAGCCTG
Tursiops_truncatus|16932 GTGCTATCACTGTCCTATACTGTTATGACTCCCATTTTGAACCCCATAATTTACAGCCTG
                          ** *.*** ******* ******.********** ***** ***** ** ** *** **

Canis_familiaris|12298   AGAAATAATGAAGTGAAGAATGCCTTTAGCCGGACCTTCCGTAAGGCTTTAGGCCTTAGA
Pongo_abelii|5019        AGAAATAGCGAGGTGAAGAATGCCCTCAGCAGGACCTTCCACAAGGTCCTGGCCCTCAGA
Bos_taurus|29448         AGAAATAATGAAGTGAAGAATGCCCTTACCCGGACCTTCCACAAGGCCCTGGGCCTTAGA
Bos_taurus|6014          AGAAATAATGAAGTGAAGAATGCCCTTACCCGGACCTTCCACAAGGCCCTGGGCCTTAGA
Tursiops_truncatus|16932 AGAAATAATGAGGTGAAGAATGCCCTTGTCCAGACCTTCTACAAGGCCCTAGGCCTTAGA
                         *******. **.************ * . *..******* . ****   *.* *** ***

Canis_familiaris|12298   AACTGCATCCCATAG
Pongo_abelii|5019        AACTGTATCCCA---
Bos_taurus|29448         AACTGCATCCTATAA
Bos_taurus|6014          AACTGCATCCTATAA
Tursiops_truncatus|16932 GACTGCATCCCATAG
                         .**** **** *   

multiple sequence alignment in CLUSTALW format


Canis_familiaris|10455   PQLGFISMAGGNWTRVEEFILMSFSSLPTEIQLLLFLTFLIIYLVTLMGNTLIILVTLAD
Pongo_abelii|21451       ---MPILMAIGNWTEISEFILMSFSSLPTEIQSLLFLTFLTIYLVTLMGNSLIILVTLAD
Bos_taurus|867           --FIPIFMAEGNWTRVNEFILMSFSSLPTEIQSLLFLTFLFIYLVTLLGNSLIILVTLAD
Bos_taurus|12426         --FIPIFMAEGNWTRVNEFILMSFSSLPTEIQSLLFLTFLFIYLVTLLGNSLIILVTLAD
Tursiops_truncatus|16034 ---IPITMAEGNWTRVSEFILMSFSSLPSEIQSLLFLIFLIIYLVTLLGNSLIILVALAD
                              * ** ****.:.***********:*** **** ** ******:**:*****:***

Canis_familiaris|10455   PMLHSPMYFFLRNLSFLEIGFNLVIVPKMLGTLLAWDTTISFLGCATQMYFFFFFGGAEC
Pongo_abelii|21451       PMLHNPMYFFLRNLSFLEIGFNLVIVPKMLGTLLAQDTTISFLGCATQMYFFFFFGVAEC
Bos_taurus|867           PMLHSPMYFFLRNLSFLEIGFNLAIVPKMLGTLIAQDTTISFLGCATQMYFFFFFGVSEC
Bos_taurus|12426         PMLHSPMYFFLRNLSFLEIGFNLAIVPKMLGTLIAQDTTISFLGCATQMYFFFFFGVSEC
Tursiops_truncatus|16034 PMLHSPMYFFLRNLSFIEIGFNLVIVPKMLGTLIAQDTTISFLGCATQMYFFFFFGVFEC
                         ****.***********:******.*********:* ********************  **

Canis_familiaris|10455   FLLATMAYDRYVAICSPLHYPVIMNQKTRAKLAVASWFPGFPVATVQTTWLFSFPFCGTN
Pongo_abelii|21451       FLLATMAYDRYVAICSPLHYPVIMNQRTRAKLAAASWFPGFPVATVQTTWLFSFPFCGTN
Bos_taurus|867           SLLATMAYDRYVAICSPLHYPVIMNPRTRAKLAAVSWFPGIPVATVQTTWLFSFPFCGSN
Bos_taurus|12426         SLLATMAYDRYVAICSPLHYPVIMNPRTRAKLAAVSWFPGIPVATVQTTWLFSFPFCGSN
Tursiops_truncatus|16034 FLLATMAYDRYVAICNPLHYPVIMNPKTWAKLAVASWFPGIPMATVQTTWLFSFPFCGT-
                          **************.********* :* ****..*****:*:***************: 

Canis_familiaris|10455   KVNHFFCDSPPVLRLVCADTALFEIYAIVGTILVVMTPCLLILCSYTRIAAAILKIPSAK
Pongo_abelii|21451       KVNHFFCDSPPVLRLICADTALFEIYAIVGTILVVMIPCLLILCSYTRIAAAILKIPSAK
Bos_taurus|867           NVNHFFCDSPPVLRLVCADTALFEIYAIIGTILFVMIPCLLILCSYTCIAAAILNIPSAK
Bos_taurus|12426         NVNHFFCDSPPVLRLVCADTALFEIYAIIGTILFVMIPCLLILCSYTCIAAAILNIPSAK
Tursiops_truncatus|16034 KVNHFFCDSPPVLRLVCADTALFEIYAIVGTILVVMIPCLLILCSYTCIIAAILKIPSAK
                         :**************:************:****.** ********** * ****:*****

Canis_familiaris|10455   GKHKAFSTCSSHLLVVSLFYVSLSLTYFRPKSNNSPESKKLLSLSYTVVTPMLNPIIYSL
Pongo_abelii|21451       GKHKAFSTCSSHLLVVSLFYVSSSFTYFRPKSNNSPESKKLLSLSYTVVTPMLNPIIYSL
Bos_taurus|867           GKRKAFSTCSSHLLVVSLFYVSLSLVYFRPKSNNSPESKKVLSLSYTVVTPMLNPIIYSL
Bos_taurus|12426         GKRKAFSTCSSHLLVVSLFYVSLSLVYFRPKSNNSPESKKVLSLSYTVVTPMLNPIIYSL
Tursiops_truncatus|16034 GKHKAFSTCSSHLLVVSLFYVSLSLIYFHPKSNNSPESKKVLSLSYTVMTPILNPIIYSL
                         **:******************* *: **:***********:*******:**:********

Canis_familiaris|10455   RNNEVKNAFSRTFRKALGLRNCIP
Pongo_abelii|21451       RNSEVKNALSRTFHKVLALRNCIP
Bos_taurus|867           RNNEVKNALTRTFHKALGLRNCIL
Bos_taurus|12426         RNNEVKNALTRTFHKALGLRNCIL
Tursiops_truncatus|16034 RNNEVKNALVQTFYKALGLRDCIP
                         **.*****: :** *.*.**:**