Orthologs Set ID: EOG4006CX


Orthology Database
OrthoDB4
Gene Symbol(s)
LRRC23

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Anolis carolinensis 6601 216, 335, 607, 738, 881
Apis mellifera 27901 54, 222, 528
Apis mellifera 28392 961
Bombyx mori 12726 302, 924, 1280
Bos taurus 21080 216, 335, 607, 738, 881
Branchiostoma floridae 25776 528, 738
Branchiostoma floridae 38368 219, 335, 607, 738, 881, 961, 1347
Callithrix jacchus 23988 219, 335, 607, 738, 881, 1356
Canis familiaris 16139 88, 219, 335, 607, 738, 881
Cavia porcellus 2245 219, 335, 607, 738, 881
Choloepus hoffmanni 2895 219, 335, 607, 738, 881
Danio rerio 18816 222, 335, 607, 738, 881, 1341
Dasypus novemcinctus 15139 219, 335, 607, 738, 881
Dipodomys ordii 4254 335, 607, 738, 881
Echinops telfairi 7775 72, 75, 219, 243, 335, 515, 607, 738, 881, 1380, 1386
Equus caballus 22814 219, 335, 607, 738, 881
Erinaceus europaeus 8425 55, 76, 219, 335, 351, 376, 607, 738, 881, 915, 1260, 1311, 1380
Gallus gallus 1428 335, 607, 738, 881, 1278, 1302
Gasterosteus aculeatus 19193 222, 335, 465, 607, 738, 881
Gorilla gorilla 13817 219, 335, 607, 738, 881
Homo sapiens 20388 219, 335, 607
Loxodonta africana 6625 219, 335, 607, 738, 881
Macropus eugenii 201 219, 335, 607, 738
Microcebus murinus 1893 219, 335, 607, 738, 881, 1387
Monodelphis domestica 30721 335, 607, 738, 881
Mus musculus 36626 219, 335, 607, 738, 881
Myotis lucifugus 13983 219, 335, 607, 738
Nematostella vectensis 15350 219, 335, 390, 513, 607, 738, 881, 961, 1296, 1341
Ochotona princeps 14676 219, 335, 607, 738, 881
Ornithorhynchus anatinus 2233 607, 738, 881, 1341, 1344
Oryctolagus cuniculus 18422 219, 335, 607, 738, 881
Otolemur garnettii 11355 219, 240, 335, 506, 579, 607, 738, 881
Pan troglodytes 8455 219, 335, 607, 738, 881
Pediculus humanus 1874 400, 663
Pogonomyrmex barbatus 4965 528, 703, 1287
Pongo abelii 5936 219, 335, 607, 738, 881
Procavia capensis 12919 219, 335, 607, 738, 881
Pteropus vampyrus 9290 219, 335, 607, 738
Rattus norvegicus 26096 219, 335, 607, 738, 881
Rhesus macaque 6876 219, 335, 607
Sorex araneus 14189 219, 335, 607, 615, 642, 654, 656, 726, 738, 881, 1380, 1383
Spermophilus tridecemlineatus 4123 219, 335, 607, 738, 881
Sus scrofa 14893 219, 335, 607, 738, 881
Taeniopygia guttata 819 607, 738, 881, 1344
Tribolium castaneum 13568
Tupaia belangeri 15677 738, 881
Tursiops truncatus 8452 219, 335, 607, 738, 807, 873, 881
Vicugna pacos 3688 219, 228, 335, 607, 738, 750, 1374, 1383, 1386
Xenopus tropicalis 24367 219, 335, 607, 738, 881, 1347

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 6601 ENSACAT00000005610 100565992 ENSACAG00000005595 LRRC23 anoCar1
Apis mellifera 27901 GB13252-PA apiMel3
Apis mellifera 28392 GB13377-PA apiMel3
Bombyx mori 12726 BGIBMGA002782-TA v2.0
Bos taurus 21080 ENSBTAT00000014977 613700 ENSBTAG00000011273 LRRC23 bosTau4
Branchiostoma floridae 25776 fgenesh2_pg.scaffold_115000101 braFlo1
Branchiostoma floridae 38368 estExt_fgenesh2_pg.C_3670028 braFlo1
Callithrix jacchus 23988 ENSCJAT00000014394 100386078 ENSCJAG00000007339 LRRC23 calJac3
Canis familiaris 16139 ENSCAFT00000023084 100856723 ENSCAFG00000014538 LRRC23 canFam2
Cavia porcellus 2245 ENSCPOT00000012466 100733934 ENSCPOG00000012349 LRRC23 cavPor3
Choloepus hoffmanni 2895 ENSCHOT00000002895 ENSCHOG00000002884 LRRC23 choHof1
Danio rerio 18816 ENSDART00000004871, NM_001006054 450033 ENSDARG00000006174 lrrc23 danRer6
Dasypus novemcinctus 15139 ENSDNOT00000002219 101441786 ENSDNOG00000002219 LRRC23 dasNov2
Dipodomys ordii 4254 ENSDORT00000008955 ENSDORG00000008956 Lrrc23 dipOrd1
Echinops telfairi 7775 ENSETET00000007578 ENSETEG00000007579 LRRC23 TENREC
Equus caballus 22814 ENSECAT00000000420 100052720 ENSECAG00000000386 LRRC23 equCab2
Erinaceus europaeus 8425 ENSEEUT00000007600 ENSEEUG00000007590 LRRC23 eriEur1
Gallus gallus 1428 ENSGALT00000023443 418291 ENSGALG00000014527 LRRC23 galGal3
Gasterosteus aculeatus 19193 ENSGACT00000013179 ENSGACG00000009961 lrrc23 gasAcu1
Gorilla gorilla 13817 ENSGGOT00000002538 101136930 ENSGGOG00000002523 LRRC23 gorGor3
Homo sapiens 20388 ENST00000433346 10233 ENSG00000010626 LRRC23 hg19,GRCh37
Loxodonta africana 6625 ENSLAFT00000005818 100675571 ENSLAFG00000005818 LRRC23 loxAfr3
Macropus eugenii 201 ENSMEUT00000000198 ENSMEUG00000000200 LRRC23 Meug_1.0
Microcebus murinus 1893 ENSMICT00000001769 ENSMICG00000001768 LRRC23 micMur1
Monodelphis domestica 30721 ENSMODT00000023030 100016399 ENSMODG00000018153 LRRC23 monDom5
Mus musculus 36626 ENSMUST00000112475 16977 ENSMUSG00000030125 Lrrc23 mm9
Myotis lucifugus 13983 ENSMLUT00000013801 102429959 ENSMLUG00000013800 LRRC23 myoLuc1
Nematostella vectensis 15350 estExt_fgenesh1_pg.C_10080 Nemve1
Ochotona princeps 14676 ENSOPRT00000003919 ENSOPRG00000003927 LRRC23 OchPri2.0
Ornithorhynchus anatinus 2233 ENSOANT00000005330 ENSOANG00000003356 LRRC23 ornAna1
Oryctolagus cuniculus 18422 ENSOCUT00000029298 100348397 ENSOCUG00000026502 LRRC23 oryCun2.0
Otolemur garnettii 11355 ENSOGAT00000010911 100949484 ENSOGAG00000010909 LRRC23 otoGar1
Pan troglodytes 8455 ENSPTRT00000008502 451802 ENSPTRG00000004597 LRRC23 panTro2
Pediculus humanus 1874 PHUM127970-RA 8233937 PHUM127970 PhumU1
Pogonomyrmex barbatus 4965 PB23322-RA 1.2
Pongo abelii 5936 ENSPPYT00000004986 100454223 ENSPPYG00000004209 LRRC23 ponAbe2
Procavia capensis 12919 ENSPCAT00000011830 ENSPCAG00000011878 LRRC23 proCap1
Pteropus vampyrus 9290 ENSPVAT00000009465 ENSPVAG00000009466 LRRC23 pteVam1
Rattus norvegicus 26096 ENSRNOT00000051613, NM_001013165 312707 ENSRNOG00000026309 Lrrc23 rn4
Rhesus macaque 6876 ENSMMUT00000047287 714269 ENSMMUG00000001781 rheMac2
Sorex araneus 14189 ENSSART00000013974 ENSSARG00000013964 LRRC23 sorAra1
Spermophilus tridecemlineatus 4123 ENSSTOT00000004123 101978633 ENSSTOG00000004121 Lrrc23 speTri1
Sus scrofa 14893 ENSSSCT00000000740 100155745 ENSSSCG00000000679 LRRC23 susScr2
Taeniopygia guttata 819 ENSTGUT00000019270 ENSTGUG00000018128 LRRC23 taeGut1
Tribolium castaneum 13568 GLEAN_16127 Tcas3.0
Tupaia belangeri 15677 ENSTBET00000015678 ENSTBEG00000015692 LRRC23 tupBel1
Tursiops truncatus 8452 ENSTTRT00000004758 101321963 ENSTTRG00000004761 LRRC23 turTru1
Vicugna pacos 3688 ENSVPAT00000001363 ENSVPAG00000001362 vicPac1
Xenopus tropicalis 24367 ENSXETT00000051602 549279 ENSXETG00000023923 lrrc23 xenTro2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 5415 ENSACAP00000005490 100565992 ENSACAG00000005595 LRRC23 anoCar1
Apis mellifera 3250 GB13252 apiMel3
Apis mellifera 3375 GB13377 apiMel3
Bombyx mori 2782 BGIBMGA002782-PA v2.0
Bos taurus 12241 ENSBTAP00000014977 613700 ENSBTAG00000011273 LRRC23 bosTau4
Branchiostoma floridae 9256 estExt_fgenesh2_pg.C_3670028 braFlo1
Branchiostoma floridae 22845 fgenesh2_pg.scaffold_115000101 braFlo1
Callithrix jacchus 16211 ENSCJAP00000013665 100386078 ENSCJAG00000007339 LRRC23 calJac3
Canis familiaris 4971 ENSCAFP00000021434 100856723 ENSCAFG00000014538 LRRC23 canFam2
Cavia porcellus 1747 ENSCPOP00000011111 100733934 ENSCPOG00000012349 LRRC23 cavPor3
Choloepus hoffmanni 2556 ENSCHOP00000002555 ENSCHOG00000002884 LRRC23 choHof1
Danio rerio 6052 ENSDARP00000004624 450033 ENSDARG00000006174 lrrc23 danRer6
Dasypus novemcinctus 13381 ENSDNOP00000001726 101441786 ENSDNOG00000002219 LRRC23 dasNov2
Dipodomys ordii 3984 ENSDORP00000008408 ENSDORG00000008956 Lrrc23 dipOrd1
Echinops telfairi 6149 ENSETEP00000006158 ENSETEG00000007579 LRRC23 TENREC
Equus caballus 346 ENSECAP00000000326 100052720 ENSECAG00000000386 LRRC23 equCab2
Erinaceus europaeus 6919 ENSEEUP00000006925 ENSEEUG00000007590 LRRC23 eriEur1
Gallus gallus 16851 ENSGALP00000023397 418291 ENSGALG00000014527 LRRC23 galGal3
Gasterosteus aculeatus 12657 ENSGACP00000013154 ENSGACG00000009961 lrrc23 gasAcu1
Gorilla gorilla 11281 ENSGGOP00000002485 101136930 ENSGGOG00000002523 LRRC23 gorGor3
Homo sapiens 59396 ENSP00000402554 10233 ENSG00000010626 LRRC23 hg19,GRCh37
Loxodonta africana 16680 ENSLAFP00000004875 100675571 ENSLAFG00000005818 LRRC23 loxAfr3
Macropus eugenii 183 ENSMEUP00000000180 ENSMEUG00000000200 LRRC23 Meug_1.0
Microcebus murinus 1609 ENSMICP00000001611 ENSMICG00000001768 LRRC23 micMur1
Monodelphis domestica 7956 ENSMODP00000022632 100016399 ENSMODG00000018153 LRRC23 monDom5
Mus musculus 41172 ENSMUSP00000108094 16977 ENSMUSG00000030125 Lrrc23 mm9
Myotis lucifugus 12558 ENSMLUP00000012558 102429959 ENSMLUG00000013800 LRRC23 myoLuc1
Nematostella vectensis 23957 estExt_fgenesh1_pg.C_10080 Nemve1
Ochotona princeps 12797 ENSOPRP00000003606 ENSOPRG00000003927 LRRC23 OchPri2.0
Ornithorhynchus anatinus 5399 ENSOANP00000005329 ENSOANG00000003356 LRRC23 ornAna1
Oryctolagus cuniculus 4256 ENSOCUP00000017454 100348397 ENSOCUG00000026502 LRRC23 oryCun2.0
Otolemur garnettii 9765 ENSOGAP00000009764 100949484 ENSOGAG00000010909 LRRC23 otoGar1
Pan troglodytes 9509 ENSPTRP00000007855 451802 ENSPTRG00000004597 LRRC23 panTro2
Pediculus humanus 1825 PHUM127970-PA 8233937 PHUM127970 PhumU1
Pogonomyrmex barbatus 13322 PB23322-PA 1.2
Pongo abelii 21089 ENSPPYP00000004796 100454223 ENSPPYG00000004209 LRRC23 ponAbe2
Procavia capensis 12089 ENSPCAP00000011050 ENSPCAG00000011878 LRRC23 proCap1
Pteropus vampyrus 8756 ENSPVAP00000008919 ENSPVAG00000009466 LRRC23 pteVam1
Rattus norvegicus 8204 ENSRNOP00000051124 312707 ENSRNOG00000026309 Lrrc23 rn4
Rhesus macaque 3691 ENSMMUP00000040315 714269 ENSMMUG00000001781 rheMac2
Sorex araneus 12623 ENSSARP00000012631 ENSSARG00000013964 LRRC23 sorAra1
Spermophilus tridecemlineatus 3700 ENSSTOP00000003700 101978633 ENSSTOG00000004121 Lrrc23 speTri1
Sus scrofa 724 ENSSSCP00000000724 100155745 ENSSSCG00000000679 LRRC23 susScr2
Taeniopygia guttata 17784 ENSTGUP00000018141 ENSTGUG00000018128 LRRC23 taeGut1
Tribolium castaneum 15720 GLEAN_16127 Tcas3.0
Tupaia belangeri 13626 ENSTBEP00000013609 ENSTBEG00000015692 LRRC23 tupBel1
Tursiops truncatus 7978 ENSTTRP00000004484 101321963 ENSTTRG00000004761 LRRC23 turTru1
Vicugna pacos 3441 ENSVPAP00000001259 ENSVPAG00000001362 vicPac1
Xenopus tropicalis 3131 ENSXETP00000051602 549279 ENSXETG00000023923 lrrc23 xenTro2

multiple sequence alignment in CLUSTALW format


Bombyx_mori|12726                  ---------------------ATGTTAAAATCTCATTTTGATATACACAAGGAT------
Pediculus_humanus|1874             ATGACGAGACTCTTACTCGAAAAAGTCGTGCCCTACGAACAC------------------
Danio_rerio|18816                  ------------------------ATGTCA------------------------------
Gasterosteus_aculeatus|19193       ------------------------ATGTCTGAGATGGATGAG------------------
Branchiostoma_floridae|25776       ------------------------------------------------------------
Apis_mellifera|28392               ------------------------------------------------------------
Branchiostoma_floridae|38368       ------------------------ATGTCGGACGCGTCTGATTTTGAAGGGGACGAG---
Nematostella_vectensis|15350       ------------------------ATGTCAGACTTTGAAGACGAA---------------
Xenopus_tropicalis|24367           ATGGAGGATGAAACGCTGGAGGATGGGCCGGAGGAGGAGGAGGAAGATGAGGAGGAAGGA
Taeniopygia_guttata|819            ------------------------------------------------------------
Gallus_gallus|1428                 ------------------------------------------------------------
Spermophilus_tridecemlineatus|4123 ------------------------ATGTCAGATGAGGATGATCTG---GATGACTTTGAG
Vicugna_pacos|3688                 ------------------------ATGTCAGATGAA---GATCTG---GAAGACTTT---
Anolis_carolinensis|6601           ---------------------------GAAGATGATAATGATATTGAAGAAGAGGAA---
Dasypus_novemcinctus|15139         ------------------------ATGTCAGATGAAGATGATCTG---GAAGAATAN---
Ornithorhynchus_anatinus|2233      ------------------------------------------------------------
Echinops_telfairi|7775             ------------------------ATGTCAGATGAAGAGGATGTG---GAGTACTTT---
Macropus_eugenii|201               ------------------------ATGTCTGATGAGGAGGACTTG---GAGGAATAT---
Monodelphis_domestica|30721        ------------------------------------------------------------
Dipodomys_ordii|4254               ------------------------------------------------------------
Otolemur_garnettii|11355           ------------------------ATGTCAGATGACGATGATCTG---GATGACTTT---
Pteropus_vampyrus|9290             ------------------------ATGTCAGATGAAGATGATCTG---GAAGATTTT---
Ochotona_princeps|14676            ------------------------ATGTCAGACGAAGATGATCTG---GAAGACTTT---
Choloepus_hoffmanni|2895           ---------------------------TCAGATGAAGACGATCTG---GAAGACTTT---
Tupaia_belangeri|15677             ------------------------------------------------------------
Erinaceus_europaeus|8425           ---------------------------ACAGATGAAGAGGATCTG---GAAGACTCT---
Sorex_araneus|14189                ------------------------------------------------------------
Cavia_porcellus|2245               ------------------------ATGTCCGACGAAGATGATCAG---GATGACACG---
Mus_musculus|36626                 ------------------------ATGTCGGATGAAGATGATGTG---GATGACGTT---
Rattus_norvegicus|26096            ------------------------ATGTCGGATGAAGATGATGTGGAAGATGACTTT---
Canis_familiaris|16139             ------------------------ATGTCAGATGAA---GACCTG---GAAGATTTC---
Myotis_lucifugus|13983             ------------------------ATGTCAGATGAAGACGATCTG---GAAGATTTT---
Rhesus_macaque|6876                ------------------------ATGTCAGATGAAGATGATCTA---GAAGACTTT---
Callithrix_jacchus|23988           ------------------------ATGTCAGATGAAGATGATCTA---GAAGACTTT---
Homo_sapiens|20388                 ------------------------ATGTCAGATGAAGATGATCTA---GAAGACTCT---
Pongo_abelii|5936                  ------------------------ATGTCAGATGAAGATGATCTA---GCAGACTCT---
Gorilla_gorilla|13817              ------------------------ATGTCAGATGAAGATGATCTA---GAAGACTCT---
Pan_troglodytes|8455               ------------------------ATGTCAGATGAAGATGATCTA---GAAGACTCT---
Tursiops_truncatus|8452            ------------------------ATGTCAGATGAAGATGATCTG---GAAGACTTT---
Oryctolagus_cuniculus|18422        ------------------------ATGTCGGACGAAGAGGATCTG---GAAGACTTT---
Microcebus_murinus|1893            ------------------------ATGTCAGATGAAGATGATCTG---GATGACTTT---
Sus_scrofa|14893                   ------------------------ATGTCAGATGAAGAGGATCTG---GAAGACTTT---
Bos_taurus|21080                   ------------------------ATGTCAGATGAAGATGACCTG---GAAGACTTT---
Equus_caballus|22814               ------------------------ATGTCAGATGAAGATGATCTG---GAAGACTTT---
Loxodonta_africana|6625            ------------------------ATGTCAGATGAAGATGATCTG---GAAGACTTT---
Procavia_capensis|12919            ------------------------ATGTCAGATGAAGATGATCTG---GAGGACTTT---
Tribolium_castaneum|13568          ------------------------ATGGGC------------------GAAGATTTCGGT
Apis_mellifera|27901               ------ATGTCTTCGATGTGGAGGCCTGAAGATTACGAGCGACATCGTTCAAACGTGAGG
Pogonomyrmex_barbatus|4965         ------------------------ATGGAGGAA---------------------------
                                                                                               

Bombyx_mori|12726                  ---------GACGATGTAGAGGAGGAGTTCGAGCATGAA------------------GCT
Pediculus_humanus|1874             ---------AAATCCCTGACTTTGAAAAAAGCCGGAGAA------------------TGT
Danio_rerio|18816                  ---------GACTCTGGTGAAGATGAGGTATTGAAAGCA------------------GAC
Gasterosteus_aculeatus|19193       ---------GATGCAGTGTTGTCGGACGTGGAGGGAGAA---------------------
Branchiostoma_floridae|25776       ------------------------------------------------------------
Apis_mellifera|28392               ------------------------------------------------------------
Branchiostoma_floridae|38368       ---------GGGGGAGAGGAGCCTCCAATGGAGTCTGGGGAA---------------GAA
Nematostella_vectensis|15350       ---------GAAGGCGTCGATGAGCCAGTTATG------------------------GAC
Xenopus_tropicalis|24367           ACCGCCGAAGAGACCAACCAGGATGTGACCGAAAGGGAC------------------GAG
Taeniopygia_guttata|819            ------------------------------------------------------------
Gallus_gallus|1428                 ------------------------------------------------------------
Spermophilus_tridecemlineatus|4123 CCAGAGTCAGAGCCAGACCAGGAAGATCTGGAAAAAGAA------------------GAA
Vicugna_pacos|3688                 ---------GAGCCAGACCTGGATGATCTGGAAAGGGAA------------------GAC
Anolis_carolinensis|6601           ---------GAAGACACTGAAGATAAAGCGGAAAAGGAA------------------GAG
Dasypus_novemcinctus|15139         ---------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------------NNN
Ornithorhynchus_anatinus|2233      ------------------------------------------------------------
Echinops_telfairi|7775             ---------GAGGCA---CTGGATGACCCGGAAAGATAT------------------GAC
Macropus_eugenii|201               ---------GATCCAGACCAGGATGAACCAGAGGAGGAA------------------GGG
Monodelphis_domestica|30721        ------------------------------------------------------------
Dipodomys_ordii|4254               ------------------------------------------------------------
Otolemur_garnettii|11355           ---------GAGCCAGACCAGGATGATTCTGAAAAAGAT------------------GAT
Pteropus_vampyrus|9290             ---------GAGCCAGACCAGGATGATCTGGAAAAGGAA------------------GAT
Ochotona_princeps|14676            ---------GAGCCAGATCAGGAGGACTTCGAAAAAGAT------------------GAT
Choloepus_hoffmanni|2895           ---------GAGCCAGACCAGGATGATCTTGAAAAAGAG------------------GAT
Tupaia_belangeri|15677             ------------------------------------------------------------
Erinaceus_europaeus|8425           ---------GGACCAGACCAGGATGACCTTGACAAAGAA------------------GAT
Sorex_araneus|14189                ------------------------------------------------------------
Cavia_porcellus|2245               ---------GAACCAGAGCAGGATGATCTGGAAAAA---------------------GAA
Mus_musculus|36626                 ---------GATGCAGAACAGGATGAAGTG---------------------------GAA
Rattus_norvegicus|26096            ---------GATCAGGAGCCGGATGAAGTGGAAAAAGAA------------------GAG
Canis_familiaris|16139             ---------GAGCCAGATCAGGATGATCTACTCAGAGGA------------------AGT
Myotis_lucifugus|13983             ---------GAGCCAGACCAGGATGATCTGGAAAGGGAG------------------GAC
Rhesus_macaque|6876                ---------GAGCCAGACCAGGATGATTTTgagaaagaa------------------gag
Callithrix_jacchus|23988           ---------GAGCTGGACCAGGACGATTTTGAGAAAGAA------------------GAA
Homo_sapiens|20388                 ---------GAGCCAGACCAGGATGATTCTgagaaagaa------------------gag
Pongo_abelii|5936                  ---------GAGCCAGACCAGGATGATTCTgagaaagaa------------------gag
Gorilla_gorilla|13817              ---------GAGCCAGACCAGGATGATTCTGAGAAAGAA------------------GAG
Pan_troglodytes|8455               ---------GAGCCAGACCAGGATGATTCTgagaaagaa------------------gag
Tursiops_truncatus|8452            ---------GAGTCAAACCTGGATGGTCTGGAAAGGGAA------------------GAC
Oryctolagus_cuniculus|18422        ---------GAGCCAGATCAGGACGACCTTGACAAAGAG------------------GAC
Microcebus_murinus|1893            ---------GACCCAGATCAGGATGATCTTGAAAGAGAA------------------GAT
Sus_scrofa|14893                   ---------GAGCCAGACCTGGACGATCTGGAAAGGGAA------------------GAT
Bos_taurus|21080                   ---------GAAACAGACCAGGATGATCTGGAAAGGGAA------------------GAT
Equus_caballus|22814               ---------GAACCAGACCCGGATGATCTggaaaaggaa------------------gat
Loxodonta_africana|6625            ---------GAGCCAGACCAGGATGATCTTgaaaaagac------------------gag
Procavia_capensis|12919            ---------GAACTATACCAGGATGACCTTGAAAAA---------------------GAA
Tribolium_castaneum|13568          GAAGGTGGACCTCCAGTTCCTGGCGAAGGCGTCCGTCAA---------------------
Apis_mellifera|27901               AAAGCGACTCGCGCGATCGACGTGGACCCGCCGAAAAGCAGGCCTCACGTGGTTCTCAAC
Pogonomyrmex_barbatus|4965         ---------GAAAGTTATGAGCAGAAAACTGAAGAAAAA------------------CTT
                                                                                               

Bombyx_mori|12726                  GTTTCTCATGCCCACGAGGAGGAGGAAGAACATGCTCTTCCTGAA---------------
Pediculus_humanus|1874             TTGGGAATATTGGGAAAAATATGGAATTTATCGGAACATTCGTCTGCGGCGGCGGCGACG
Danio_rerio|18816                  TCTGATCATGAGGGAGAGAATGAGGATCTGGAAGAGAAAGAGAAATCAGAT---------
Gasterosteus_aculeatus|19193       ------------------GAAGAAGAAGCAGCACATCAACAAGAAGCCGAAGAG------
Branchiostoma_floridae|25776       ------------------------------------------------------------
Apis_mellifera|28392               ------------------------------------------------------------
Branchiostoma_floridae|38368       GGAGACGCTCCTCAAGATGAAGACGAAGACGTGGAGAAGGAAGAAGGCGAGGATGAGGGG
Nematostella_vectensis|15350       GACGAAAACGAGGAGGAAGATCAGGAC---------------------------------
Xenopus_tropicalis|24367           GAAGAGGAGGCTGAAAAGGATGAGGAAGAAGATAAAGAGGAGGAAGAGGAAGCTGAAAAA
Taeniopygia_guttata|819            ------------------------------------------------------------
Gallus_gallus|1428                 ---------------------------------------------------TCTCTCCCC
Spermophilus_tridecemlineatus|4123 GATGAGAAGGAGACAGAGGAGTGGGAG---GACTACAAGAAGGAGGGGGAAGAGTTCTCC
Vicugna_pacos|3688                 GATGAGAAGGAGACAGAGGAGTGGGAG---GACTACAAGAAGGAGGGAGAAGACTTCTTG
Anolis_carolinensis|6601           GGAGGGGAAGATGAGAAGGAG---------GCTGGGGAGGAGGAAGAAGAAGAGGAGGAA
Dasypus_novemcinctus|15139         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|2233      ------------------------------------------------------------
Echinops_telfairi|7775             TATGAGAAGGAGACCGAGGAGGGAGAG---GACTACAGGAAAGACGGGGAAGACTTGTCG
Macropus_eugenii|201               GAGGATAAAGATGAAGAAGAAGAGGAA---------GAGAAGGAGGGAGGAGAAGAAGTT
Monodelphis_domestica|30721        ------------------------------------------------------------
Dipodomys_ordii|4254               ------------------------------------------------------------
Otolemur_garnettii|11355           GATGAAAAGGAGACAGAGGAGTGGGAAGATGAC------AGGAAAGGAGAAGAATACTCT
Pteropus_vampyrus|9290             GATGAGAAGGAGACGGAAGAGGGGGAG---GATGACAGGAAAGAGATGGAAGACTTCTCT
Ochotona_princeps|14676            GATGAGAAGGAGACAGAGGAATGGGAG---GACTACAGGAAAGAGGGGGAAGAACTCTCC
Choloepus_hoffmanni|2895           GATGAGAAGGAGACAGAGGAGGGGGAG---GAGGACAGGAAAGAGAGGGAAGAGTTCTCT
Tupaia_belangeri|15677             ------------------------------------------------------------
Erinaceus_europaeus|8425           GATGATCAGGAGACAGAAGAGTGGGAT---GAGTTAGGGAAAGAG---GAAGAAGTCTCT
Sorex_araneus|14189                ------------------------------------------------------------
Cavia_porcellus|2245               GATGATAAGGATACAGAGGAGTGGGAG---GACTACAAGAAAGAGGGCGAAGATTTGTCT
Mus_musculus|36626                 AGTGACAAGGAGATAGAGGAATGGGAA---GACTACAGGAAAGAGACAGAAGAAGCCTCT
Rattus_norvegicus|26096            GATGACAATGAGATGGAGGACTGGGAAGACGACTACAGGAAGGAGGGGGAAGAAGTCTCT
Canis_familiaris|16139             GAGAGCATGAAATCCTGGAATTGGTGG---GGTCCTAAGGCTAAGGGATGGGGTTGGGCT
Myotis_lucifugus|13983             GATGAGAAGGATACAGAAGATTGGGAA---GATGACAGGAAAGAGGAGGAAGACTTATCA
Rhesus_macaque|6876                gacgagaaggagacagaggagggggag---gactacagaaaagagggggaagagTTCCCT
Callithrix_jacchus|23988           GATGAGAAGGAGACAGAGGAGGAGGAG---GACTACAGAAAAGAGGGGGAAGAATTCCCT
Homo_sapiens|20388                 gacgagaaggagacagaggagggggag---gactacagaaaagagggggaagagTTCCCT
Pongo_abelii|5936                  gacgagaaggagacagaggagggggag---gactacagaaaagagggggaagagTTCCCT
Gorilla_gorilla|13817              GACGAGAAGGAGACAGAGGAGGGGGAG---GACTACAGAAAAGAGGGGGAAGAGTTCCCT
Pan_troglodytes|8455               gacgagaaggagacagaggagggggag---gactacagaaaagagggggaagagTTCCCT
Tursiops_truncatus|8452            GACGAGAAGGAGACAGAGGAGTGGGAG---GACCACAGGAAAGAGGGAGAAGACTCT---
Oryctolagus_cuniculus|18422        GATGAGAAGGAGACGGAGGAATGGGAG---GACTACAGGAAAGAGGGGGAAGAATTCTCC
Microcebus_murinus|1893            GATGAGAAGGATACAGAGGATTGGGAG---GACTACAGGAAAGAGGGGGACGAATACTCT
Sus_scrofa|14893                   GACGAGAAGGAGATAGAAGAGTGGGAG---GACTACAGGAAGGAGGGAGAAGAAGAGTCC
Bos_taurus|21080                   GATGAGAAGGAGACAGAGGAGTGGGAG---GACTACAGGAAGGAGGGAGAGGAGTCCGAG
Equus_caballus|22814               gatgagaaggagacagaggagtgggag---gactacaggaaggagggggaagaACTCCCT
Loxodonta_africana|6625            gatgagaaggagacagaggagggagag---gactacaggaaagagggggaagaCTTCACT
Procavia_capensis|12919            GATGAGGAGGAGACAGAGGAGGGAGAG---GAATACAGGAGAGAGGAGGAAGAATTCACT
Tribolium_castaneum|13568          ---------------------------------TTCCGTCCCCCAACCGCCCCCTCAATC
Apis_mellifera|27901               GCGAAAGGAATGCAATTGGAACGCGAGAAGCAATATCGCATCATGAGGGAGAATTTCATC
Pogonomyrmex_barbatus|4965         GCCGAAAGAGTGATTTTTGATGAAGAGGATCAATTCAAATATGAATCAACGATTTCGTTG
                                                                                               

Bombyx_mori|12726                  ---------------------------------GTGATCAGTGGTCCAGTTAGGAAACTG
Pediculus_humanus|1874             ACG------------------------------ACGACGAACCCGAATGTATTCCCCCTT
Danio_rerio|18816                  ---------------------------------GGAGATCAGCTAGAGTCTTGTCCACTA
Gasterosteus_aculeatus|19193       ---------------------------------AACGAGAAGGTAGAGGTTTGTCATTTG
Branchiostoma_floridae|25776       ------------------------------------------------------------
Apis_mellifera|28392               ------------------------------------------------------------
Branchiostoma_floridae|38368       GAGGGGGTGCAAGTGGAGGACCAACAAGAAGAAGAAGAGAAACTTCCTGAGCACCCCTTG
Nematostella_vectensis|15350       ---------------------------------GATGAGAAACCTCCAGAAAACCCACTA
Xenopus_tropicalis|24367           ---------------------------------GAAGAGCCCCCGCCTCATATGCCGTTA
Taeniopygia_guttata|819            ------------------------------------------------------------
Gallus_gallus|1428                 ---------------------------------CAGGTGCTGGTCGCGTGT---CCCCTG
Spermophilus_tridecemlineatus|4123 ---------------------------------GAGGAATGGATGCCGGTC---CCCCTC
Vicugna_pacos|3688                 ---------------------------------GAGGAATGGATGCCCNNN---NNNNNN
Anolis_carolinensis|6601           ---------------------------------GAGCATCCAATTTCCACT---CCTCTC
Dasypus_novemcinctus|15139         ---------------------------------NNNNNNNNNNNNNNNNNN---NNNNNN
Ornithorhynchus_anatinus|2233      ------------------------------------------------------------
Echinops_telfairi|7775             ---------------------------------GAGGAATGGATACCCAAT---TCCCTC
Macropus_eugenii|201               ---------------------------------GAAGAGTTCCTCTCCAAT---CCCATC
Monodelphis_domestica|30721        ------------------------------------------CTCCCCAAT---CCCCTC
Dipodomys_ordii|4254               ------------------------------------------------------------
Otolemur_garnettii|11355           ---------------------------------GAGGAATGGCTGCCCACC------CCC
Pteropus_vampyrus|9290             ---------------------------------GAGGAATGGATGCCCAAT---CCCCTG
Ochotona_princeps|14676            ---------------------------------GAGGACTGGGCTCCCACG---CCCCTC
Choloepus_hoffmanni|2895           ---------------------------------GAGGAATGGTTACCCAAC---CCCCTC
Tupaia_belangeri|15677             ------------------------------------------------------------
Erinaceus_europaeus|8425           ---------------------------------GAGGAATGGGTGCCAACG---CCCCTC
Sorex_araneus|14189                ---------------------------------GAGGAATGGGTGCCCACC---CCTCTC
Cavia_porcellus|2245               ---------------------------------GAGGAATGGCCGCCCACA---CCCCTG
Mus_musculus|36626                 ---------------------------------GAGGAATGGCTGCCCACC---CCCATC
Rattus_norvegicus|26096            ---------------------------------GAGGAATGGCTGCCCACC---CCCCTC
Canis_familiaris|16139             ---------------------------------GGAAGGTGGATGCCCACG---CCACTC
Myotis_lucifugus|13983             ---------------------------------GAGGAATGGATGCCGACC---CCCCTC
Rhesus_macaque|6876                ---------------------------------GAGGAATGGCTGCCCACG---CCCCTC
Callithrix_jacchus|23988           ---------------------------------GAGGAATGGCTGCCCAAC---CCCCTC
Homo_sapiens|20388                 ---------------------------------GAGGAATGGCTGCCCACC---CCCCTC
Pongo_abelii|5936                  ---------------------------------GAGGAATGGCTGCCCAAC---CCCCTC
Gorilla_gorilla|13817              ---------------------------------GAGGAATGGCTGCCCACC---CCCCTC
Pan_troglodytes|8455               ---------------------------------GAGGAATGGCTGCCCACC---CCCCTC
Tursiops_truncatus|8452            ---------------------------------GAGGAATGGATGTCCACG---CCCCTC
Oryctolagus_cuniculus|18422        ---------------------------------GAGGAATGGCTGCCCACC---CCGCTC
Microcebus_murinus|1893            ---------------------------------GAGGAATGGATGCCCACC---CCGCTT
Sus_scrofa|14893                   ---------------------------------GAGGAATGGGTATCCACT---CCCCTC
Bos_taurus|21080                   ---------------------------------GATCAGTGGATATCCACG---CCCCTC
Equus_caballus|22814               ---------------------------------GAGGAATGGATGCCCAGC---CCCCTC
Loxodonta_africana|6625            ---------------------------------GAGGATTGGATGCCCAAT---GCCCTC
Procavia_capensis|12919            ---------------------------------GAGGATTGGATGCCCAAT---GCCCTC
Tribolium_castaneum|13568          ---------------------------------CCCGAAGTAATCAAAGAGAAAATACTA
Apis_mellifera|27901               CTTCTGAAGAAATTGCGTGACATAATGAATCGAAAGAAGCCCGATGTGACGAAGGCGTTG
Pogonomyrmex_barbatus|4965         ---------------------------GACGAGACCGAGCAGAATAAATTACGTGTGTTA
                                                                                               

Bombyx_mori|12726                  AATAGATCTGAAGTCAGTGTTAGA---CTCGGGCTGCTTGGGAAAACTGCGGAAGCAGAT
Pediculus_humanus|1874             AACGAATTGTGCGATAAAGAATCGGAATGTAAACTCATGGACATGGAAGGCTACGTTGAC
Danio_rerio|18816                  ACCCAGGACATTTTAGCGAGAAGT---TTATCTTTGCTATGTCGCACAGGGAATGGTCTG
Gasterosteus_aculeatus|19193       ACCAAAGAAACCATAAGTCGGGGG---CTCTCCTTGCTGTGCCGAACAGGAAATGGACTA
Branchiostoma_floridae|25776       ---------------------------ATGAATATCATTGTCACTACT------------
Apis_mellifera|28392               ------------------------------------------------------------
Branchiostoma_floridae|38368       ACAGAAGAGATGTTAGGAGACTGT---CTATCCCTGCTGTGTAAGACTGGGAACGGCCTG
Nematostella_vectensis|15350       ACGGAAGAAATGTTAGCTGATAGC---TTGTCCCTGCTCTGCAAAACGGGAAATGGCCTG
Xenopus_tropicalis|24367           TCAGAGGAGATGCTGAGAGATGGA---CTCTCCCTGCTCTGTAAGACAGGGAATGGCTTA
Taeniopygia_guttata|819            ------------------------------------------------------------
Gallus_gallus|1428                 ACGGAGGAGATGCTGAAGGAGGGC---CTCTCCCTCCTCTGCAAAATTGGCAACGGCCTG
Spermophilus_tridecemlineatus|4123 ACTGAGAACATGANNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Vicugna_pacos|3688                 NNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Anolis_carolinensis|6601           ACGGAGGATATGATGAAAGAAGGC---CTCTCACTTTTATGTAAAACGGGCAATGGCCTG
Dasypus_novemcinctus|15139         NNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|2233      ------------------------------------------------------------
Echinops_telfairi|7775             TCG---GACTTGATGAAGGAGAGC---CTTTCTATGCTCTGTAAGACCGGTAACGGCCTG
Macropus_eugenii|201               ACAGAGGACACAATGAAGGAAGGT---CTCTCTTTGCTCTGCAAGACAGGCAATGGACTC
Monodelphis_domestica|30721        ACAGAGGAGGTAATGAAAGAAGGT---CTCTCTTTGCTCTGCAAGATTGGCAATGGACTC
Dipodomys_ordii|4254               ------------------------------------------------------------
Otolemur_garnettii|11355           ACGGAGGAAATGATGAAGGAAGGG---CTTTCTTTGCTTTGTAAGACGGGCAATGGACTG
Pteropus_vampyrus|9290             ACGGAGGACATGATGAAGGAAGGG---CTTTCTTTGCTCTGTAAGACAGGCAGTGGATTA
Ochotona_princeps|14676            ACGGAGTACGTGATGAAGGAAGGG---CTTTCCTTACTCTGTAAGACGGGCAGTGGCCTG
Choloepus_hoffmanni|2895           ACAGAGGACATGATGAAGGATGGG---CTTTCTTTGCTTTGTAAGACAAGCAGTGGACTG
Tupaia_belangeri|15677             ------------------------------------------------------------
Erinaceus_europaeus|8425           ACAGAGGACATGATGAAGGAAGGC---CTCTCCTTGCTCTGTAAGACAGGCACTGGGCTG
Sorex_araneus|14189                TCGGAGGACATGATGAAGGAAGGG---CTTTCTATGCTGTGTAAGACGGGCTCCGGGTTG
Cavia_porcellus|2245               ACAGAGGAGATGATGAAGGAAGGG---CTATCTATGCTTTGTAAGACGGGGAATGGACTG
Mus_musculus|36626                 ACGGAGGCCATGATGAAGGAAGGG---CTCTCATTACTCTGCAAGATTGGCAGTGGACTG
Rattus_norvegicus|26096            ACGGAGGCCATGATGAAGGAAGGG---CTTTCATTACTCTGCAAGATTGGCAGTGGACTG
Canis_familiaris|16139             ACAGAGGACATGTTGAAGGAAGGG---CTTTCTTTGCTCTGTAAGACAGGCAATGGACTG
Myotis_lucifugus|13983             ACCGAGGACATGATGAAGGAAGGG---CTTTCTTTGCTCTGTAAGACCGGCAATGGATTG
Rhesus_macaque|6876                ACGGAGGACATGATGAAGGAAGGG---CTTTCTCTGCTCTGTAAGACAGGCAGTGGGCTG
Callithrix_jacchus|23988           ACGGAGGACATGATGAAGGAAGGG---CTTTCTCTGCTCTGTAAGACTGGCAGTGGGCTG
Homo_sapiens|20388                 ACGGAGGACATGATGAAGGAAGGG---CTTTCTCTGCTCTGTAAGACAGGCAATGGGCTG
Pongo_abelii|5936                  ACGGAGGACATGATGAAGGAAGGG---CTTTCTCTGCTCTGTAAGACAGGCAATGGGCTG
Gorilla_gorilla|13817              ACGGAGGACATGATGAAGGAAGGG---CTTTCTCTGCTCTGTAAGACAGGCAATGGGCTG
Pan_troglodytes|8455               ACGGAGGACATGATGAAGGAAGGG---CTTTCTCTGCTCTGTAAGACAGGCAATGGGCTG
Tursiops_truncatus|8452            ACAGAGGACATGGTGAAGGAAGGG---CTTTCTGCGCTCTGCAAGACGGGTAATGGACTG
Oryctolagus_cuniculus|18422        ACGGAGGCCGTGGTGAAGGAAGGG---CTGTCTTTGCTCTGTAAGACTGGCAGCGGGCTA
Microcebus_murinus|1893            ACGGAGGACATGGCGAAGGAAGGG---CTTTCTTTGCTCTGTAAGACGGGCAATGGACTG
Sus_scrofa|14893                   ACGGAGGACATGATGAAGGAAGGG---CTTTCTTTGCTCTGCAAAACCGGTAATGGACTG
Bos_taurus|21080                   ACAGAGGACATGATGAAAGAAGGG---CTTTCTCTGCTCTGCAAGACGGGTAATGGACTG
Equus_caballus|22814               ACGGAGGACATGATGAAGGAAGGG---CTTTCTCTGCTCTGTAAGACAGGCAGTGGACTG
Loxodonta_africana|6625            ACAGAGGACTTGATGAAGGAAGGG---CTTTCTTTGCTCTGTAAGACTGGCAATGGACTG
Procavia_capensis|12919            ACGGAGGAATTGATGAAAGAAGGG---CTTTCTCTGCTTTGTAAGACTGGCAATGGACTG
Tribolium_castaneum|13568          ACATTCGAAGAAGCCTCCAAATGC---CTCAACACCCTCGGCAAAGATGAAACCGGAAGC
Apis_mellifera|27901               ACGCAAACGGAGGCCGGTGAGTGC---CTTCACACGTTGGGAAAATGCGAATCCGGGCTT
Pogonomyrmex_barbatus|4965         ACACACAACGAGGCCGGCGAGTGT---CTTCACACTTTGGGAAAATGCATCGCGTTGCAT
                                                                                               

Bombyx_mori|12726                  GGGTACACATATTTAAAAGCGACCTGCACGGACATGAATCTGACCGACATAACAGCCATT
Pediculus_humanus|1874             GACTATCAATATTTACACATGGAAGCCAAAGACATGTGTCTCACGGACGTGACCATTCTA
Danio_rerio|18816                  TCTCATGCCTATGTCAGACTTGATCTTAAAAATAAGGGTCTGACAGACCTAGCCTTGCTC
Gasterosteus_aculeatus|19193       GGGCACGCGTTTGTCAAAGTGAACCTAAAAGACAACGGACTGGACGACATTGCTGCGATC
Branchiostoma_floridae|25776       ------------------------ATATATTATAGGGATCTGACGGACATCAGTGTCCTG
Apis_mellifera|28392               ------------------------------------------------------------
Branchiostoma_floridae|38368       GCACACGCATATGTCAGACTGGACATACATGAAAGAGAAATCACTGACATCAGCATCCTG
Nematostella_vectensis|15350       GCACATGCGTATGTTCGTTTGGATATACATGACAAGGAGTTAACAGATATTAGTGTGCTA
Xenopus_tropicalis|24367           GCTCATGCCTACGTTAAACTGGAGGTCAAAGAGAGAGAGCTAACAGACATCTCAGTTCTG
Taeniopygia_guttata|819            ---------------------------------AGGGGCCTGACAGATATCAGCCTCCTC
Gallus_gallus|1428                 GCGCACGCTTACGTGAAGTTTGAAGCCAAGTATAAGGACTTGACAGACATCAGTCTCCTT
Spermophilus_tridecemlineatus|4123 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Vicugna_pacos|3688                 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Anolis_carolinensis|6601           GCTCATGCCTTTGTAAAATTAGAGGTCAGAGAAAAGGAACTGACAGATATCACCCTCATC
Dasypus_novemcinctus|15139         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGATCTGACAGATATCCACCTGCTG
Ornithorhynchus_anatinus|2233      ---------------------------------AGGGAGCTGACGGACATTACCCTGCTG
Echinops_telfairi|7775             GCTCATGCTTACGTCAAGCTGGAAGTCAAGGGCAGGGATCTGACAGACATCATCTTGCTG
Macropus_eugenii|201               TCCCATGCCTATGTGAAGCTGGAGGCCAAGGATAAGGAACTGACTGACATTTCTCTGCTG
Monodelphis_domestica|30721        TCCCATGCTTACGTGAAGTTGGAGGCCAAGGAAAAGGACCTCAGTGACATTTCTCTGTTG
Dipodomys_ordii|4254               ------------------------------GACAGGGACCTCACGGATATCAGCCTGCTG
Otolemur_garnettii|11355           GCTCATGCTTATGTGAAGCTGGAGGTTAAAGAGAGGGACCTGACAGACATCTCCCTGCTG
Pteropus_vampyrus|9290             GCCCATGCTTATGTGAAGCTGGAGGTTAAAGAGAGAGATCTGACAGACATCTACTTGCTG
Ochotona_princeps|14676            GCTCATGCTTACGTCAAGCTGGAGATTAAAGAGAGAGACCTAACAGACATCTCCTTGCTA
Choloepus_hoffmanni|2895           GCTCACGCCTATGTCAAGTTGGAGGTCAGAGAGAGGGATCTGACAGACATCTACTTGCTG
Tupaia_belangeri|15677             ------------------------------------------------------------
Erinaceus_europaeus|8425           GCACATGCTTACGTCAAGTTGGAGGTGAAAGACAGNGAGCTGACAGATATC---TTGCTT
Sorex_araneus|14189                GCGCACGCCTTTGTCAGGCTGGAGGTCAAAGACAGGGAACTCACAGACGTCTCCCTGCTG
Cavia_porcellus|2245               GCTCATGCATATGTTAAGCTGGATCTTAAAGACAGAGACTTGACAGACATCTCCTTGCTG
Mus_musculus|36626                 GCTCACGCTTATATTAAGCTGGAGGCTAAGGACAGGGACCTCACAGACATCTCCTTACTG
Rattus_norvegicus|26096            GCTCACGCTTATATTAAGCTGGAGGTTAAGGACAGGGACCTCACAGACATCTCCTTACTG
Canis_familiaris|16139             GCTCATGCTTATGTCAAGCTGGAGGTTAAAGAGAGGGACCTGACAGACATCTACTTGTTG
Myotis_lucifugus|13983             GCCCATGCTTATGTCAAGCTGGAGGTTAAAGAGAGAGAACTGACGGACATCCAGTTGCTG
Rhesus_macaque|6876                GCTCATGCTTATGTCAAGCTGGAGGTTAAAGAGAGGGACCTGACAGACATCTACTTGCTG
Callithrix_jacchus|23988           GCTCATGCTTATGTCAAGCTGGAGGTTAAAGAGAGGGACCTGACAGACATCTACTTGCTG
Homo_sapiens|20388                 GCTCATGCTTATGTCAAGCTGGAGGTTAAAGAGAGGGACCTGACAGACATCTACTTGCTG
Pongo_abelii|5936                  GCTCATGCTTATGTCAAGCTGGAGGTTAAAGAGAGGGACCTTACAGACATCTACTTGCTG
Gorilla_gorilla|13817              GCTCATGCTTATGTCAAGCTGGAGGTTAAAGAGAGGGACCTGACAGACATCTACTTGCTG
Pan_troglodytes|8455               GCTCATGCTTATGTCAAGCTGGAGGTTAAAGAGAGGGACCTGACAGACATCTACTTGCTG
Tursiops_truncatus|8452            GCCCATGCTTACGTCAAGCTGGTGGTTAAAGACAGGGATCTGACAGACATCCACTTGCTG
Oryctolagus_cuniculus|18422        GCTCATGCTTACGTCAAGCTGGAGGTTAAAGAGAGAGACCTAACAGACATCTCCTTGCTG
Microcebus_murinus|1893            GCTCACGCTTATGTGAAGCTGGAGGTTAAAGAGAGGGACCTGACAGACATCTCCTTGCTG
Sus_scrofa|14893                   GCCCATGCTTACGTCAAGCTGGAGGTTAAAGACAGGGATCTGACAGACATCTACTTGCTG
Bos_taurus|21080                   GCTCATGCTTACGTCAAGCTGGAGATTAAAGACAGGGATCTGACAGACATCCACCTGTTG
Equus_caballus|22814               GCTCATGCTTATGTCAAGCTGGAGCTTAAAGAGAGAGATCTGACAGACATCTACTTGCTG
Loxodonta_africana|6625            GCTCATGCTTATGTCAAGCTGGAGGTCAAAGACAGGGATCTGACAGACATCTCCTTGCTG
Procavia_capensis|12919            GCTCATGCTTATGTCAAGCTGGAGCTCAAAGAGAGGGATCTGACAGACATCTCCTTGCTG
Tribolium_castaneum|13568          CGCTACGCCTACTTGATGATAACAGCAACAAATCGCAAACTAACCGATGTCTCCATAATC
Apis_mellifera|27901               GGCTACGCTTATCTCGGCCTGAACGCGTCCAACAGGGGCCTGACGGACATAAAGATTATA
Pogonomyrmex_barbatus|4965         GAGTATGCTTATCTCAGCCTGGACGCCTCGGACAGAGATCTTACGGATATCAATGTGATA
                                                                                               

Bombyx_mori|12726                  ---AAATATTTTAAGCACCTACAATTTGTCGACGTATCCAACAACAAGTTGGACTTAGAA
Pediculus_humanus|1874             CCAAAATATTTCGTCTGGTTGCTTTCCGTCGATCTGTCGGGGAATTTATTAACGAACGAA
Danio_rerio|18816                  ---AGCTCCTACATCCATCTGCGTTATTTGGACCTGTCCTCCAATCATTTGTCAGAC---
Gasterosteus_aculeatus|19193       ---GCCAGTTTTACTCACCTACGTTTTCTGGATGTATCCAACAACCACCTTATTGAT---
Branchiostoma_floridae|25776       ---AAGGACCTGGTGCATGTCCGGTACCTGGACCTGTCCGGCAACCGTCTGACGGAC---
Apis_mellifera|28392               ------------------------------------------------------------
Branchiostoma_floridae|38368       ---AAATCCTTCATCCACCTGCGGTACGTGGACGTGTCCGCTAACCTCCTCCGCGAC---
Nematostella_vectensis|15350       ---AACTGTTTCATTCATCTGAGATATGTGGACATTAGTGGAAATTCTTTAAAGGAC---
Xenopus_tropicalis|24367           ---CAGTCCTTCATACACCTGCGCTATGTGGACTTGTCCCAGAATTCCCTGCAGGAC---
Taeniopygia_guttata|819            ---GAAGGCTTCATTCACTTGCGGTATGTGGATTTGTCAAAGAACAAGCTGAAAGAT---
Gallus_gallus|1428                 ---GAATGCTTCATTCACCTGCGGTATGTGGATTTGTCAGAGAACAAGCTGCAGGAT---
Spermophilus_tridecemlineatus|4123 ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---
Vicugna_pacos|3688                 ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---
Anolis_carolinensis|6601           ---CAAAATTTCATCCACTTACGTTACGTAGACCTGTCAGACAACCTGATCCGAGAC---
Dasypus_novemcinctus|15139         ---CGCACCTACATCCATCTGCGCTACGTGGATATTTCTGAGAACCACCTGACAGAC---
Ornithorhynchus_anatinus|2233      ---AGCTCCTACATCCACCTGCGCTACGTGGACGTGTCGGAGAATTTCCTGTCGGAC---
Echinops_telfairi|7775             ---CGCTCCTACATCCATCTGCGTTATGTGGATGTTTCTGAGAACCACCTGACAGAC---
Macropus_eugenii|201               ---TCCTCCTACATTCACCTGCGTTATGTGGATCTGTCTGGGAACCGGCTGACTGAC---
Monodelphis_domestica|30721        ---TCCTCCTACATCCACCTGCGTTATGTGGATTTGTCTGATAACCGGCTGGTGGAC---
Dipodomys_ordii|4254               ---CGGACCTACATCCACCTGCGCTACGTGGACATCTCCGAGAACCACATCAGCGAC---
Otolemur_garnettii|11355           ---CGCTCCTACATCCATCTGCGCTATGTGGATGTTTCTGAGAACCACTTGACAGAC---
Pteropus_vampyrus|9290             ---CGTTCCTACATCCATCTGCGCTATGTGGATGTTTCTGAGAACCACCTGACAGAC---
Ochotona_princeps|14676            ---CGATCCTACATTCATCTGCGCTACGTGGATATTTCTGACAATCACGTGACGGAC---
Choloepus_hoffmanni|2895           ---CGCTCCTACATCCACCTGCGCTATGTGGATATTTCTGAGAACCACCTGACAGAC---
Tupaia_belangeri|15677             ------------------------------------------------------------
Erinaceus_europaeus|8425           ---CGATCCTACATCCATCTGCGCTATGTGGACATCTCTGAGAACCACCTGACAGAC---
Sorex_araneus|14189                ---CAGTCCTACATCCACCTGCGCTACGTGGATGTCTCTGAGAACCACCTGGCGGAC---
Cavia_porcellus|2245               ---TGCTCCTACATCCATCTGCGATATGTGGATATCTCTGAGAACCACCTGACAGAC---
Mus_musculus|36626                 ---CGCTCCTATATCCATCTTCGCTATGTGGATATTTCTGAGAACCATATTACAGAC---
Rattus_norvegicus|26096            ---CGCTCCTACATCCACCTCCGCTACGTGGATATTTCTGAGAACCATATCACAGAC---
Canis_familiaris|16139             ---CGTTCCTACATCCATCTGCGCTATGTGGATGTTTCTGAGAACCACCTGACAGAC---
Myotis_lucifugus|13983             ---CGTTCCTACATCCATCTGCGTTACGTGGATATTTCTGAGAACCATCTGACGGAC---
Rhesus_macaque|6876                ---CGCTCCTACATCCATCTGCGCTATGTGGATGTTTCTGAGAATCACCTGACAGAC---
Callithrix_jacchus|23988           ---CGCTCCTACATCCATCTGCGCTATGTAGATGTCTCTGAGAACCACCTGACAGAC---
Homo_sapiens|20388                 ---CGCTCCTACATCCATCTGCGCTATGTGGATATTTCTGAGAACCACCTGACAGAC---
Pongo_abelii|5936                  ---CGCTCCTACATCCATCTGCGCTATGTGGATATTTCTGAGAACCACCTGACAGAC---
Gorilla_gorilla|13817              ---CGCTCCTACATCCATCTGCGCTATGTGGATATTTCTGAGAACCACCTGACAGAC---
Pan_troglodytes|8455               ---CGCTCCTACATCCATCTGCGCTATGTGGATATTTCTGAGAACCACCTGACAGAC---
Tursiops_truncatus|8452            ---CGTTCCTACATCCATCTGCGCTTTGTGGATGTTTCCAGAAACCACTTGACAGAC---
Oryctolagus_cuniculus|18422        ---CGGTCCTACATCCATCTGCGCTATGTGGATATTTCTGAGAATCACCTGACAGAC---
Microcebus_murinus|1893            ---CGCTCCTACATCCATCTGCGCTATGTGGATGTTTCTGAGAACCACCTGACAGAC---
Sus_scrofa|14893                   ---GATTCCTACATCCAACTGCGCTACGTGGATATTTCTGAAAACCACTTGACAGAC---
Bos_taurus|21080                   ---CGTTCCTACATCCATCTGCGCTACGTGGATGTTTCTGAAAACCACTTGACAGAC---
Equus_caballus|22814               ---CGTTCCTACATCCATCTGCGCTATGTGGATGTTTCTGAGAACCACCTGACAGAC---
Loxodonta_africana|6625            ---CGCTCCTACATCCATCTGCGCTATGTGGATGTTTCTGAGAACCACCTGACAGAC---
Procavia_capensis|12919            ---CGATCCTACATCCATCTGCGTTATGTGGATATTTCTGAGAACCATCTGACAGAC---
Tribolium_castaneum|13568          ---CTCCGCTTCAAACACGTGCTATTCCTCGATCTCAGCGGCAACTACCTCACCACTGAC
Apis_mellifera|27901               ---CCGATGTTCAAATACGTGCTCTACGTGAACGTCTCCGGGAATAAATTGAATAACGAG
Pogonomyrmex_barbatus|4965         ---TTATCCTTCAGACACGTTCGTCATGTGAACGTGTCGGGAAACAGATTGACGTCAGAA
                                                                                               

Bombyx_mori|12726                  GCATTGCAAGCGGTGACGGAGCTTCCACATCTTTTGCTGATACACGCTGACAAAAATATA
Pediculus_humanus|1874             ACGTCTTGTCCCGTCACCAAACTTCCAAACATTGTCGCACTCAAATTGAACAGGAATAAT
Danio_rerio|18816                  ---TTCTCTCCACTGGCTGGCCTCACTCAGCTGCTGTGGGTGAAGGGAGACAGCAACCTG
Gasterosteus_aculeatus|19193       ---CTTTCTCCTCTGGCGTCACTCACCCAGCTGCTCTGGCTGAAGGTTGACAAAAACGCT
Branchiostoma_floridae|25776       ---CTGTCTCCACTCAACAAGATGGACCATCTACTCTGGCTCAAGGTGGACCGAAACGCG
Apis_mellifera|28392               ------------------------------------------------------------
Branchiostoma_floridae|38368       ---GTCTCGGCGCTGAACTCCCTCACGCACCTGCTGACCCTTAAGGCGGACAGGAACCTT
Nematostella_vectensis|15350       ---CTCTCACCTCTGAACTCTCTCACTCACCTTCTGACCCTGAAAGCTGATAGGAATGCT
Xenopus_tropicalis|24367           ---CTGTCTCCCTTGGGAGCCCTCACCCATCTCCTGAGTTTGCGGGCTGATCACAACCAG
Taeniopygia_guttata|819            ---TTGGCCCCACTGAGCAGCCTAACCCAGCTGCTTTGGCTGAAGGTGGATGGGAATCTG
Gallus_gallus|1428                 ---TTGTCTCCATTGAGCAGCCTAACCCACCTGCTTTGGCTGAAGGTGGATGGGAATCTG
Spermophilus_tridecemlineatus|4123 ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Vicugna_pacos|3688                 ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Anolis_carolinensis|6601           ---CTATCTCCACTGTCAAGTCTTAATCATTTGCTGTGGCTGAAAGTGGATAACAATAAA
Dasypus_novemcinctus|15139         ---TTGACCCCACTCAATAACCTCACCCACCTACTCTGGCTCAAGGCTGATGGCAACCGA
Ornithorhynchus_anatinus|2233      ---CTGTCCCCGCTCAACAGCCTCACGCACCTGCTGTGGCTCAAGGCGGACAAGAACCGC
Echinops_telfairi|7775             ---TTGTCCCCACTCAATCATCTCACCCACCTGCTCTGGCTCAAGGCTGATGGCAACCGG
Macropus_eugenii|201               ---CTGTCACCACTCAACAACCTGACTCACCTACTCTGGCTCAAAGCTGACCACAACCGG
Monodelphis_domestica|30721        ---CTGTCACCCCTCAATGGCCTGACTCACCTACTCTGGCTCAAGGTCGACAACAACCGG
Dipodomys_ordii|4254               ---CTGTCGCCCATGAACTCGCTCACGCACCTGCTGTGGCTCAAGGCGGACGGGAACCAG
Otolemur_garnettii|11355           ---CTGTCTCCACTTAATGGCCTAACCCACCTGCTCTGGCTGAAGGCTGATGGCAATCGG
Pteropus_vampyrus|9290             ---TTGTCCCCACTCAATTACCTCACCCACCTGCTCTGGCTCAAGGCTGACAGCAACCGG
Ochotona_princeps|14676            ---CTGTCCCCACTCAATTACCTCACACATTTGCTCTGGCTCAAGGCTGACAATAATCGG
Choloepus_hoffmanni|2895           ---TTGTCCCCACTCAATTACCTCACCCACCTGCTCTGGCTCAAGGCTGAGGGCAATCGG
Tupaia_belangeri|15677             ------------------------------------------------------------
Erinaceus_europaeus|8425           ---CTGACCCCACTCAACTACCTCACCCACCTGCTCTGGCTCAAGGCTGACAACAACCAG
Sorex_araneus|14189                ---CTGTCCCCCCTCAACCACCTGACCCACCTGCTGTGGCTCAAGGCCGACAACAACCAG
Cavia_porcellus|2245               ---CTAACACCACTCAATAACCTCACCCACCTGCTGTGGCTCAAGGCTGATGGCAACCAG
Mus_musculus|36626                 ---ATATCGCCGCTCAACAGTCTCACTCACCTCCTATGGCTCAAGGCCGATGGCAATCAG
Rattus_norvegicus|26096            ---ATGTCACCACTCAACAGTCTCACTCACCTACTGTGGCTCAAGGCAGACGGCAATCAG
Canis_familiaris|16139             ---TTGTCGCCACTCAATTACCTTACCCACCTGCTCTGGCTCAAGGCTGATGGCAACAAT
Myotis_lucifugus|13983             ---GTGTCCGCACTCAATCACCTCACCCACCTGCTCTGGCTCAAGGCTGACGGCAACCGG
Rhesus_macaque|6876                ---CTGTCGCCACTCAACTACCTCACCCACCTGCTCTGGCTCAAGGCTGATGGCAATCGG
Callithrix_jacchus|23988           ---CTGTCTCCACTCAACCACCTCACCCACCTGCTCTGGCTCAAGGCTGATGGCAATCGG
Homo_sapiens|20388                 ---CTGTCTCCACTCAACTACCTCACCCACCTGCTCTGGCTCAAGGCTGATGGCAATCGG
Pongo_abelii|5936                  ---CTTCTCTCCACTCAACTACCTCACCCACTGCTCTGGCTCAAGGCTGATGGCAATCGG
Gorilla_gorilla|13817              ---CTGTCTCCACTCAACTACCTCACCCACCTGCTCTGGCTCAAGGCTGATGGCAATCGG
Pan_troglodytes|8455               ---CTGTCTCCACTCAACTACCTCACCCACCTGCTCTGGCTCAAGGCTGATGGCAATCGG
Tursiops_truncatus|8452            ---TTGTCCCCACTCAATTGCCTCACCCACCTGCTCTGGCTCAAGGCTGACGGCAACAGG
Oryctolagus_cuniculus|18422        ---CTGTCTCCACTCAACTACCTCACTCACCTGCTCTGGCTCAAGGCTGACAGCAATCAG
Microcebus_murinus|1893            ---CTGTCGCCACTCAATCACCTCACCCACCTGCTCTGGCTCAAGGCTGATGCCAACCGG
Sus_scrofa|14893                   ---TTGTCTCCGCTCAATTACCTCACTCACCTGCTCTGGCTGAAAGCTGATGGCAACCAA
Bos_taurus|21080                   ---TTGTCCCCACTCAATCACCTCACCCACCTGCTCTGGCTCAAGGCCGATGGCAACCAG
Equus_caballus|22814               ---TTGTACCCACTCAATTACCTCACACACCTGCTCTGGCTCAAGGCTGATGGCAACCGG
Loxodonta_africana|6625            ---TTGTCTCCACTCAATTACCTCACCCACCTGCTGTGGCTCAAGGCTGATGGCAACCGG
Procavia_capensis|12919            ---TTGTCCCCACTCAATAACCTCACCCACCTGCTGTGGCTCAAGGCTGATGGCAACGGG
Tribolium_castaneum|13568          GCCCTCACTGTCCTCACTGAAATGCCCTTCCTCATACTCCTCAAAGCCGAGAGGAACCGA
Apis_mellifera|27901               GCACTTCGCGTTCTCTCGTCCATGAAATATCTTCTGATGCTTCAAGCTGATAAAAATGAA
Pogonomyrmex_barbatus|4965         GCACTGCGTGTACTCGAAGCGATGCCGTATTTGCAGACACTGCGAGCGGATCGAAATTGT
                                                                                               

Bombyx_mori|12726                  CTTCGATCG---GGCGCG------CTGAAGAAAATGAAGTACCTCCAAGTCATTATAATG
Pediculus_humanus|1874             TTCAACGAT---CCTTAC------ATGCCCCCCATGAAACACCTACAGTACCTCGGACTC
Danio_rerio|18816                  CTTCAGGGCTTTGAGGGACAGCCTTTCGGTCAGCTCACTTTCCTGCAGTGGCTCAGCATT
Gasterosteus_aculeatus|19193       GTGGAAACCCTCAAAGGGCAACCTTTTCCTCAGTTGATCTACTTGCAGTGGCTGAGCGTG
Branchiostoma_floridae|25776       CTCACCAAA---ATTAAC------CTTACCGAGAGGCTCTTTCTACAGGTGGCGTCCTTC
Apis_mellifera|28392               ------------------------------------------------------------
Branchiostoma_floridae|38368       CTTAAGACT---GCCGCT------CTAGACGAGCTGCCGTATCTTCAGATGGCCAGCTTC
Nematostella_vectensis|15350       CTAAGCTCT---GCCAAG------CTTGATGAGCTTCCCTATCTTCAAATAGCAAGTTTT
Xenopus_tropicalis|24367           CTGGTCAGTGTGAGCGGC------CTGGGCGAGCTCCCCTACCTGCAAGTGGCCAGCTTT
Taeniopygia_guttata|819            CTCACCAGT---GCCAGC------ATGCAGGAGCTGCCCTACCTCCAAGTCATCAGCTTT
Gallus_gallus|1428                 CTTAGCAGT---GCCCAC------ATGCAGGAGCTTCCCTACCTCCAGTTCATCAGCTTT
Spermophilus_tridecemlineatus|4123 NNNNNNNNN---NNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Vicugna_pacos|3688                 NNNNNNNNN---NNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Anolis_carolinensis|6601           CTAACCAGT---GCTGGC------ATGGATGAGTTATTGTATCTGCAGAGTGCCAGCTTT
Dasypus_novemcinctus|15139         CTGCGGAGT---GCCCAG------CTGGATGAACTGCCCTACCTGCAGATTGCTAGTTTT
Ornithorhynchus_anatinus|2233      CTGCGGACC---GCACAC------CTGGAGGAGCTGCCCTACCTGCAGATCGCCAGCTTC
Echinops_telfairi|7775             CTGCGGACT---GCCCGG------CTCAATGAACTNNNNNNNNNNNNNNNNNNNNNNNNN
Macropus_eugenii|201               CTACAGAGT---GCCCAG------ATGTCAGAGCTGCCCTACTTGCAGATCGCCAGCTTT
Monodelphis_domestica|30721        CTAATAAGT---GCCCGA------TTGACAGAGTTACCCTATTTGCAGATTGCCAGCTTT
Dipodomys_ordii|4254               CTGCGCAGC---GCCAGG------CTGAACGAGCTGCCATACCTGCAGATGGTCAGCTTC
Otolemur_garnettii|11355           CTGCGGACT---GCCCGG------TTGAATGAACTGCCTTACTTGCAGATTCACAGTTTT
Pteropus_vampyrus|9290             CTGCGGAGT---GTCCAG------CTGAATGAACTGCCCTACCTGCAGATTGCCAATTTT
Ochotona_princeps|14676            CTGCACAGT---GCCCAG------CTCAATGAACTGCCCTACCTGCAGATGGCCAGTTTT
Choloepus_hoffmanni|2895           CTGCGGAGT---GCCCGG------CTGGATGAACTGCCCTATCTGCAGATTGCCAGTTTT
Tupaia_belangeri|15677             ------------------------------------------------------------
Erinaceus_europaeus|8425           CTGCGGAGT---GCCCGA------ATGAATGTGCTTCCCTACCTGCAGATTGCCAGCTTT
Sorex_araneus|14189                CTGCGCAGT---GCCCGG------CTGCACGAGCTGCCCTACCTGCAGATCCTTAGCTTC
Cavia_porcellus|2245               CTTCGGAGT---GCCCAG------CTGAATGAACTGCCCTACCTGCAGATCGCCAGTTTT
Mus_musculus|36626                 CTTCGGAGT---GCTAGG------ATGAATGAACTTCCCTACCTGCAGATCGCCAGCTTT
Rattus_norvegicus|26096            CTCCGGAGC---GCCCGG------CTGAACGAACTGCCCTACCTGCAGATCGCCAGTTTC
Canis_familiaris|16139             CTGCGGAGT---GCCCAG------CTGAATGAACTGCCCTACCTGCAGGTTGCCAGTTTT
Myotis_lucifugus|13983             CTGCGGAGT---GCCCAG------CTGAACGAACTGCCTTACCTGCAGATTGCCAGTTTT
Rhesus_macaque|6876                CTTCGAAGT---GCCCAG------CTGAATGAACTGCCCTACCTGCAGATTGCTAGTTTT
Callithrix_jacchus|23988           CTGCGGAGT---GCCCAG------CTGAATGAACTGCCCTACCTGCAGACTGCTAGTTTT
Homo_sapiens|20388                 CTGCGAAGT---GCCCAG------ATGAATGAACTGCCCTACCTGCAGATTGCTAGTTTT
Pongo_abelii|5936                  CTGCGAAGT---GCCCAG------CTGAATGAACTGCCCTACCTGCAGATTGCTAGTTTT
Gorilla_gorilla|13817              CTGCGAAGT---GCCCAG------CTGAATGAACTGCCCTACCTGCAGATTGCTAGTTTT
Pan_troglodytes|8455               CTGCGAAGT---GCCCAG------ATGAATGAACTTCCCTACCTGCAGATTGCTAGTTTT
Tursiops_truncatus|8452            CTGCGGAGT---GCCCGG------TTGAGCGAACTGCCCTACCTGCAGATCGCCAGCTTT
Oryctolagus_cuniculus|18422        CTGCGGAGC---GTCCAG------CTGAATGAACTGCCCTACCTGCAGATTGCCAGTTTT
Microcebus_murinus|1893            CTGCGGAGT---GCCCGG------TTGAGTGAACTGCCCTACCTGCAGATTGCCAGTTTT
Sus_scrofa|14893                   CTGCGGAGT---GCCCGG------CTGAACGAACTGCCGTACCTGCAGATTGCCAACTTT
Bos_taurus|21080                   CTTCGGAGT---GCCCGG------CTGAACGAACTGCCCTACCTGCAGATTGCCAGCTTT
Equus_caballus|22814               CTGCGGAGC---GCCCAG------CTGAACGAGCTGCCCTACCTGCAGATTGCCAGTTTT
Loxodonta_africana|6625            CTGCGGAGT---GCTCAG------CTGGATGAACTGCCCTACCTGCAGATTGCCAGTTTT
Procavia_capensis|12919            CTGCGGAGT---GTCCGG------CTGGATGAACTGCCCTACCTGCAGATTGCCAGTTTT
Tribolium_castaneum|13568          GTCGATTCA---GCCGCC------CTCAAACCCATGCCCTACCTCCAGGTCTTAGCCCTC
Apis_mellifera|27901               GTGGAATCC---GCAGAA------TTGGATCCCATGCCTTATCTTCAGGTTTTAACATTG
Pogonomyrmex_barbatus|4965         CTGATCAGC---GCGGAA------TTGAATTCGATGCCCTATCTGCAGGAGCTCTCCCTG
                                                                                               

Bombyx_mori|12726                  AATTACAACGAATTAACGACAGTTCACGATGTCTTCCAACCAGAGCTCAGCACTTTAGAA
Pediculus_humanus|1874             AACAACAACAGGATAAAATCCTTGCACAGAATATATCATCCCAATTTGGAAACTCTGGAT
Danio_rerio|18816                  GCAAGCAATCGGCTGTTTGATGTGAAGGGTCTCGGAGGCCCAGCACTGGAAACCCTCAAT
Gasterosteus_aculeatus|19193       GCAGGGAACCGCCTGGCCGACCTGGACGGCCTCGTCGGACCTTCTTTGGAGAGCCTCAAT
Branchiostoma_floridae|25776       GCGTTTAACCAGATCGCTACGGTGGCAGGCCTGAGCCATCCCCAGCTCATGCTCCTGAAC
Apis_mellifera|28392               ------------------------------------------------------------
Branchiostoma_floridae|38368       ACCAACAACAAGATCAACACTACAGAGGGGATCAACCATCCACTATTGGAGACACTCGTG
Nematostella_vectensis|15350       ACACAAAACAAGATTATGGATACAGAAGGCATCAACCATCCCCTTTTGGAACATCTTAAT
Xenopus_tropicalis|24367           GCGCAGAACCGGATAAAGTCGCTGCAAGGATTCGGGCATCCGCGGCTTGAAACTCTCAAC
Taeniopygia_guttata|819            GATCGCAACCGCATCATGGATTTTGAGGGCATTACTCACCCCCTCCTAGCCAACCTCAGC
Gallus_gallus|1428                 GCTCACAACCACATCAAGAATATGGAGGGTATTACTCACCCCCACTTAACCAGCCTCAGC
Spermophilus_tridecemlineatus|4123 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Vicugna_pacos|3688                 NNNNNNNNNNNNNNNNNNNNNNNNNNNNGCATCTCCCATCCTCGTCTGGCCAGCCTGGAT
Anolis_carolinensis|6601           GCTAACAACCAAATAAAAGACACCAATGGCATCAACCACCCACGCTTGGCCAGCCTCAAC
Dasypus_novemcinctus|15139         GCCTATAACCAGATCACTGACACTGAGGGCATCGCTCATCCCCGTCTGGGCAGCCTGGAT
Ornithorhynchus_anatinus|2233      GCCCACAACCGCATCAGCGGCACGGAGGGCATCACCCACCCCCGCCTCACCAGCCTGGAC
Echinops_telfairi|7775             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Macropus_eugenii|201               GCCTACAACCAGATCACTGACACCGAAGGCATCGGCCATCCCAGATTGGGCAGCTTGGAT
Monodelphis_domestica|30721        GCCTACAACCAAATCACTGACACTGAGGGCATCCTGCATCCCAGATTAGTGAGCCTGGAT
Dipodomys_ordii|4254               GCCTACAACCAGATCACAGACACCGAGGGCATCACCCACCCGCGCCTGGGCAGCCTCGAC
Otolemur_garnettii|11355           GCCTATAACCAGATCACTGACACTGAGGGCATTTTTCAT---CGTCTGGGAAGCCTGGAT
Pteropus_vampyrus|9290             GCCTATAACCAGATCACTGACACTGAGGGCATCTCTCATCCTCGTCTGGGCAGCCTGGAT
Ochotona_princeps|14676            GCCTATAACCAGATCACGGACACGGAAGGCATTGCTCATCCTCGTCTGGCCAGCCTGGAT
Choloepus_hoffmanni|2895           GCCTATAACCAGATCATTGACACTGAGGGCATCTCTCATCCTCGTCTGAGCAGCCTGGAT
Tupaia_belangeri|15677             ------------------------------------------------------------
Erinaceus_europaeus|8425           GCCTACAACCAGATCGGTGATACGGAAGGCATTTTGCACCCCCGGCTGAGCAGTCTGGAT
Sorex_araneus|14189                GCCTACAACCAGATCACGGACACCGAGGGCATCTCGCACCCGCGCCTGACCAGCCTGGAC
Cavia_porcellus|2245               GCCTACAATCAGATCACTGACACTGAAGGAATCACTCATCCTCGGCTAGCAAGTCTGGAT
Mus_musculus|36626                 TCCTACAACCAGATCATAGACACTGAAGGCATCTTTCACCCCCGTCTGGGAAGCCTGGAT
Rattus_norvegicus|26096            TCCTACAACCAGATCACAGACACCGAAGGCATCATCCATCCCCGTCTGGGAAGCCTGGAT
Canis_familiaris|16139             GCCCATAACCAGATCACTGACACTGAGGGCATCTCTCACCCTCGTCTGGGCAGCCTGGAT
Myotis_lucifugus|13983             GCCTATAACCAGATCGCTGACACGGAGGGCATCTCTCATCCTCGTCTGGGCATCCTGAAC
Rhesus_macaque|6876                GCTTATAACCAGATTACTGACACTGAAGGCATCTCTCATCCTCGTCTTGAAACCCTGAAT
Callithrix_jacchus|23988           GCTTATAACCAGATTACTGACACTGAAGGCATCTCACATCCTCGTCTGGGAAGCGTGAAT
Homo_sapiens|20388                 GCTTATAACCAGATTACTGACACTGAAGGCATCTCTCATCCTCGTCTTGAAACCCTGAAT
Pongo_abelii|5936                  GCTTATAACCAGATTACTGACACTGAAGGCATCTCTCATCCTCGTCTTGAAACCCTGAAT
Gorilla_gorilla|13817              GCTTATAACCAGATTACTGACACTGAAGGCATCTCTCATCCTCGTCTTGAAACCCTGAAT
Pan_troglodytes|8455               GCTTATAACCAGATTACTGACACTGAAGGCATCTCTCATCCTCGTCTTGAAACCCTGAAT
Tursiops_truncatus|8452            GCCTATAACCAGATCACCGACACTGAGGGCATCTCTCATCCTCGTCTGGCCAGCCTGGAT
Oryctolagus_cuniculus|18422        GCCTATAACCAGATCATTGATACTGAGGGCATTGCTCATCCTCGTCTGAGAAGCCTGGAT
Microcebus_murinus|1893            GCCTATAACCAGATCACTGACACTGAGGGCATCTCTCATCCTCGTCTGGGAAGCCTGGAT
Sus_scrofa|14893                   GCCTATAATCAGATCACTGACACTGAGGGCATCTCTCATCCTCGTCTGGCCAGCCTGGAT
Bos_taurus|21080                   GCCTACAACCAGATCACTGACACAGAGGGCATCTCTCATCCTCGTCTGGCCAGCCTGGAT
Equus_caballus|22814               GCCCATAACCAGATCACTGACACTGAGGGCATCTCTCATCCTCGTCTGGGCAGCCTGGAT
Loxodonta_africana|6625            GCTTATAACCAGATCACTGATACTGAGGGCATCTCTCATCCTCGCCTGGGCAGCCTGGAC
Procavia_capensis|12919            GCTTATAACCAGATCACTGACACTGAGGGCATCTCTCATCCTCGTCTGGTCAGCCTGGAT
Tribolium_castaneum|13568          AACCAAAACCAAATCAAACAGGTGGGAAACATCGACCAACCCCTGCTTGACTGCCTCGAA
Apis_mellifera|27901               AACAATAACAAATTGAACAGCACGTCGGGCATCTCGCACAAGTTTCTCGAATGTCTGGAA
Pogonomyrmex_barbatus|4965         AATCAAAACAAGTTGAGGGATGCAGCTGGCATTCATCACAGGTTGCTCGAACGTCTGGAA
                                                                                               

Bombyx_mori|12726                  GTTGGTTACAACAAAATAAGAAAAATAAAT---TTCGATAGC---AGAATGGAAACTATA
Pediculus_humanus|1874             TTAAATTATAATCACGTGAGAGATGTGGATCCGAGAGATTGTTGGAAATTACCCAAATTA
Danio_rerio|18816                  CTTACTGGTAATGGCATCCAGACCATGCAGGGCCTGGATCATCCAAATCTGACCAATCTG
Gasterosteus_aculeatus|19193       CTCACAGGTAACCGTATTCAGAGAGTGAATGGTCTTCAGAGTGGCTCTTTAGCCAACCTG
Branchiostoma_floridae|25776       CTGACAGGGAACCGTCTGCAGCGGATCTCCGGGCTCGACCCGTGTAAGCTCCGGGCCCTG
Apis_mellifera|28392               ------------------------------------------------------------
Branchiostoma_floridae|38368       TTGTCTTATAATGAGATTAAGATTGCTAGCGGGCTGGACCCAGGAAAACTGCGAAACCTG
Nematostella_vectensis|15350       CTATCTATGAATGAGATAGTGGAAGTGTCAGGTCTAGACCCTGGAAAGCTGAGCAGACTG
Xenopus_tropicalis|24367           CTGATAGGAAATGAATTGCGGGATCTGGAGGGCTTAGAGTGCAGCAATCTGAGCAGCCTT
Taeniopygia_guttata|819            CTGAAAGAAAATAAAATCGAGACAGTGCAGGGCCTGAGTCACAACCAGTTGTTCAGCCTG
Gallus_gallus|1428                 CTTAAAGGAAATAAAATCCCAACAGCACTGGGTCTGAGTCAAGCA---TTGTATAGCCTG
Spermophilus_tridecemlineatus|4123 NNNNNNNGGAACCACATCCACATGGTAACCGGTCTTGACCCCCAAAAGCTGAACAGTCTG
Vicugna_pacos|3688                 CTCAAAGGGAACCACATCCATGTGGTGACAGGTCTGGACCCCCAAAAGCTGATTAGCCTG
Anolis_carolinensis|6601           CTAAAAGGTAATGAAATTGAGAAGGTAACAGGTCTGGATCCAGAAATATTGTCGAATCTG
Dasypus_novemcinctus|15139         CTCAAAGGGAACCGCATCCACTTGGTGACAGGTTTGGATCCCCAAAAGCTGAACTGCCTG
Ornithorhynchus_anatinus|2233      CTCAAAGGAAATTTTATCCAGAGAGTGACGGGGCTGGACCCTCTGAAGCTGGGGAACCTG
Echinops_telfairi|7775             NNNNNNNGAAACCGCATCCAAATGGTGACAGGCCTGGACCCCCAAAAGCTGACCTGCCTG
Macropus_eugenii|201               CTCAAAGGGAACAACATCAAGAAGATAACAGGCCTGGACCCCCAAAAGCTGGTGAACCTG
Monodelphis_domestica|30721        CTCAAAGGGAACAACATCAAGAAAGTAACAGGCCTAGACCCCCAAAAACTGGGGAACTTG
Dipodomys_ordii|4254               CTCAAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|11355           CTTAAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Pteropus_vampyrus|9290             CTCAAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|14676            CTCAAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|2895           CTCAAAGGGAACCACATCCGCATAGTGACAGGTCTGGACCCTCAAAAGCTGAACAACCTG
Tupaia_belangeri|15677             ---------AACCGCATTCGTATGGTGACAGGTCTGGACCCCCAAAAGCTGAACAGCCTG
Erinaceus_europaeus|8425           CTCAAAGGGAACCGGATTCAGATGGTGACAGGTCTGGACCCCATGAAGTTGCGCAGTCTG
Sorex_araneus|14189                CTCAAAGGCAACCGCATCCAAACATTGACCGGCCTGGATCCCAAG------CTGAGCCTG
Cavia_porcellus|2245               CTCAAAGGGAACCGCATCCAGGTGGTGACTGGTCTGGACCCTGAGAAGCTGAAAAGCCTG
Mus_musculus|36626                 CTCAAAGGGAACCGCATCCACCAGGTGACTGGTCTGGACCCCGAGAGACTGTCGAGCCTG
Rattus_norvegicus|26096            CTCAAAGGGAACCGCATCCACCAGGTGACTGGTCTGGACCCCGAAAGACTGACTAACCTG
Canis_familiaris|16139             CTCAAAGGGAACCGCATCCGCAGGGTGACAGGTCTGGACCCCCAGAAGCTGCTCAGCCTG
Myotis_lucifugus|13983             CTCAAAGGGAATCACATCCGCCTGGTGACAGGTATGGACCCCGAAAAGCTGATCAGCCTG
Rhesus_macaque|6876                CTCAAAGGAGATCAAAAACGCTGGCCTTCAGCCCTG------------------------
Callithrix_jacchus|23988           CTCAAAGGGAACAACATCCACATGGTGACAGGTCTGGACCCCCAGAAGCTGATCAGCCTG
Homo_sapiens|20388                 CTCAAAGGGAACAGCATCCACATGGTGACAGGTCTGGACCCCGAGAAGTTGATCAGCCTG
Pongo_abelii|5936                  CTCAAAGGGAACAGCATCCACACGGTGACAGGTCTGGACCCCCAGAAGTTGATCAGCCTG
Gorilla_gorilla|13817              CTCAAAGGGAACAGCATCCACACGGTGACAGGTCTGGACCCCGAGAAGTTGATCAGCCTG
Pan_troglodytes|8455               CTCAAAGGGAACAGCATCCACATGGTGACAGGTCTGGACCCCGAGAAGTTGATCAGCCTG
Tursiops_truncatus|8452            CTCAAAGGGAACCACATCCACATGGTGACAGGTCTGGACCCCCAGAAGCTGATGAGCCTG
Oryctolagus_cuniculus|18422        CTCAAAGGGAACCGCATCCAGATGGTGACAGGTCTGGACCCCCAAAAACTAAACAGCCTG
Microcebus_murinus|1893            CTCAAAGGGAACCGTATCCGTCTTGTGACAGGTCTTGACCCCCAAAATCTGATCAGCCTG
Sus_scrofa|14893                   CTCAAAGGGAACCGCATCCCCATGGTGACAGGTCTGGACCCCCAAAAGCTGATCAGCCTG
Bos_taurus|21080                   CTCAAAGGGAACCGCATCCACATGGTGACAGGTTTGGATCCCCAAAAACTGATCAGCCTG
Equus_caballus|22814               CTCAAAGGAAACCGCATCCGCATGGTGACAGGTCTGGACCCCCAAAAGCTGATCAGCCTG
Loxodonta_africana|6625            CTCAAAGGGAATCGTATCCGCATGGTGACAGGTCTGGACCCCCAAAAGCTGAACAGCCTG
Procavia_capensis|12919            CTGAAAGGGAACCGCATCCACATGGTGACAGGTCTGGACCCCCAAAAGCTGAACAGCCTG
Tribolium_castaneum|13568          ATGAACTACAACGACATCTACAGC---ACGGAATTCGAAACTGCCAATTTGAAGCAATTA
Apis_mellifera|27901               TTGAATCACAACAACATTGAGGAGATCACT---TTGAACCCGTACGATCTCGAAAATTTG
Pogonomyrmex_barbatus|4965         TTGAATCACAATGATATTTGCACTGTGGCT---ATTGATCCGCAGAATCTTCCGAACTTG
                                                                                               

Bombyx_mori|12726                  AGGTGCTTAGATTTTCGCTACAATTTAATAGAAGACATTAACGGACTTAATTTTCCAAAT
Pediculus_humanus|1874             ACGCAATTGGAACTCCGCGGAAATCTTTTACAAACGACCGAAGGAATACAATATCAATCT
Danio_rerio|18816                  GTGACTCTGGAGCTCAGAGGAAATTGTTTGGAAACAACAGATGGCATTTACCTGCCCAAC
Gasterosteus_aculeatus|19193       GTCACGCTGGAGCTGAGGGGAAACAAACTGGATACCACAGATGGAATCAACCTTCCAAAC
Branchiostoma_floridae|25776       ACCACGCTGGAGCTGCGGGGCAACGGGCTGGAGAGCACCGAAGGGCTGGCCCTCCCGTCC
Apis_mellifera|28392               ------------------------------------------------------------
Branchiostoma_floridae|38368       CACACACTGGAGCTGAGAGGGAACCGGCTGGAGTCCACTAACGGCATCTACCTGCCTAAC
Nematostella_vectensis|15350       GCCATACTTGAGTTACGAGGGAACAAGCTCATGACAACAACCGGGATGAACTTGGAAAAC
Xenopus_tropicalis|24367           CATACCTTGGAGCTGCGCAGTAACCAGTTACTCAGCACTGCCGGACTCAACCTACCCAGC
Taeniopygia_guttata|819            GAGGTCCTGGAGCTGCGAGGAAACAGGATAAAGACCACAGCAGGTCTCGGCGTTTCCAAG
Gallus_gallus|1428                 CGTACCCTGGAGCTGCGAGGAAACAAGCTAGAGAGCACAGCAGGGCTTTACCTTCCCAAG
Spermophilus_tridecemlineatus|4123 CACACCCTGGAGCTTCGGGGAAACCAGCTAGAATCCACCCTGGGAATCAACCTTCCTAAG
Vicugna_pacos|3688                 CACACACTGGAGCTTCGGGGGAACCAGCTGGACAGCACCCTGGGAATCAACCTTCCTAAG
Anolis_carolinensis|6601           CACACACTAGAGTTGCGGGGCAACAATCTAAAATCTACAACAGGATTCGACCTGCCCAAA
Dasypus_novemcinctus|15139         CACACACTGGAGCTTCGGGGGAACCAGCTGGAGAGCACCCTGGGAATCAACCTCCCTAAG
Ornithorhynchus_anatinus|2233      CACACGATCGAGCTGCGAGGAAACCAGCTGGAGAGCACAGCCGGGCTCCACCTTCCCAAA
Echinops_telfairi|7775             CATACCCTGGAGCTTCGGGGGAACCAGCTGAACAACACCCTGGGGATCAACCTCCCTAAG
Macropus_eugenii|201               CACACACTAGAGCTCCGAGGGAACCAGCTGGAGAGTACCATGGGAATCGAACTCCCCAAG
Monodelphis_domestica|30721        CATACGCTTGAGCTCCGAGGAAACCAGCTGGAGAGTACACAAGGAATCGAACTCCCTAAG
Dipodomys_ordii|4254               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|11355           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Pteropus_vampyrus|9290             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|14676            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|2895           CACACTCTGGAGCTTCGGGGGAACCAGCTGGAAAGCACCCTGGGAATCAACCTCCCTAAG
Tupaia_belangeri|15677             CACACGCTGGAGCTTCGGGGAAACCAGCTGGAAAGCACCCTGGGGATCAACCTTCCTAAG
Erinaceus_europaeus|8425           CACACACTGGAGCTTCGGGGGAATCACCTGACTAGCACTCTGGGACTCGAGCTCCCGACA
Sorex_araneus|14189                CAGACGCTCGAGCTCCGAGGGAACCAGCTGATCAGCACGCTGGGGCTCAACCTTCCGAAG
Cavia_porcellus|2245               CATACTTTGGAGCTCCGGGCGAACCAGCTGTACACCACCGTGGGGATCAACCTTCCTAAG
Mus_musculus|36626                 CACACCCTGGAGCTTCGAGGGAACCAGCTGGAATCCACAAAGGGAATCTACCTTCCTAAG
Rattus_norvegicus|26096            CACACCCTGGAGCTTCGAGCGAACCAGCTGGAAACCACAATAGGAATCAACCTTCCCAAG
Canis_familiaris|16139             CACACACTGGAGCTTCGGGGGAACCAGCTGGAGAGCACTCTGGGAATCAATCTTCCTAAG
Myotis_lucifugus|13983             CACACACTGGAGCTTCGAGGGAACCAACTGGAAAGCACAGTGGGGATCAACGTTCCTACG
Rhesus_macaque|6876                ---------------------------------------------ATCGGACTCCCAGGG
Callithrix_jacchus|23988           CACACACTGGAGCTTCGGGGGAACCAGCTGGAAAGCACCCTGGGAATCAACCTTCCTAAG
Homo_sapiens|20388                 CACACAGTGGAGCTTCGGGGGAACCAGCTGGAAAGCACCCTGGGAATCAATCTTCCTAAG
Pongo_abelii|5936                  CACACAGTGGAGCTTCGGGGGAACCAGCTGGAAAGCACGCTGGGAATCAATCTTCCTAAG
Gorilla_gorilla|13817              CACACAGTGGAGCTTCGGGGGAACCAGCTGGAAAGCACCCTGGGAATCAATCTTCCTAAG
Pan_troglodytes|8455               CACACAGTGGAGCTTCGGGGGAACCAGCTGGAAAGCACCCTGGGAATCAATCTTCCTAAG
Tursiops_truncatus|8452            CACACACTGGAGCTTCGGGGGAACCAGCTGAACAGCACCGTGGGAATCAACCTTCCTAAG
Oryctolagus_cuniculus|18422        CACACATTGGAGCTTCGGGGAAACCAGCTGAAAAGCACCCTGGGAATCAACCTTCCCAAG
Microcebus_murinus|1893            CACACACTGGAGCTTCGGGGGAACCAGCTGGAAAGTACCCTGGGAATCAACCTCCCTAAG
Sus_scrofa|14893                   CACACCCTGGAGCTTCGGGGCAACCAACTGAGCAGCACCCTGGGAATCAACCTTCCTAAG
Bos_taurus|21080                   CACACGCTGGAGCTTCGGGGGAACCAGCTGAATAGCACCCTGGGAATCAACCTCCCTAAG
Equus_caballus|22814               CATACACTGGAGCTTCGGGGGAACCTGTTGGACAGCACCCTGGGAATCAACCTTCCTAAG
Loxodonta_africana|6625            CACACACTGGAGCTTCGGGGGAACCAGCTGGACAGCACCCTAGGGATTAACCTCCCTAAA
Procavia_capensis|12919            CACACACTGGAGCTTCGGGGGAACCAGCTGGAAACCACCCAGGGGATCAACCTCCCTAAG
Tribolium_castaneum|13568          AAACAACTGGAGATGAGAAGTAATCTCTTGTTTGAAATTTCGGGGTTTTACCCACCTAAC
Apis_mellifera|27901               AAGACCCTTGAAATCGGTGGAAACATTCTCACCACGACCAACGGTATATTCTTTCCGGGA
Pogonomyrmex_barbatus|4965         AAGACTTTAGAGTTACGCGGTAATGCGCTAGTCAGTACAACAGAAATTTGTTGTCCCACT
                                                                                               

Bombyx_mori|12726                  TTGGACAGCTTGTACTTAGCCGGAAATCAAATAAACAGCTTGATTGGACTTGAG------
Pediculus_humanus|1874             CTCGTGAATCTTTACCTGGCACAAAATAAAATAACGGAATTGAGAGGATTTGAA------
Danio_rerio|18816                  TTACGCCATTTGTATCTGGCTCAGAACAATATAAAGAAACTGGAGGGTCTGGAA------
Gasterosteus_aculeatus|19193       CTGCGGCAATTATATCTGGCCCAAAATGCGATCAAGCATTTGGAGGGATTAGAG------
Branchiostoma_floridae|25776       CTCCGAGAGCTGTATCTG------------------------------------------
Apis_mellifera|28392               ------------------------------------------------------------
Branchiostoma_floridae|38368       CTCAAGAACCTCTTCCTGGGGGCGAACATGATCAAGCGAGTGGAGGGCCTGGAG------
Nematostella_vectensis|15350       CTCAGAGAGCTATATCTGGCAGCTAATACCATTCGTAAGGTGGAGGGCCTCGAT------
Xenopus_tropicalis|24367           CTGCGGGAGCTCTACCTGGGACAAAATAACATAAGTCGCCTGGAGGGTCTGGAG------
Taeniopygia_guttata|819            CTCAAGAAGCTCTATCTGGCCAAGAACACTATTTGCAGCCTTGAAGGCCTTGAG------
Gallus_gallus|1428                 CTCAAGAACCTCTATCTGGCCCAGAATGCCATTAGGAGCCTTGAAGGCCTTGAG------
Spermophilus_tridecemlineatus|4123 CTGAAGAACCTCTTCCTGGCCCAGAACTTGCTGAAGAAGGTTGAAGGCTTGGAG------
Vicugna_pacos|3688                 CTAAAGAACCTCTTCCTGTCAGACATGCTG------------------------------
Anolis_carolinensis|6601           CTCAAAAATCTGTACCTGGCCCAAAACTCCCTTACCTATCTGGAGGGCCTGACA------
Dasypus_novemcinctus|15139         CTGAAGAACCTCTACCTGGCCCAGAACTTGCTGAAGAAGGTGGAAGGCTTGGAG------
Ornithorhynchus_anatinus|2233      CTCAAGTATCTCTACCTGGCCCAGAACAACCTGAGGCAACTGGAGGGTCTGGAG------
Echinops_telfairi|7775             CTGAAGAACCTCTACCTGGCCCAGAACATGCTGAAGAAGGTGGAAGGCTTGGAG------
Macropus_eugenii|201               CTGAAGAATCTCTTCTTGGCCCAGAACCAGCTGAAGAAAATAGAAGGAATTGAA------
Monodelphis_domestica|30721        CTAAAGAATCTCTTCTTGGCCCAGAACCAGCTGAAGCAAATAGAAGGACTTGAA------
Dipodomys_ordii|4254               NNNNNNNNNNNNNNNNNNGCTCAGAACATGCTGAAGAAGGTGGAAGGCTTGGAG------
Otolemur_garnettii|11355           NNNNNNNNNNNNNNNNNNGCCCAGAACTTGCTGAAGAAGGTGGAAGGCTTGGAG------
Pteropus_vampyrus|9290             NNNNNNNNNNNNNNNNNNGCCCAGAACATGCTGAAGAAGGTGGAAGGCTTGGAG------
Ochotona_princeps|14676            NNNNNNNNNNNNNNNNNNGCGCAGAACATGCTGAAGAAGGTGGAAGGCTTGGAG------
Choloepus_hoffmanni|2895           CTGAAGAACCTTTTCCTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------
Tupaia_belangeri|15677             CTGAAGAACCTCTACCTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------
Erinaceus_europaeus|8425           CTGAAGAATCTTTTCTTGGCCCAGAACATGCTGAAGAAGGTGGAGGGCTTGGAG------
Sorex_araneus|14189                CTGAAG---CTCTTCCTGGCCCAGAACCAGCTGACGAAGGTGGAAGGCTTGGAG------
Cavia_porcellus|2245               CTGAAGAAACTCTTCCTGGGCCAGAACATGCTGAAGAAAGTGGAAGGCTTGGAA------
Mus_musculus|36626                 CTGAAGAATCTCTACCTGGCTCAAAACCTGCTGAAGAAGGTAGAGGGCCTGGAG------
Rattus_norvegicus|26096            CTAAAGAATCTCTACCTGGCTCAAAACCTGCTGAAGAAGGTGGAAGGCCTGGAA------
Canis_familiaris|16139             CTGAAGAACCTCTACCTGGCCCAGAACATGCTGAAGAAGGTGGAGGGTTTGGAG------
Myotis_lucifugus|13983             CTGAAGAACCTCTTCCTGGCCCAGAATATGTTGAAGAAGGTGGAAGGCTTGGAG------
Rhesus_macaque|6876                ------------------------------------------------------------
Callithrix_jacchus|23988           CTGAAGAACCTCTACCTGGCCCAAAACTTGCTGAAGAAGGTGGAAGGCCTGGAG------
Homo_sapiens|20388                 CTGAAGAACCTCTACCTGGTAGCTCACTGGGTCAGagggtgg------------------
Pongo_abelii|5936                  CTGAAGAACCTCTACCTGGCCCAAAACATGCTGAAGAAGGTGGAAGGCTTGGAG------
Gorilla_gorilla|13817              CTGAAGAACCTCTACCTGGCCCAAAACATGCTGAAGAAGGTGGAAGGCTTGGAG------
Pan_troglodytes|8455               CTGAAGAACCTCTACCTGGCCCAAAACATGCTGAAGAAGGTGGAAGGCTTGGAG------
Tursiops_truncatus|8452            CTGAAGAACCTCTTCCTGNNNNNNNNNNNNNNNNNNNNNNNNNAAGGCTTGGAA------
Oryctolagus_cuniculus|18422        CTGAAGAACCTCTACCTGGCCCAGAACATGCTGAAGAAGGTAGAAGGACTGGAG------
Microcebus_murinus|1893            CTGAAGAACCTCTACCTGGCCCAGAACTTGCTGAAGAAAGTGGAAGGCTTGGAG------
Sus_scrofa|14893                   CTGAAGAACCTCTTCCTGGCCCAGAACATGTTGAAGAAGGTGGAAGGTTTGGAG------
Bos_taurus|21080                   CTGAAGAACCTCTTCCTGGCCCAGAACATGTTGAAGAAGGTGGAAGGCTTGGAG------
Equus_caballus|22814               CTGAAGAACCTCTTCCTGGCCCAGAACTTGCTGAAGAAGGTGGAAGGCTTGGAG------
Loxodonta_africana|6625            CTGAAGAACCTCTTCCTGGCCCAGAACATGCTGAAGAAGGTGGAAGGCTTGGAG------
Procavia_capensis|12919            CTGAAGAACCTTTACCTGGCCCAGAACATGCTGAAGAAGGTGGAAGGCTTGGAG------
Tribolium_castaneum|13568          CTACGGAAACTCTACATGGCTGCCAATAAAATCACGACGATAAATTCGCCAGAATTTGCA
Apis_mellifera|27901               TTGATACGATTGTATTTGGGGGAGAATCAGATAGAGAGGTTGGAGGGGTTAGAG------
Pogonomyrmex_barbatus|4965         TTGACGCAGCTCTTTTTAGCTGAGAATCAGATCGAGAAAATCGAAGGACTTGAT------
                                                                                               

Bombyx_mori|12726                  AGTTGCGTGAATTTAAGAATTTTGCATGTTCGTAATAATCCCATCAAATTGCTTAACGGG
Pediculus_humanus|1874             ATTTTAATCAATTTAGAAAGGTTGCATTTGCGAGAGAATCCCCTTTCGGATTTGACGGGA
Danio_rerio|18816                  AAGCTTGAGCGTCTCATCACTCTTCACCTCAGACATAACCAGTTAGAAACACTGGATGGA
Gasterosteus_aculeatus|19193       AAGTTAGAGCGCCTCACCACCCTTCACCTTCGAGACAACCAGCTGGATGCTCTGGACGGC
Branchiostoma_floridae|25776       ------------------------------------------------------------
Apis_mellifera|28392               ------------------------------------------------------------
Branchiostoma_floridae|38368       CGGCTGGAGAAGCTGACCACGCTCCATCTCCGTGACAACCAGATCGACACGCTGGACGGG
Nematostella_vectensis|15350       CGCTTGGAACACTTGACGAAACTTCACCTGCGGGACAATCAGATAGATAGCCTTGAAGGC
Xenopus_tropicalis|24367           GCTCTTGTCAATCTCACCACCCTCCATCTTAGAGACAACCAGCTGGAGAGCTTAGATGGC
Taeniopygia_guttata|819            GAGTTTGAGCAGCTGGAGACTCTGCACCTACGTGACAATAAGCTTGAGGCCCTGGATGGA
Gallus_gallus|1428                 GCACTAGAGCAGTTGTCAACTCTGCACCTGCGTGACAATGAGCTTGAGACCCTGGATGGA
Spermophilus_tridecemlineatus|4123 AACCTAAGCAATCTCACTACCTTGCATCTCCGAGACAATCAAATTGAAACTCTGAATGGG
Vicugna_pacos|3688                 ------------------------------------------------------------
Anolis_carolinensis|6601           GAGCTGGGGCAACTCACAACCTTACATCTACGTGACAATCAGCTTGAGACACTGGATGGT
Dasypus_novemcinctus|15139         AAGCTAAGCAATCTCACCACCTTGCATCTTCGAGACAACCAGATTGAAACTCTGAGTGGC
Ornithorhynchus_anatinus|2233      TCTCTGGAGCACCTCTGCACGCTGCACCTGCGCGATAACCAAGTGGAAGTCCTGGACGGC
Echinops_telfairi|7775             ACCCTCAGCAACCTCACCACGCTGCATCTTCGAGACAACCAGATTGAAACTCTGAGTGGC
Macropus_eugenii|201               GGACTAAGTTATCTCACTACGTTACATCTTCGGGACAACCAGATCAGTGTTCTGAGCGGC
Monodelphis_domestica|30721        AACCTGGAGCATCTCACTACATTGCATCTTCGGGACAACCAAATCAATACCCTGTCTGGC
Dipodomys_ordii|4254               AATCTAAGCAGCCTCACCACACTGCATCTTCGAGACAACCAGATCGAAAATCTCAGCGGC
Otolemur_garnettii|11355           GAACTGACCGGTCTCACCACTTTGCATCTTCGAGACAACCAGATTGAAACTCTGAGTGGC
Pteropus_vampyrus|9290             AACCTAAAGAATCTCACTACCTTGCATCTTCGAGATAACCACATTGAAACTCTGAGTGGC
Ochotona_princeps|14676            AACCTGAGCAGTCTCACTACCTTGCATCTTCGAGACAACCAGATTGAAACGTTGAGTGGC
Choloepus_hoffmanni|2895           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|15677             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Erinaceus_europaeus|8425           AACCTAGCCAACCTCAACACCCTGCATCTTCGAGACAACCAGATTGAAACACTGAGTGGC
Sorex_araneus|14189                AATCTGAGCAACCTCACGACCTTGCACCTTCGAGATAACATGATCACAACGCTGAACGGC
Cavia_porcellus|2245               AACCTAAGCGATCTCACCACCTTACACCTGCGAGACAACCACATTGAAACTCTGAGCGGC
Mus_musculus|36626                 AACCTGAGCAACTTGACCACCCTGCATCTGCGAGACAACCAGATTGAAACTTTGAATGGC
Rattus_norvegicus|26096            AACTTGAGCAACCTGACCACTCTGCATCTGCGAGACAACCAGATTGAAACTCTGGACGGC
Canis_familiaris|16139             AACCTAAGCAATCTCACTACCTTGCATCTTCGAGACAACCAGATTGAAACTCTGAGTGGC
Myotis_lucifugus|13983             CACCTAAAGAATCTCACTACCTTGCACCTTAGAGACAACCAGATTGACACTCTGAGTGGC
Rhesus_macaque|6876                ------------------------------------------------------------
Callithrix_jacchus|23988           AACCTGAGCAATCTCACCACTTTGCATCTTCGAGACAACCAGATTGACACTCTAAGTGGC
Homo_sapiens|20388                 ------------------------------------------------------------
Pongo_abelii|5936                  GATCTGAGCAATCTCACCACCTTGCATCTTCGAGACAACCAGATTGACACCCTGAGTGGC
Gorilla_gorilla|13817              GATCTGAGCAATCTCACCACCTTGCATCTTCGAGACAACCAGATTGACACCCTGAGTGGC
Pan_troglodytes|8455               GATCTGAGCAATCTCACCACCTTGCATCTTCGAGACAACCAGATTGACACCCTGAGTGGC
Tursiops_truncatus|8452            AGCCTAAGCAATCTCACTACCTTGCAT---CGAGACAACCAGATTGAAACTCTGAGTGGC
Oryctolagus_cuniculus|18422        AACCTAACCAATCTCACCACACTGCATCTTCGAGACAACCAGATTGAAACTCTGAGTGGC
Microcebus_murinus|1893            AACCTAAGCAATCTCACCACTTTGCATCTTCGAGACAACCATATTGAAACTCTGAATGGC
Sus_scrofa|14893                   AACCTAAGCAATCTCACTACCTTGCATCTTCGGGACAACCAGATTGACACTCTGAGTGGC
Bos_taurus|21080                   AACCTAAGCAATCTCACTACCTTGCATCTTCGAGACAACCAGATTGAGACTCTGAGTGGT
Equus_caballus|22814               AACCTTAGCAATCTCACTACCTTGCATCTTCGAGACAACCAGATTGAAACTCTGAGTGGC
Loxodonta_africana|6625            AACCTAAGCAATCTCACCACCTTGCATCTTCGAGACAACCAGATTGAGACTCTGAGTGGC
Procavia_capensis|12919            AACCTAAGCAATCTCACCACCTTGCATCTTCGAGACAACCAGATTGAAACTCTGAGTGGC
Tribolium_castaneum|13568          AAACTTTCGCGTCTGGAAACACTTCATTTGCGAGAGAACAGCATCCAGAATTTGGACGGT
Apis_mellifera|27901               ATATTGGTCAATTTGAAAATTCTGCATCTGAGAAGCAACAAGATATCGAATCTGTCCGGA
Pogonomyrmex_barbatus|4965         GCTCTCGTGAATTTGAGAACACTACACTTGCGAAATAATAAACTTGCGAATTTGGACGGC
                                                                                               

Bombyx_mori|12726                  TTTGTCCCGGATTTAGGGAGGCTTCAGTATGTGAACTTGAGAAACTGCAAGGTCTCCACT
Pediculus_humanus|1874             TTCACGAAATCCAACGTCAAATTGAAATATTTAAACGTGAGAAAGTGCGAAATAGGAAAC
Danio_rerio|18816                  CTCAGTGCCAGTATGAAATGCCTCGAGTATCTTAATGTCAGGGGGAACCTTATATCTTCT
Gasterosteus_aculeatus|19193       CTCAGCCCCAACATGAAGTGTCTCCAATATCTCAATGTGAGAAACAACGTGATCTCAGAT
Branchiostoma_floridae|25776       ------------------------------------------------------------
Apis_mellifera|28392               ------------ATGAGGAATCTACAATACATCAATATGAGGGGGAACATGGTGAGCGAT
Branchiostoma_floridae|38368       TTCGCCGAGTCCATGAAGTCCCTGCAGTACATCAACCTCAGAGGAAACAACATGACGAGT
Nematostella_vectensis|15350       TTTTCAGAAAATATGAAAAACTTACAGTACTTAAATCTCAGGGGGAACAGCATCTCAAGC
Xenopus_tropicalis|24367           TTCTCAGAACATCTGCAGGCCCTCCAGTACTTAAATCTCAGGTCCAACATGGTGGCGAAG
Taeniopygia_guttata|819            TTCTCTAATAGCATGAAGTGCCTACAGTACCTCAATCTACGGAGCAATGGGATCAAAAGC
Gallus_gallus|1428                 TTCTCTAGCAGCATGAAGTGCCTGCAGTACCTCAATCTACGGAACAATGGGATCAGTAGC
Spermophilus_tridecemlineatus|4123 TTCTCCATGGAAATGAAATCACTGCAGTACCTCAACCTGAGGGGCAACATGGTGAGTGAC
Vicugna_pacos|3688                 ------------------------------------------------------------
Anolis_carolinensis|6601           TTCTCAGAGGACATGAAGTCTCTTCAGTACCTCAATTTACGGGGGAATGCAATTAGTCAA
Dasypus_novemcinctus|15139         TTCTCCAAGGAAATGAAATCGCTGCAGTACCTCAACTTGAGGGGCAACATGGTGTCAGAC
Ornithorhynchus_anatinus|2233      TTCTCCCCGTCTATGAAGGCATTGCAGTACCTCAACCTGCGGGGGAATATGATCGCGGAT
Echinops_telfairi|7775             TTTTCTGGGACAATGAAATCGCTGCAGTACCTCAATCTGAGGGGCAATATGGTGGCTGAC
Macropus_eugenii|201               TTCTCTCGGGAAATGAAGTCCCTGCAGTACCTCAATCTT---------------------
Monodelphis_domestica|30721        TTCTCTAGTGAAATGAAGTCCCTGCAGTACCTCAATCTTCGAGGGAACTTGGTGGCAAAC
Dipodomys_ordii|4254               TTCTCCAAGGAGATGAAATCCCTGCAGTACCTCAACTTGCGAGGCAACATGGTGAGCAGC
Otolemur_garnettii|11355           TTCTCCGAGAAAATGTATTCACTGCAGTACCTCAACCTGAGGAGCAACATGGTGACAGAC
Pteropus_vampyrus|9290             TTCTCCAAGGAAATGCAATCACTGCAATACCTCAACCTG---------------------
Ochotona_princeps|14676            TTCTCCAAGGAGATGAAGTCCTTGCAGTACCTCAACCTAAGAGGCAACATGGTGGCTGAC
Choloepus_hoffmanni|2895           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGAAACATGGTGACCAGC
Tupaia_belangeri|15677             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGCAACATGGTGACTGAC
Erinaceus_europaeus|8425           TTCTCCAAGGAAATGAAGTCCCTGCAGTACCTCAACCTGCGGAGCAACATGGTGGCTGAC
Sorex_araneus|14189                TTCTCCAAGGAAATGAAGTCCCTGCAGTACATCAACCTGAGGGGCAACATGGTGTCCGAC
Cavia_porcellus|2245               TTCTCCAAAGAAATGCAGTCCCTGCAGTATCTCAATTTGAGGGGCAACTCGATAAGCAGC
Mus_musculus|36626                 TTCTCCCAGGAAATGAAGTCGCTGCAGTACCTCAACTTGAGGAGCAATATGATTAGTGAT
Rattus_norvegicus|26096            TTCTCCAAGGAAATGAAGTCTCTGCAGTACCTCAACTTGAGGAGTAACATGATCAGTGAC
Canis_familiaris|16139             TTCTCCAAGGAAATGGCATCACTGCAGTATCTCAACCTGAGGGGCAACATGGTGACCCAC
Myotis_lucifugus|13983             TTCTCCGAGGGAATGAAATCACTGCAGTACCTCAACCTG---------------------
Rhesus_macaque|6876                ------------------------------------------------------------
Callithrix_jacchus|23988           TTCTCCAAGGAAATGAAATCATTGCAGTACCTCAACCTGAGGGGCAACTTGGTGGCCAAC
Homo_sapiens|20388                 ------------------------------------------------------------
Pongo_abelii|5936                  TTCTCCAGAGAAATGAAATCATTGCAGTACCTCAACCTGAGGGGCAACATGGTGGCCAAC
Gorilla_gorilla|13817              TTCTCCAGAGAAATGAAATCATTGCAGTACCTCAACCTGAGGGGCAACATGGTGGCCAAC
Pan_troglodytes|8455               TTCTCCAGAGAAATGAAGTCATTGCAGTACCTCAACCTGAGGGGCAACATGGTGGCCGAC
Tursiops_truncatus|8452            TTCTCCAAGGAAATGGAATCACTGCAGTACCTCAACCTAAGGGGCAACATGGTGGCTGAC
Oryctolagus_cuniculus|18422        TTCTCCAAGGAGATGAAGTCGCTGCAATATCTCAACCTGAGGGGCAACATGGTGACTGAC
Microcebus_murinus|1893            TTCTCCGGGGAAATGAAATCACTGCAGTACCTCAACCTGAGGGGCAACATGGTGGCCGAC
Sus_scrofa|14893                   TTCTCCAAGGAAATGAAATCACTGCAGTACCTCAACCTAAGGGGCAACATGGTGACCGAC
Bos_taurus|21080                   TTCTCCAAGGAAATGAAATCATTGCAGTACCTCAACCTAAGGGGCAACATGGTGGCCGAC
Equus_caballus|22814               TTCTCCAAGGAAATGAAGTCACTGCAGTACCTCAACCTGAGGGGCAACATGGTGACTGAC
Loxodonta_africana|6625            TTTTCTGGGGAAATGAAATCACTGCAATACCTCAACTTAAGGGGCAATATGGTGACCGAC
Procavia_capensis|12919            TTTTCTGGAGAAATGAAGTCACTGCAATACCTTAACTTGAGGGGAAATATGATAACTGAC
Tribolium_castaneum|13568          TTCTCCGAGGCTCAAACTAGTCTCAAATATCTCAATTTGCGGAACAATAAAATCGAAAAA
Apis_mellifera|27901               TTCGACTCGCGATGCGCCAAGCTTAATTATCTGAATCTACGCAACAACGAGATATCGAAA
Pogonomyrmex_barbatus|4965         TTCACAGAACGATGTCACAGTTTGAAATACTTAAATCTGCGCAATAATGAGATCTCGAGA
                                                                                               

Bombyx_mori|12726                  TTGAGGCAGGTCAAGAAGCTGAAGGTCCTGCCATCT---TTAGAAACGTTGATATTGAAA
Pediculus_humanus|1874             GTGGAAGAATTTAAAAAATTATCCGTACTCGCGGGA---CTCAAAGAACTCGTGATCAAA
Danio_rerio|18816                  ATGAGGGCTTTGCAGACTCTGGCAAGTGTGGGGCAAACACTAAAGGCACTTGTGCTTTTG
Gasterosteus_aculeatus|19193       GAGAAAGCTCTGGAAGGCCTCGCGCGTGTGTCAAAAACTCTGCGAGCTCTGGTCCTTTCT
Branchiostoma_floridae|25776       ---------GTGGAAAAACTGCACCACCTGAACCGT---CTCCGAACCCTGTCCCTGGCG
Apis_mellifera|28392               GTAAAGGAGACGGCCAAGATGAAGTGTCTGCCCAAA---CTTCGGGCCCTGATCCTCTCC
Branchiostoma_floridae|38368       GTGAAGGAGGTGAAGAAGCTGACAGTCCTGCCCATG---CTCAGAGCTCTTGTCTTCCTG
Nematostella_vectensis|15350       AATAAAGAAGTTCAAAAACTGAAATGTTTACCCCTA---CTAAGAGCATTAGTGTTAATG
Xenopus_tropicalis|24367           CTCCAGGAGGTTCAGAAGCTCTATTGTTTGCCCAGG---TTACGGGCACTTGTTTTGCGG
Taeniopygia_guttata|819            TTTCAGGAGGTGGAAAAGCTGCAGGTGCTCCCCATG---CTGCAGGCACTGGTGCTGATG
Gallus_gallus|1428                 TTGCAGGAAGTGGCAAAACTGCAGGTGCTCCCCATG---CTGCAGGCCCTGGTGCTGATG
Spermophilus_tridecemlineatus|4123 CTGGGAGAGCTGGCAAAGCTTCGGGACCTGCCCAAG---CTTCGAGCCCTGGTGTTGCTG
Vicugna_pacos|3688                 ------------------------------------------------------------
Anolis_carolinensis|6601           ATTCAAGAGCTGACGAAGTTGCTGGTGCTGCCCATG---TTACGGGCCCTGGTCCTGCTA
Dasypus_novemcinctus|15139         CTGGGGGAGCTGGCCAAGCTTCGGGACTTGCCCAAG---CTGCGGGCGATGGTGCTTCTG
Ornithorhynchus_anatinus|2233      CTGGCGGAGCTGGAGAAGCTGCAGGTGCTGCCCAAG---TTGCGGGCGCTGATCCTGCTG
Echinops_telfairi|7775             CTGGGGGAGCTGAGCAAGCTTCGGGACTTGCCCAAA---CTGCGGGCCCTGGTACTGCTG
Macropus_eugenii|201               ------------------------------------------------------------
Monodelphis_domestica|30721        ATAATAGAATTGATTCAACTTAAGGAATTGCCCCGA---CTTCGGGCCCTGATCCTGATG
Dipodomys_ordii|4254               CTGAGCGAGGTGGCCAAGCTGCGCGAGCTGCCCAAG---CTGCGCGCGCTGGTGCTGATG
Otolemur_garnettii|11355           CTGGCGGAGCTGGCCAAGCTTCGGGACCTGCCCAAG---CTGCGAGCCTTGGTGCTGCTG
Pteropus_vampyrus|9290             ------------------------------------------------------------
Ochotona_princeps|14676            CTGTCGGAGCTGGCCAAGCTCCGGGACCTGCCCAAG---CTGCGAGCCTTGGTGCTGCTG
Choloepus_hoffmanni|2895           CTGGGGGAGCTGGCCAAGCTGCGGGATCTCCCCAAG---CTGCGGGCACTGGTACTGCTG
Tupaia_belangeri|15677             TTGAGGGAGCTGGCCAAGCTCCACGACCTGCCCAAG---CTGCGTGCCCTGGTGCTGCTG
Erinaceus_europaeus|8425           CTGGCGGAGCTCTCC---CTCCGGGACCTGCCTAAG---CTTCGAGCCTTGGTGCTGCTG
Sorex_araneus|14189                ATGAGCGAGCTGGCCAAGCTCCGGGAGCTGCCCAAG---CTGCGCGCCCTGGTGCTGCTG
Cavia_porcellus|2245               GTGGGGGAGCTGGCCAAGCTGCGGGAATTGCCCAAG---CTTCGAGCTTTGGTGCTGCTA
Mus_musculus|36626                 CTGGCAGAGCTGGCCAAACTGCGGGACCTGCCCAAA---CTTCGAGCCCTGGTGCTGCTG
Rattus_norvegicus|26096            CTGGGGGAGCTGGCCAAACTGCGGGACCTGCCCAAG---CTGAGGGCCTTGGTGCTGCTG
Canis_familiaris|16139             CTGGAGGAGCTGGCCAAGCTTCGGGACCTGCCCAAG---CTGCGAGCCCTGGTGCTATTG
Myotis_lucifugus|13983             ------------------------------------------------------------
Rhesus_macaque|6876                ------------------------------------------------------------
Callithrix_jacchus|23988           TTGGGGGAGCTGGCCAAGCTTCAAGACCTGCCCAAG---CTGCGAGCCTTGGTGCTGCTG
Homo_sapiens|20388                 ------------------------------------------------------------
Pongo_abelii|5936                  CTGCGGGAGCTGGCCAAGCTTCGAGACCTGCCCAAG---CTGCGAGCCTTGGTGCTGCTC
Gorilla_gorilla|13817              CTGGGGGAGCTGGCCAAGCTTCGAGACCTGCCCAAG---CTGCGAGCGTTGGTGCTGCTC
Pan_troglodytes|8455               CTGGGGGAGCTGGCCAAGCTTCGAGACCTGCCCAAG---CTGCGAGCGTTGGTGCTGCTC
Tursiops_truncatus|8452            CTGGGGGAGCTCGCCAAGCTGCGGAACCTGCCCAAG---CTGCGAGCCTTGGTGCTGCTG
Oryctolagus_cuniculus|18422        CTGACAGAGTTGGCCAAACTTCGGGACCTGCCCAAG---CTTCGAGCCTTGGTGCTGCTG
Microcebus_murinus|1893            CTGGGGGAGCTGGCCAAGCTTCGGGACCTGCCCAAG---CTACGAGCCTTGGTGCTGTTG
Sus_scrofa|14893                   CTGGGGGAGCTAGCCAAGCTGCAGGACCTGCCCAAG---CTGCGAGCCCTGGTGCTGCTG
Bos_taurus|21080                   CTGGGGGAGCTCGCCAAGCTGCGGGACCTACCCAGG---CTGCGAGCCTTGGTGCTGCTG
Equus_caballus|22814               CTGGGGGAGCTAGCCAAGCTTCGGGACCTGCCCAAG---CTTCGAGCCTTGGTGCTGCTG
Loxodonta_africana|6625            CTGGGGGAGCTGGCCAAGCTTCGGGACCTGCCCAAG---CTGCGGGCCCTGGTGCTGCTG
Procavia_capensis|12919            CTGGCGGAACTGGCCAAACTTCGAGACCTGCCCAAG---CTGCGGGCCCTGGTGCTGCTG
Tribolium_castaneum|13568          TTTAAGGAGTTTCGAAAATTGCAGTGTTTACCAAAT---TTGGAAACTTTGATCGTCACT
Apis_mellifera|27901               ATTTCCGAGTTGGAGAAGTTGAACTGTTTGCCCGCG---TTGGAGACGCTGATAGTCATG
Pogonomyrmex_barbatus|4965         ATATCAGAGCTGGAAAAATTAAGCTGTCTATCAAAT---CTGGAAACGCTTATCATTTTG
                                                                                               

Bombyx_mori|12726                  GGGTGTCCATATATGGGAGGAACTGGGGAAGAAACGCCCGAAGTAGCAGACGAG------
Pediculus_humanus|1874             GGCAACGTTTTCAATGCGGAACCGGGCGAAGAAGCACAATCGGACGAAAACAACGAGAAT
Danio_rerio|18816                  GACAACCCTATT------------------------------------------------
Gasterosteus_aculeatus|19193       GACAATCCTCTG------------------------------------------------
Branchiostoma_floridae|25776       GGTAACCCTCTA------------------------------------------------
Apis_mellifera|28392               GAGAACCCCTGT------------------------------------------------
Branchiostoma_floridae|38368       GAATGCCCGGTG------------------------------------------------
Nematostella_vectensis|15350       GAAAATCCTGTG------------------------------------------------
Xenopus_tropicalis|24367           GAGAATCCTTGT------------------------------------------------
Taeniopygia_guttata|819            GACAATCCATGT------------------------------------------------
Gallus_gallus|1428                 GAGAATCCGTGC------------------------------------------------
Spermophilus_tridecemlineatus|4123 GAGAACCCAATT------------------------------------------------
Vicugna_pacos|3688                 ------------------------------------------------------------
Anolis_carolinensis|6601           GACAATCCTTGT------------------------------------------------
Dasypus_novemcinctus|15139         GACAACCCATGC------------------------------------------------
Ornithorhynchus_anatinus|2233      GAGAACCCGTGC------------------------------------------------
Echinops_telfairi|7775             GAAAACCCATGC------------------------------------------------
Macropus_eugenii|201               ------------------------------------------------------------
Monodelphis_domestica|30721        GAGAACCCATGC------------------------------------------------
Dipodomys_ordii|4254               GAAAACCCGTGC------------------------------------------------
Otolemur_garnettii|11355           GACAACCCAATC------------------------------------------------
Pteropus_vampyrus|9290             ------------------------------------------------------------
Ochotona_princeps|14676            GATAACCCGTGT------------------------------------------------
Choloepus_hoffmanni|2895           GACAACCCATGC------------------------------------------------
Tupaia_belangeri|15677             GATAACCCCTGC------------------------------------------------
Erinaceus_europaeus|8425           GACAACCCGTGT------------------------------------------------
Sorex_araneus|14189                GAGAACCCGTGT------------------------------------------------
Cavia_porcellus|2245               GAGAATCCATGC------------------------------------------------
Mus_musculus|36626                 GACAACCCATGT------------------------------------------------
Rattus_norvegicus|26096            GACAACCCCTGT------------------------------------------------
Canis_familiaris|16139             GACAACCCATGT------------------------------------------------
Myotis_lucifugus|13983             ------------------------------------------------------------
Rhesus_macaque|6876                GGGCCACCA---------------------------------------------------
Callithrix_jacchus|23988           GATAACCCATGC------------------------------------------------
Homo_sapiens|20388                 ---------tgc------------------------------------------------
Pongo_abelii|5936                  GATAACCCATGC------------------------------------------------
Gorilla_gorilla|13817              GATAACCCATGC------------------------------------------------
Pan_troglodytes|8455               GATAACCCATGC------------------------------------------------
Tursiops_truncatus|8452            GACAACCCGTGT------------------------------------------------
Oryctolagus_cuniculus|18422        GACAACCCGTGT------------------------------------------------
Microcebus_murinus|1893            GACAACCCGTGC------------------------------------------------
Sus_scrofa|14893                   GACAACCCGTGT------------------------------------------------
Bos_taurus|21080                   GACAACCCATGC------------------------------------------------
Equus_caballus|22814               GACAACCCATGT------------------------------------------------
Loxodonta_africana|6625            GAAAACCCATGC------------------------------------------------
Procavia_capensis|12919            GAAAACCCATGT------------------------------------------------
Tribolium_castaneum|13568          GGAAATCCGCTCCCAGGGAGTGAAGTCCCACAAATGGGTGGTGAAGGTGGTGGTGGGGGA
Apis_mellifera|27901               GAGAATCCCGCG------------------------------------------------
Pogonomyrmex_barbatus|4965         GGAAATCCTTTTCTGAAGAAAGAGGCAAAAGAGGAAGAA---------------------
                                                                                               

Bombyx_mori|12726                  ------------------GAGGAA------------------------------------
Pediculus_humanus|1874             GAAAGTGAAAATGAAGAACAAGATGGAGGAAGAAGAGGAGCAGAAGAAGAACAAGAAGTG
Danio_rerio|18816                  ------------------GCGAAG------------------------------------
Gasterosteus_aculeatus|19193       ------------------GTGGAC------------------------------------
Branchiostoma_floridae|25776       ------------------GCCGAG------------------------------------
Apis_mellifera|28392               ------------------TCAGAC------------------------------------
Branchiostoma_floridae|38368       ------------------ACGGAG------------------------------------
Nematostella_vectensis|15350       ------------------TCTGAT------------------------------------
Xenopus_tropicalis|24367           ------------------GAAGAG------------------------------------
Taeniopygia_guttata|819            ------------------GCTGAA------------------------------------
Gallus_gallus|1428                 ------------------TCAGAT------------------------------------
Spermophilus_tridecemlineatus|4123 ------------------ACAGAT------------------------------------
Vicugna_pacos|3688                 ------------------------------------------------------------
Anolis_carolinensis|6601           ------------------TCTGAA------------------------------------
Dasypus_novemcinctus|15139         ------------------ACAGAT------------------------------------
Ornithorhynchus_anatinus|2233      ------------------GTCGAC------------------------------------
Echinops_telfairi|7775             ------------------ACAGAT------------------------------------
Macropus_eugenii|201               ------------------------------------------------------------
Monodelphis_domestica|30721        ------------------ACAGAT------------------------------------
Dipodomys_ordii|4254               ------------------GCCGAC------------------------------------
Otolemur_garnettii|11355           ------------------ACAGAT------------------------------------
Pteropus_vampyrus|9290             ------------------------------------------------------------
Ochotona_princeps|14676            ------------------GCGGAT------------------------------------
Choloepus_hoffmanni|2895           ------------------ACAGAT------------------------------------
Tupaia_belangeri|15677             ------------------ACGGAC------------------------------------
Erinaceus_europaeus|8425           ------------------GCAGAT------------------------------------
Sorex_araneus|14189                ------------------TCCGAC------------------------------------
Cavia_porcellus|2245               ------------------ACGGAT------------------------------------
Mus_musculus|36626                 ------------------GCGGAT------------------------------------
Rattus_norvegicus|26096            ------------------GCCGAT------------------------------------
Canis_familiaris|16139             ------------------ACAGAT------------------------------------
Myotis_lucifugus|13983             ------------------------------------------------------------
Rhesus_macaque|6876                ------------------------------------------------------------
Callithrix_jacchus|23988           ------------------ACGGAT------------------------------------
Homo_sapiens|20388                 ------------------agggaa------------------------------------
Pongo_abelii|5936                  ------------------ACGGAT------------------------------------
Gorilla_gorilla|13817              ------------------ACGGAC------------------------------------
Pan_troglodytes|8455               ------------------ACGGAC------------------------------------
Tursiops_truncatus|8452            ------------------ACGGAC------------------------------------
Oryctolagus_cuniculus|18422        ------------------GCAGAT------------------------------------
Microcebus_murinus|1893            ------------------GCAGAT------------------------------------
Sus_scrofa|14893                   ------------------GCAGAC------------------------------------
Bos_taurus|21080                   ------------------ACCGAT------------------------------------
Equus_caballus|22814               ------------------ACAGAT------------------------------------
Loxodonta_africana|6625            ------------------ACAGAT------------------------------------
Procavia_capensis|12919            ------------------ACAGAT------------------------------------
Tribolium_castaneum|13568          GTGTTTGGTGAAGGGGGTAAGATC------------------------------------
Apis_mellifera|27901               ------------------ATAGAC------------------------------------
Pogonomyrmex_barbatus|4965         ------------------GAGAAA------------------------------------
                                                                                               

Bombyx_mori|12726                  ------------------------------------------------AAT------TCT
Pediculus_humanus|1874             GAAGAGGAGGAAGGCAAAAGCAAACGAAAAAACAAAGGAAATAAAACCGAAAACGATGAT
Danio_rerio|18816                  ------------------------------------------------ACT------GAC
Gasterosteus_aculeatus|19193       ------------------------------------------------GCG------ACA
Branchiostoma_floridae|25776       ------------------------------------------------GAAGAGGCTGAG
Apis_mellifera|28392               ------------------------------------------------GAT------GAT
Branchiostoma_floridae|38368       ------------------------------------------------GAA------GAC
Nematostella_vectensis|15350       ------------------------------------------------GAA------GAT
Xenopus_tropicalis|24367           ------------------------------------------------GAG------GAG
Taeniopygia_guttata|819            ------------------------------------------------GAA------CCC
Gallus_gallus|1428                 ------------------------------------------------GAA------GCA
Spermophilus_tridecemlineatus|4123 ------------------------------------------------GAG------ACT
Vicugna_pacos|3688                 ------------------------------------------------------------
Anolis_carolinensis|6601           ------------------------------------------------GAA------GGG
Dasypus_novemcinctus|15139         ------------------------------------------------GAG------AGC
Ornithorhynchus_anatinus|2233      ------------------------------------------------GAA------GGG
Echinops_telfairi|7775             ------------------------------------------------GAG------AGT
Macropus_eugenii|201               ------------------------------------------------------------
Monodelphis_domestica|30721        ------------------------------------------------GAA------ACT
Dipodomys_ordii|4254               ------------------------------------------------GAG------ACG
Otolemur_garnettii|11355           ------------------------------------------------GAG------AGT
Pteropus_vampyrus|9290             ------------------------------------------------------------
Ochotona_princeps|14676            ------------------------------------------------GAG------ACT
Choloepus_hoffmanni|2895           ------------------------------------------------GAG------AAT
Tupaia_belangeri|15677             ------------------------------------------------GAG------ACC
Erinaceus_europaeus|8425           ------------------------------------------------GAA------AAT
Sorex_araneus|14189                ------------------------------------------------GAG------AGC
Cavia_porcellus|2245               ------------------------------------------------GAG------ACT
Mus_musculus|36626                 ------------------------------------------------GAG------ACC
Rattus_norvegicus|26096            ------------------------------------------------GAG------ACT
Canis_familiaris|16139             ------------------------------------------------GAG------GCT
Myotis_lucifugus|13983             ------------------------------------------------------------
Rhesus_macaque|6876                ------------------------------------------------------------
Callithrix_jacchus|23988           ------------------------------------------------GAC------ACC
Homo_sapiens|20388                 ------------------------------------------------gag---------
Pongo_abelii|5936                  ------------------------------------------------GAA------ATC
Gorilla_gorilla|13817              ------------------------------------------------GAA------ACC
Pan_troglodytes|8455               ------------------------------------------------GAA------ACC
Tursiops_truncatus|8452            ------------------------------------------------GAG------AAC
Oryctolagus_cuniculus|18422        ------------------------------------------------GAG------ACC
Microcebus_murinus|1893            ------------------------------------------------GAA------ACC
Sus_scrofa|14893                   ------------------------------------------------GAG------AGT
Bos_taurus|21080                   ------------------------------------------------GAG------AAC
Equus_caballus|22814               ------------------------------------------------GAG------AAC
Loxodonta_africana|6625            ------------------------------------------------GAG------AGT
Procavia_capensis|12919            ------------------------------------------------GAG------AGT
Tribolium_castaneum|13568          ------------------------------------------------AGG------GAT
Apis_mellifera|27901               ------------------------------------GAGAGAGAAATGGAAGAGGAAGCT
Pogonomyrmex_barbatus|4965         ------------------------------------------------GAAGCGAGACAA
                                                                                               

Bombyx_mori|12726                  GAATTG------------------------------------------------------
Pediculus_humanus|1874             GATTACGGTGTTGGTGACGGTGATAAAACAAACGAAGAATCGGATATGGAAGAAGAAGAA
Danio_rerio|18816                  GATTAC------------------------------------------------------
Gasterosteus_aculeatus|19193       GACTAC------------------------------------------------------
Branchiostoma_floridae|25776       CACTAC------------------------------------------------------
Apis_mellifera|28392               GAATAC------------------------------------------------------
Branchiostoma_floridae|38368       GACTAC------------------------------------------------------
Nematostella_vectensis|15350       GATTAC------------------------------------------------------
Xenopus_tropicalis|24367           GGTTAT------------------------------------------------------
Taeniopygia_guttata|819            ACTTAT------------------------------------------------------
Gallus_gallus|1428                 AACTAC------------------------------------------------------
Spermophilus_tridecemlineatus|4123 GATTAC------------------------------------------------------
Vicugna_pacos|3688                 ------------------------------------------------------------
Anolis_carolinensis|6601           GACTAC------------------------------------------------------
Dasypus_novemcinctus|15139         GACTAC------------------------------------------------------
Ornithorhynchus_anatinus|2233      GGCTAC------------------------------------------------------
Echinops_telfairi|7775             GACTAC------------------------------------------------------
Macropus_eugenii|201               ------------------------------------------------------------
Monodelphis_domestica|30721        GACTAC------------------------------------------------------
Dipodomys_ordii|4254               GACTAC------------------------------------------------------
Otolemur_garnettii|11355           GACTAC------------------------------------------------------
Pteropus_vampyrus|9290             ------------------------------------------------------------
Ochotona_princeps|14676            GACTAC------------------------------------------------------
Choloepus_hoffmanni|2895           GACTAC------------------------------------------------------
Tupaia_belangeri|15677             GACTAC------------------------------------------------------
Erinaceus_europaeus|8425           GACTAC------------------------------------------------------
Sorex_araneus|14189                GAGTAC------------------------------------------------------
Cavia_porcellus|2245               GACTAC------------------------------------------------------
Mus_musculus|36626                 GACTAC------------------------------------------------------
Rattus_norvegicus|26096            GACTAC------------------------------------------------------
Canis_familiaris|16139             GACTAC------------------------------------------------------
Myotis_lucifugus|13983             ------------------------------------------------------------
Rhesus_macaque|6876                ------------------------------------------------------------
Callithrix_jacchus|23988           AACTAC------------------------------------------------------
Homo_sapiens|20388                 ------------------------------------------------------------
Pongo_abelii|5936                  AACTAC------------------------------------------------------
Gorilla_gorilla|13817              AGCTAC------------------------------------------------------
Pan_troglodytes|8455               AGCTAC------------------------------------------------------
Tursiops_truncatus|8452            GACTAC------------------------------------------------------
Oryctolagus_cuniculus|18422        GACTAC------------------------------------------------------
Microcebus_murinus|1893            GACTAC------------------------------------------------------
Sus_scrofa|14893                   GACTAC------------------------------------------------------
Bos_taurus|21080                   GACTAC------------------------------------------------------
Equus_caballus|22814               GACTAC------------------------------------------------------
Loxodonta_africana|6625            GACTAC------------------------------------------------------
Procavia_capensis|12919            GACTAC------------------------------------------------------
Tribolium_castaneum|13568          CCGGTG------------------------------------------------------
Apis_mellifera|27901               ACTTAT------------------------------------------------------
Pogonomyrmex_barbatus|4965         GAATAC------------------------------------------------------
                                                                                               

Bombyx_mori|12726                  ---------AGAGTAGAGATCTTAGCGGCTTTACCTAAATTAAAGAAAATTAACAAGACT
Pediculus_humanus|1874             ATGGAAAACCGTTTAAAAATTTTAAGTTATTTACCCCATCTCCATAGAATAGACAAAAGA
Danio_rerio|18816                  ---------AGGCTTTATGTGATCTCACAACTTCCCCACCTGGAACGAGTGGACAAAGAT
Gasterosteus_aculeatus|19193       ---------CGGCTGAGCGTACTGACTCTCCTGCCCCAGCTGGAGCGACTGGACAAAGAT
Branchiostoma_floridae|25776       ---------GTGTTGGACGCCCTGTCCTACATCCCGAGCCTGGACCGGATAGACAAGAAC
Apis_mellifera|28392               ---------CGGATGGAGGTTCTGATCGGTATCAGGAGAATAGAACGTCTTGACAAGGAT
Branchiostoma_floridae|38368       ---------CGAATCGAGGTTCTGATCGCTCTGCGGAGAATCGAGCGGCTGGACAAGGAC
Nematostella_vectensis|15350       ---------CGTATTGAGGTGCTGATTGCTCTGCGCCGACTGGAAAGACTGGACAAGGAT
Xenopus_tropicalis|24367           ---------CGCATGGAGACTCTAATCGCCCTACCCCAGCTAGAGCGCCTCGATAAGGAT
Taeniopygia_guttata|819            ---------CGCCTGGAGGTCCTGTCCCGGCTGCCACAGCTGCAGCGCCTCGACAAGGAA
Gallus_gallus|1428                 ---------CAGCAGGAGGTCCTGGTCCAGCTGCCACACCTGAAGCGTCTCGACAAGGAA
Spermophilus_tridecemlineatus|4123 ---------CGTCAGGAGGCCCTGGTACAGATGGCACACCTGGAGCGTCTGGACAAGGAT
Vicugna_pacos|3688                 ------------------------------------------------------------
Anolis_carolinensis|6601           ---------CGGATAGAAGTCCTGGTCCAGTTGCCACGCCTGGAACGCCTTGATAAGGAT
Dasypus_novemcinctus|15139         ---------CGGCAGGAAGCCTTGGTGCAGATTGCGCACCTGGAACGCCTGGACAAGGAC
Ornithorhynchus_anatinus|2233      ---------CGGGTAGAGGCCTTGGTGCACGTGCCGCACCTCGAGCGGCTCGACAAGGAC
Echinops_telfairi|7775             ---------CGCCAGGAGGCCTTGGTGCAGATGGCACACCTCGAACGGCTGGACAAGGAG
Macropus_eugenii|201               ------------------------------------------------------------
Monodelphis_domestica|30721        ---------AGGCAAGAAACCCTTGTACAGCTACCCCAACTGGAACGCCTGGACAAGGAT
Dipodomys_ordii|4254               ---------CGCCAGGAGGCCCTGGTGCAGATCGCGCACCTGGAGCGGCTGGACAAGGAC
Otolemur_garnettii|11355           ---------CGCCAGGAGGCCCTTGTGCAGATGGCACAGCTTGAACGCCTTGACAAGGAC
Pteropus_vampyrus|9290             ------------------------------------------------------------
Ochotona_princeps|14676            ---------CGTCAGGAGGCCCTGGTACAGATCGCACACCTCGAACGCCTGGACAAGGAC
Choloepus_hoffmanni|2895           ---------CGCCAGGAAGCCCTGGTGCAGAATGCACACCTCGAACGGCTAGACAAGGAC
Tupaia_belangeri|15677             ---------CGCCAGGAGGCCCTGGTGCAGATGGTGCACCTGGAACGCCTGGACAAAGAG
Erinaceus_europaeus|8425           ---------CGCCAAGATGCTCTGGTGCAGATAGCACAACTCGAACGCCTAGATAAGGGA
Sorex_araneus|14189                ---------CGCCAGGAGGCCCTGGTGCAGATGGCGCACCTCGAGCGCCTGGACAAGGAC
Cavia_porcellus|2245               ---------CGCCAGGAGGCTCTGGTGCAGATGCCACACCTTGAGCGTCTGGACAAGGAG
Mus_musculus|36626                 ---------CGCCAGGAGGCCCTGGTGCAGATGGCGCACCTTGAGCGCCTGGACAAAGAA
Rattus_norvegicus|26096            ---------CGCCAGGAGGCCCTGGTGCAGATGGCACACCTAGAGCGCCTAGACAAAGAG
Canis_familiaris|16139             ---------CGCCAGGAGGCCCTGGTGCAGATAGCACACCTCGAACGCCTGGATAAAGAT
Myotis_lucifugus|13983             ------------------------------------------------------------
Rhesus_macaque|6876                ------------------------------------------------------------
Callithrix_jacchus|23988           ---------CGCCAGGAGGCCCTGGTGCAGATGCCATACCTCGAACGTCTAGACAAGGGA
Homo_sapiens|20388                 ---------ggcactgtcctgggggtcaggatgcctgctttc------------------
Pongo_abelii|5936                  ---------CGCCAGGAGGCCCTGGTGCAGATGCCATACCTTGAACGCCTGGACAAGGAA
Gorilla_gorilla|13817              ---------CGCCAGGAGGCCCTGGTGCAGATGCCATACCTTGAACGCCTGGACAAGGAA
Pan_troglodytes|8455               ---------CGCCAGGAGGCCCTGGTGCAGATGCCATACCTTGAACGCCTGGACAAGGAA
Tursiops_truncatus|8452            ---------CGCCGGGAGGCCCTGGTGCAGGTG---------------------------
Oryctolagus_cuniculus|18422        ---------CGCCAGGAGGCCCTGGTGCAGATAGCGCATCTTGAACGCTTGGACAAGGAC
Microcebus_murinus|1893            ---------CGCCAGGAGGCCCTGGTGCAGATGGCACACCTTGAACGCCTGGACAAGGAC
Sus_scrofa|14893                   ---------CGCCAGGAGGCCCTGGTGCAGTTGGCACACCTCGAGCGCCTGGACAAGGAC
Bos_taurus|21080                   ---------CGCCAGGAAGCCCTGGTGCAGATTGCTCATCTGGAGCGCCTGGACAAGGAA
Equus_caballus|22814               ---------CGCCAGGAGGCCCTGGTGCAGATGGCACACCTCGAACGCCTGGACAAGGAC
Loxodonta_africana|6625            ---------CGCCAGGAGGCCCTGGTGCAGATGGCACACCTTGAACGGCTGGACAAGGAC
Procavia_capensis|12919            ---------CGCCAGGAGGCCTTGGTGCAAATGGCACACCTTGAACGGCTAGACAAAGAT
Tribolium_castaneum|13568          ---------GTGATTCCACTCTTGGTGTTGTTACCAAAGCTAAAGAGGATTAATAAAACG
Apis_mellifera|27901               ---------AGGCATATTATCTTGGCAATGTTGCCGAATTTGACGCGAATCGACAAGGAT
Pogonomyrmex_barbatus|4965         ---------AGATACATCATTCTGACAATTCTACCGAAACTAAAGAGGATCGATAAAGAT
                                                                                               

Bombyx_mori|12726                  GTGGTCACACCTGAAGAGAGAGCCGAAGCGAAAGAATTAATAACGCAATGGATCGAAGAT
Pediculus_humanus|1874             ATCGTAACGGAAACGGAAAGACAAATGATGAGAGAAATGATTGAA---------------
Danio_rerio|18816                  CCCGTCACACCTGAAGAAAAATTTGAGGCACAA---------------------------
Gasterosteus_aculeatus|19193       CCCGTCTCCCCAGAGGAGAGGGTCGAGGCCCGTGAGAGA---------------------
Branchiostoma_floridae|25776       CCCATCTCGGAGGAGGACCGCAGCGAGGCCGAGGCGTTGGCCGAGCTTCGCCGCCAGGAG
Apis_mellifera|28392               GACTACAACGAGGAAGAGAGGCAGGAGGCAGAAGAGATCTACGAGACGAGGAGAGCG---
Branchiostoma_floridae|38368       GAGTACACGGAGGACGAACGGCAGGAGGCCGAGGAAATCTACGAGCAGAGGAGACAGGAG
Nematostella_vectensis|15350       GAGTACACCGAGGATGAACGACAGGAAGCCGAGGAGATCTATAATCAACGGCAAGAGGAA
Xenopus_tropicalis|24367           TTTTTTGAAGAGGAGGAGAAAAGGGAGGCCGCAGAGACCAAGAAAGCAAGGGAGGAG---
Taeniopygia_guttata|819            TCGATCGAGGAAGAGGAGAGGGAAGAGGCTGAGAAAATCTGTCAGGCAAGGAAGGAA---
Gallus_gallus|1428                 CCAGTT---GAGCAAAATCATGCAGAGGCAAATGAAATCTGTAAA---AGGCAGGAA---
Spermophilus_tridecemlineatus|4123 TTCTATGAGGAGGAAGAGCGGATTGAGGCTGATGAGATCCGTCAGAGGATCAAGGAG---
Vicugna_pacos|3688                 ------------------------------------------------------------
Anolis_carolinensis|6601           TTCTTTGAGGAAGACGAACGGGCTGAAGCTGAAGATATACGTCAGCGGCGGAAGGAA---
Dasypus_novemcinctus|15139         TTCTACGAGGAGGAGGAGCGGGCTGAGGCCGAGGAGATCCGTCAGAGGCTGAAGGAG---
Ornithorhynchus_anatinus|2233      TTCTACGACGAGGAGGAGCGGGCCGAGGCCGACGAGACCCGCCAGCGGCTGCGGGAG---
Echinops_telfairi|7775             ATCTTTGAGGAGGAGGAGCGGGTGGAGGCCGAGGAGATGCGCCAGAGGCTAAGGGAA---
Macropus_eugenii|201               ------------------------------------------------------------
Monodelphis_domestica|30721        TTCTATGAGGAGGAAGAACGGGCTGAGGCTGATGAAATTAGACAGAGGTTAAAGGAAGAA
Dipodomys_ordii|4254               TTCTACGAGGAGGAGGAGCGCGCCGACGCCGACGAGGTGCGCCAGCGGCTGAAGGAG---
Otolemur_garnettii|11355           TACTTTGAGGAGGAGGAGCGGGCTGAAGCCAGTGAGATCCGTCAGAGGCTGAAAGAA---
Pteropus_vampyrus|9290             ------------------------------------------------------------
Ochotona_princeps|14676            TTCTTTGAGGAGGAGGAGCAGGCTGAGGCTGAGGAAATCCGCCAGCGGCTGAAGGAGGAG
Choloepus_hoffmanni|2895           TTCTACGAGGAGGAGGAACGAGCTGAGGCCGAAGAGATCCGTAATAGGCTGAAGGAAGAG
Tupaia_belangeri|15677             TTCTATGAGGAGGAAGAGCGGGCTGAGGCTGAGGAGATCCGCCAGAGGCTGAAGGAG---
Erinaceus_europaeus|8425           TTCTATGACGACGATGAGCGGGCTGAGGCCGAGGAGGCCCGTCAGAGGATCGGAGAA---
Sorex_araneus|14189                TTCTACGAGGAGGAGGAGCGGCTGGAGGCCGACGAGATCCGTCAGAGGCTACGGGAGGAG
Cavia_porcellus|2245               TTCTACGAGGAAGAGGAAAGGGCTGAGGCTGATGAGATCCGTCAGAGGATAAAAGAT---
Mus_musculus|36626                 TTCTATGAGGATGATGACCGGGCAGAGGCCGAGGAGATCCGTCAGAGGCTGAAGGAG---
Rattus_norvegicus|26096            TACTATGAGGACGAGGACCGGGCAGAAGCTGAGGAGATCCGACAGAGGCTGAAGGAG---
Canis_familiaris|16139             TTCTATGAAGAGGAGGAGCGGGCCGATGCTGATGAGATCCGTCAGAGGTTGAAGGAG---
Myotis_lucifugus|13983             ------------------------------------------------------------
Rhesus_macaque|6876                ------------------------------------------------------------
Callithrix_jacchus|23988           TTCTATGAGGAGGAGGAACAGGCTGAGGCTGATGAGATTCGGCGGAGGCTGAAGGAA---
Homo_sapiens|20388                 ------------------------------------------------------------
Pongo_abelii|5936                  TTCTATGAGGAGGAGGAACGGGCTGAGGCTGATGAGATTCGACAGAGGCTGAAGGAA---
Gorilla_gorilla|13817              TTCTATGAGGAGGAGGAACGGGCTGAGGCTGATGAGATTCGACAGAGGCTGAAGGAA---
Pan_troglodytes|8455               TTCTATGAGGAGGAGGAACGGGCTGAGGCTGATGAGATTCGACAGAGGCTGAAGGAA---
Tursiops_truncatus|8452            ------------------------------------------------------------
Oryctolagus_cuniculus|18422        TTCTTTGAGGAGGAGGAGCAGGCTGAGGCTGAGGAAATCCGCCAGAGGCTGAAGGAG---
Microcebus_murinus|1893            TTCTATGAGGAAGAGGAGCGGGTTGAGGCCAATGAGATCCGTCAGAGGCTGAAGGAG---
Sus_scrofa|14893                   TTCTATGAGGAGGAGGAGCGGGCTGAGGCCGATGAGATCCGGCAGAGGATGAAGGAG---
Bos_taurus|21080                   TTCTATGAGGAGGAGGAGCGGGCTGAGGCCGATGAGATCCGGCAGAGGATGAAGGAG---
Equus_caballus|22814               TTCTTCGAGGAGGAGGAGCGGGCTGAGGCCGATGAGATCCGTCAGAGGATGAAGGAGGAG
Loxodonta_africana|6625            TTCTATGAGGAGGAGGAGCGGGCTGAGGCTGATGAGATCCGTCAGAGGTTGAAGGAG---
Procavia_capensis|12919            TTCTATGAGGAAGAGGAGCGGGCTGAGGCTGATGAGATCCGTCAGAGAATGAAGGAG---
Tribolium_castaneum|13568          GTGATTACAATGGAGGATAGGATTGATGCTGAGGATATGGAGAATGATGTTATAGAGGCA
Apis_mellifera|27901               CCAGTGCTATACGATGAAAGGAAGGAGGCTAAAGAGTTTCGTAGACAAATGTTTCTA---
Pogonomyrmex_barbatus|4965         CCTGTACTGGATTTTGAGAGGAACGAGACTGTATATTTACAAAGAAAATTCTACTTT---
                                                                                               

Bombyx_mori|12726                  GGT---------GCTGCAGACGAGGAAGCTGAAGAAGAACAACAACCCGAGGAGCACGAC
Pediculus_humanus|1874             ---------------GATGAGGAAGAGGAAGAAGAA------------------------
Danio_rerio|18816                  ---------------AAAAAGGAGTTTGAAGATGACAATGCTGAAGATCAAGAGGACGAC
Gasterosteus_aculeatus|19193       ------------------------------------------------------------
Branchiostoma_floridae|25776       TTA---------TCGAGCTCGGACTCGCTGGCTCATCTTCCGCACGAACAAATGTTCTCT
Apis_mellifera|28392               ---------------GAAGAGCTGGCTGCCGGAGAGGTATGT------------------
Branchiostoma_floridae|38368       GAG------------CAGCCTCCGGAGGGTGCAGAAGAAGTGATAGAGGATCAGGATGAT
Nematostella_vectensis|15350       GAG---------CTTGCAGCTCAGCAAGGAGGGCATGAAATCATCCATACAGACGAAGAT
Xenopus_tropicalis|24367           ---------------------GAGGAGATGGCTGAGCCTGGAGAGAAGGGAAAC------
Taeniopygia_guttata|819            ---------------AAAGAAAAGCAGCAGCCTGAGGCCAAAAGGCCTCCAGAGCCC---
Gallus_gallus|1428                 ---------------AATGAAAAG------------------------------------
Spermophilus_tridecemlineatus|4123 ---------------GAACAGGAGCAGGAAGCTGAGCCTGAGCATGACTTGGAACTGGAC
Vicugna_pacos|3688                 ---------------------------------------------AAAGTGGAACTTGAG
Anolis_carolinensis|6601           ------------------GAAGAATTGGAACTAGAGAGAGAAAGAGAGCAAGAAAAGGAA
Dasypus_novemcinctus|15139         ---------------GAGCAGGAGCACGAGCCTGAG---CAGCACTACCAGGACGTGGAC
Ornithorhynchus_anatinus|2233      ---------------GAGCAGgAGCGTGACCTTCCCCCTGGTCCTTCAGGAGATAGAGAG
Echinops_telfairi|7775             ---------------------------------GAGCAGGAGCGCGAAGCTGACCAGGAT
Macropus_eugenii|201               ------------------------------------------------------------
Monodelphis_domestica|30721        CAAGAGATTGATCTAGATCAAGACCTATCTCCAGATCCAGAAAAGGAAGTGAGCAAAGAG
Dipodomys_ordii|4254               ---------------GAGCTGGAGCAGGAGGCGGACACGGAGAACGATCTGGAGCAC---
Otolemur_garnettii|11355           ---------------GACCAGGAGCAGGAGGCTGAGCCTGAGCATGACCCGGAGCAGGAC
Pteropus_vampyrus|9290             ------------------------------------------------------------
Ochotona_princeps|14676            CAG------------GAGCAGGAGCAGGAGGCTGAGCAGGGGCAGAACCCGGATCAGGAC
Choloepus_hoffmanni|2895           CAGGAGCAG------GAGCCTGAGCCCGAGCCCGAGCCCAAGCACTACCAAGACCTGGAC
Tupaia_belangeri|15677             ---------------GAGCAGGAACAGGATGGCGAGATGGAGCACGACCTGGAACCCATC
Erinaceus_europaeus|8425           ------------------CAGGAGCAGGAAGCTGAATCTGACCATGATGTGGTACTGGAC
Sorex_araneus|14189                CCC------------GAGATGGAACAGGACGTCGAGCAGGAGCACGAAACTGCATCCCAC
Cavia_porcellus|2245               ---------------GAACAGGAGCAGGAGCCTGAGCCTGAGCATGACCTGGACCCAGAC
Mus_musculus|36626                 ---------------GAACAGGATCAAGATCTCGATCCGGACCAGGACATGGAACCGTAC
Rattus_norvegicus|26096            ---------------GAACAGGAGCAAGAACTCGACCCGGACCAAGACATGGAACCGTAC
Canis_familiaris|16139             ---------------ACCCAGGAGCAGGAGGCTGAGGTTGAGCATGACTCAGAACTGGAG
Myotis_lucifugus|13983             ------------------------------------------------------------
Rhesus_macaque|6876                ------------------------------------------------------------
Callithrix_jacchus|23988           ---------------------AATCAGGAGCAGGAGCCCCAGCGTGATCTGGAACCCGAA
Homo_sapiens|20388                 ------------------------------------------------------------
Pongo_abelii|5936                  ---------------GAAAAGGAGCAGGAGCCTGAGCCCGAGCGTGACCTGGAACTGGAA
Gorilla_gorilla|13817              ---------------GAAAAGGAGCAGGAGCCTGAGCCCGAGCGTGACCTGGAACCCGAA
Pan_troglodytes|8455               ---------------GAAAAGGAGCAGGAGCCTGAGCCCCAGCGTGACCTGGAACCCGAA
Tursiops_truncatus|8452            ------------------------------------------------------------
Oryctolagus_cuniculus|18422        ---------------GAACGCGAGCAGGAGGCTGAGCAGGAGCACAGCCTGGATCTAGAC
Microcebus_murinus|1893            ---------------GACCAGGAGCAGGAGGTTGATCCTGAGCATGATATGGAATCAGAC
Sus_scrofa|14893                   ---------------GAGCAGGAGCAGGAGGCTGAGCCCGAGGCTGAATCGGAACTGGAC
Bos_taurus|21080                   ---------------GAGCAGGAGCAGGAGGCTGAGGTCGAGCCTGAGTCAGAACTGGAC
Equus_caballus|22814               CAG------------GATCAGGAGCAGGAGGCTGAGCCCGAGCATGACTTGGAATTGGAC
Loxodonta_africana|6625            ---------------GACCAGGAGCATCAGGCTGAGCCTGATCACGAGGAAGACCTGGAC
Procavia_capensis|12919            ---------------GACCAGGAGCACAAGTCTGAGCAAGGCCATGGGGAAGACCTGGAC
Tribolium_castaneum|13568          TTG---------TTGAGGGATGATGAGACGGCTCAAGACACAGATAGGGAGACGACGACT
Apis_mellifera|27901               ---------------------------GACGGGACAACCTTCGCTGATCTGGATTATAAT
Pogonomyrmex_barbatus|4965         ---------------------------------AAATTCAGATACGAATTG---------
                                                                                               

Bombyx_mori|12726                  AATGATGATGAT---------------------TGA
Pediculus_humanus|1874             ---------------------------------TAA
Danio_rerio|18816                  ---------------------------------TGA
Gasterosteus_aculeatus|19193       ------------------------------------
Branchiostoma_floridae|25776       TCTGCCAGCTCAGAGTTCAGCTCAGATATGATGTAG
Apis_mellifera|28392               ---------------------------------TAA
Branchiostoma_floridae|38368       GCAGATGCAGAC---------------------TGA
Nematostella_vectensis|15350       GAT------------------------------TAG
Xenopus_tropicalis|24367           ---------------------------------TAA
Taeniopygia_guttata|819            ------------------------------------
Gallus_gallus|1428                 ------------------------------------
Spermophilus_tridecemlineatus|4123 CAGCCATTGGTC---------------------TAG
Vicugna_pacos|3688                 AACAGCCTCACT------------------------
Anolis_carolinensis|6601           CAAGAA------------------------------
Dasypus_novemcinctus|15139         CACCCATCGACC---------------------TAG
Ornithorhynchus_anatinus|2233      CATCCAGGAGGTGTCAGC------------------
Echinops_telfairi|7775             GGACCCACCTGT------------------------
Macropus_eugenii|201               ------------------------------------
Monodelphis_domestica|30721        CAGGCAGGGGTG------------------------
Dipodomys_ordii|4254               ------------------------------------
Otolemur_garnettii|11355           CAGGAAGTGATG---------------------TAG
Pteropus_vampyrus|9290             ------------------------------------
Ochotona_princeps|14676            CCTGCGCTGCAG---------------------TAG
Choloepus_hoffmanni|2895           CAGACATTGGCT---------------------TAG
Tupaia_belangeri|15677             CAGCCATTGCCT---------------------TAG
Erinaceus_europaeus|8425           GCTCTGCTC---------------------------
Sorex_araneus|14189                CCGCCGGCC---------------------------
Cavia_porcellus|2245               CAGTCATCCATG---------------------TAG
Mus_musculus|36626                 TTGCCACCAGTT---------------------TAG
Rattus_norvegicus|26096            CTCCCGCCAACT---------------------TAG
Canis_familiaris|16139             CAGACATCTATG---------------------TAG
Myotis_lucifugus|13983             ------------------------------------
Rhesus_macaque|6876                ---------------------------------C--
Callithrix_jacchus|23988           CAGTCATTGATCTAT---------------------
Homo_sapiens|20388                 ---------------------------------tag
Pongo_abelii|5936                  CAGTCATTGATC------------------------
Gorilla_gorilla|13817              CAGTCATTGATC---------------------TAG
Pan_troglodytes|8455               CAGTCATTGATC---------------------TAG
Tursiops_truncatus|8452            ------------------------------------
Oryctolagus_cuniculus|18422        CAGGCCCCCATG---------------------TAG
Microcebus_murinus|1893            CACCCATTGACGTAC---------------------
Sus_scrofa|14893                   CAGTCATCCATC------------------------
Bos_taurus|21080                   CAGTCATCCACC---------------------TAG
Equus_caballus|22814               CAACCATCGACC---------------------TAG
Loxodonta_africana|6625            CAGTCA------------------------------
Procavia_capensis|12919            CAGTCAACTAAC---------------------TAG
Tribolium_castaneum|13568          ACGGATTATAAGCAAGAGTCGGATTTGGATGGGTGA
Apis_mellifera|27901               TTCTTGGCTGGA---------------------TGA
Pogonomyrmex_barbatus|4965         ---------------------------------TAA
                                                                       

multiple sequence alignment in CLUSTALW format


Bombyx_mori|2782                   -------MLKSHFDIHKD-----DDVEEEFEHE------AVSHAHEEEEEHALPE-----
Pediculus_humanus|1825             MTRLLLEKVVPYEH---------KSLTLKKAGE------CLGILGKIWNLSEHSSAAAAT
Danio_rerio|6052                   --------MS-------------DSGEDEVLKA------DSDHEGENEDLEEKEKSD---
Gasterosteus_aculeatus|12657       --------MSEMDE---------DAVLSDVEGE-------------EEEAAHQQEAEE--
Branchiostoma_floridae|22845       ------------------------------------------------------------
Apis_mellifera|3375                ------------------------------------------------------------
Branchiostoma_floridae|9256        --------MSDASDFEGDE----GGEEPPMESGE-----EGDAPQDEDEDVEKEEGEDEG
Nematostella_vectensis|23957       --------MSDFEDE--------EGVDEPVM--------DDENEEEDQD-----------
Xenopus_tropicalis|3131            MEDETLEDGPEEEEEDEEEGTAEETNQDVTERD------EEEEAEKDEEEDKEEEEEAEK
Taeniopygia_guttata|17784          ------------------------------------------------------------
Gallus_gallus|16851                ---------------------------------------------------------SLP
Spermophilus_tridecemlineatus|3700 --------MSDEDDL-DDFEPESEPDQEDLEKE------EDEKETEEWE-DYKKEGEEFS
Vicugna_pacos|3441                 --------MSDE-DL-EDF----EPDLDDLERE------DDEKETEEWE-DYKKEGEDFL
Anolis_carolinensis|5415           ---------EDDNDIEEEE----EDTEDKAEKE------EGGEDEKE---AGEEEEEEEE
Dasypus_novemcinctus|13381         --------MSDEDDL-EEX----XXXXXXXXXX------XXXXXXXXXXXXXXXXXXXXX
Ornithorhynchus_anatinus|5399      ------------------------------------------------------------
Echinops_telfairi|6149             --------MSDEEDV-EYF----EA-LDDPERY------DYEKETEEGE-DYRKDGEDLS
Macropus_eugenii|183               --------MSDEEDL-EEY----DPDQDEPEEE------GEDKDEEEEE---EKEGGEEV
Monodelphis_domestica|7956         ------------------------------------------------------------
Dipodomys_ordii|3984               ------------------------------------------------------------
Otolemur_garnettii|9765            --------MSDDDDL-DDF----EPDQDDSEKD------DDEKETEEWEDD--RKGEEYS
Pteropus_vampyrus|8756             --------MSDEDDL-EDF----EPDQDDLEKE------DDEKETEEGE-DDRKEMEDFS
Ochotona_princeps|12797            --------MSDEDDL-EDF----EPDQEDFEKD------DDEKETEEWE-DYRKEGEELS
Choloepus_hoffmanni|2556           ---------SDEDDL-EDF----EPDQDDLEKE------DDEKETEEGE-EDRKEREEFS
Tupaia_belangeri|13626             ------------------------------------------------------------
Erinaceus_europaeus|6919           ---------TDEEDL-EDS----GPDQDDLDKE------DDDQETEEWD-ELGKE-EEVS
Sorex_araneus|12623                ------------------------------------------------------------
Cavia_porcellus|1747               --------MSDEDDQ-DDT----EPEQDDLEK-------EDDKDTEEWE-DYKKEGEDLS
Mus_musculus|41172                 --------MSDEDDV-DDV----DAEQDEV---------ESDKEIEEWE-DYRKETEEAS
Rattus_norvegicus|8204             --------MSDEDDVEDDF----DQEPDEVEKE------EDDNEMEDWEDDYRKEGEEVS
Canis_familiaris|4971              --------MSDE-DL-EDF----EPDQDDLLRG------SESMKSWNWW-GPKAKGWGWA
Myotis_lucifugus|12558             --------MSDEDDL-EDF----EPDQDDLERE------DDEKDTEDWE-DDRKEEEDLS
Rhesus_macaque|3691                --------MSDEDDL-EDF----EPDQDDFEKE------EDEKETEEGE-DYRKEGEEFP
Callithrix_jacchus|16211           --------MSDEDDL-EDF----ELDQDDFEKE------EDEKETEEEE-DYRKEGEEFP
Homo_sapiens|59396                 --------MSDEDDL-EDS----EPDQDDSEKE------EDEKETEEGE-DYRKEGEEFP
Pongo_abelii|21089                 --------MSDEDDL-ADS----EPDQDDSEKE------EDEKETEEGE-DYRKEGEEFP
Gorilla_gorilla|11281              --------MSDEDDL-EDS----EPDQDDSEKE------EDEKETEEGE-DYRKEGEEFP
Pan_troglodytes|9509               --------MSDEDDL-EDS----EPDQDDSEKE------EDEKETEEGE-DYRKEGEEFP
Tursiops_truncatus|7978            --------MSDEDDL-EDF----ESNLDGLERE------DDEKETEEWE-DHRKEGEDS-
Oryctolagus_cuniculus|4256         --------MSDEEDL-EDF----EPDQDDLDKE------DDEKETEEWE-DYRKEGEEFS
Microcebus_murinus|1609            --------MSDEDDL-DDF----DPDQDDLERE------DDEKDTEDWE-DYRKEGDEYS
Sus_scrofa|724                     --------MSDEEDL-EDF----EPDLDDLERE------DDEKEIEEWE-DYRKEGEEES
Bos_taurus|12241                   --------MSDEDDL-EDF----ETDQDDLERE------DDEKETEEWE-DYRKEGEESE
Equus_caballus|346                 --------MSDEDDL-EDF----EPDPDDLEKE------DDEKETEEWE-DYRKEGEELP
Loxodonta_africana|16680           --------MSDEDDL-EDF----EPDQDDLEKD------EDEKETEEGE-DYRKEGEDFT
Procavia_capensis|12089            --------MSDEDDL-EDF----ELYQDDLEK-------EDEEETEEGE-EYRREEEEFT
Tribolium_castaneum|15720          --------MG------EDFGEGGPPVPGEGVRQ------------------FRPPTAPSI
Apis_mellifera|3250                --MSSMWRPEDYERHRSNVRKATRAIDVDPPKSRPHVVLNAKGMQLEREKQYRIMRENFI
Pogonomyrmex_barbatus|13322        --------MEE------------ESYEQKTEEK------LAERVIFDEEDQFKYESTISL
                                                                                               

Bombyx_mori|2782                   -----------VISGPVRKLNRSEVSVR-LGLLGKTAEADGYTYLKATCTDMNLTDITAI
Pediculus_humanus|1825             T----------TTNPNVFPLNELCDKESECKLMDMEGYVDDYQYLHMEAKDMCLTDVTIL
Danio_rerio|6052                   -----------GDQLESCPLTQDILARS-LSLLCRTGNGLSHAYVRLDLKNKGLTDLALL
Gasterosteus_aculeatus|12657       -----------NEKVEVCHLTKETISRG-LSLLCRTGNGLGHAFVKVNLKDNGLDDIAAI
Branchiostoma_floridae|22845       -----------------------------MNIIVTT------------IYYRDLTDISVL
Apis_mellifera|3375                ------------------------------------------------------------
Branchiostoma_floridae|9256        EGVQVEDQQEEEEKLPEHPLTEEMLGDC-LSLLCKTGNGLAHAYVRLDIHEREITDISIL
Nematostella_vectensis|23957       -----------DEKPPENPLTEEMLADS-LSLLCKTGNGLAHAYVRLDIHDKELTDISVL
Xenopus_tropicalis|3131            -----------EEPPPHMPLSEEMLRDG-LSLLCKTGNGLAHAYVKLEVKERELTDISVL
Taeniopygia_guttata|17784          ---------------------------------------------------RGLTDISLL
Gallus_gallus|16851                -----------QVLVAC-PLTEEMLKEG-LSLLCKIGNGLAHAYVKFEAKYKDLTDISLL
Spermophilus_tridecemlineatus|3700 -----------EEWMPV-PLTENMXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Vicugna_pacos|3441                 -----------EEWMPX-XXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Anolis_carolinensis|5415           -----------EHPIST-PLTEDMMKEG-LSLLCKTGNGLAHAFVKLEVREKELTDITLI
Dasypus_novemcinctus|13381         -----------XXXXXX-XXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXDLTDIHLL
Ornithorhynchus_anatinus|5399      ---------------------------------------------------RELTDITLL
Echinops_telfairi|6149             -----------EEWIPN-SLS-DLMKES-LSMLCKTGNGLAHAYVKLEVKGRDLTDIILL
Macropus_eugenii|183               -----------EEFLSN-PITEDTMKEG-LSLLCKTGNGLSHAYVKLEAKDKELTDISLL
Monodelphis_domestica|7956         --------------LPN-PLTEEVMKEG-LSLLCKIGNGLSHAYVKLEAKEKDLSDISLL
Dipodomys_ordii|3984               --------------------------------------------------DRDLTDISLL
Otolemur_garnettii|9765            -----------EEWLPT--PTEEMMKEG-LSLLCKTGNGLAHAYVKLEVKERDLTDISLL
Pteropus_vampyrus|8756             -----------EEWMPN-PLTEDMMKEG-LSLLCKTGSGLAHAYVKLEVKERDLTDIYLL
Ochotona_princeps|12797            -----------EDWAPT-PLTEYVMKEG-LSLLCKTGSGLAHAYVKLEIKERDLTDISLL
Choloepus_hoffmanni|2556           -----------EEWLPN-PLTEDMMKDG-LSLLCKTSSGLAHAYVKLEVRERDLTDIYLL
Tupaia_belangeri|13626             ------------------------------------------------------------
Erinaceus_europaeus|6919           -----------EEWVPT-PLTEDMMKEG-LSLLCKTGTGLAHAYVKLEVKDXELTDI-LL
Sorex_araneus|12623                -----------EEWVPT-PLSEDMMKEG-LSMLCKTGSGLAHAFVRLEVKDRELTDVSLL
Cavia_porcellus|1747               -----------EEWPPT-PLTEEMMKEG-LSMLCKTGNGLAHAYVKLDLKDRDLTDISLL
Mus_musculus|41172                 -----------EEWLPT-PITEAMMKEG-LSLLCKIGSGLAHAYIKLEAKDRDLTDISLL
Rattus_norvegicus|8204             -----------EEWLPT-PLTEAMMKEG-LSLLCKIGSGLAHAYIKLEVKDRDLTDISLL
Canis_familiaris|4971              -----------GRWMPT-PLTEDMLKEG-LSLLCKTGNGLAHAYVKLEVKERDLTDIYLL
Myotis_lucifugus|12558             -----------EEWMPT-PLTEDMMKEG-LSLLCKTGNGLAHAYVKLEVKERELTDIQLL
Rhesus_macaque|3691                -----------EEWLPT-PLTEDMMKEG-LSLLCKTGSGLAHAYVKLEVKERDLTDIYLL
Callithrix_jacchus|16211           -----------EEWLPN-PLTEDMMKEG-LSLLCKTGSGLAHAYVKLEVKERDLTDIYLL
Homo_sapiens|59396                 -----------EEWLPT-PLTEDMMKEG-LSLLCKTGNGLAHAYVKLEVKERDLTDIYLL
Pongo_abelii|21089                 -----------EEWLPN-PLTEDMMKEG-LSLLCKTGNGLAHAYVKLEVKERDLTDIYLL
Gorilla_gorilla|11281              -----------EEWLPT-PLTEDMMKEG-LSLLCKTGNGLAHAYVKLEVKERDLTDIYLL
Pan_troglodytes|9509               -----------EEWLPT-PLTEDMMKEG-LSLLCKTGNGLAHAYVKLEVKERDLTDIYLL
Tursiops_truncatus|7978            -----------EEWMST-PLTEDMVKEG-LSALCKTGNGLAHAYVKLVVKDRDLTDIHLL
Oryctolagus_cuniculus|4256         -----------EEWLPT-PLTEAVVKEG-LSLLCKTGSGLAHAYVKLEVKERDLTDISLL
Microcebus_murinus|1609            -----------EEWMPT-PLTEDMAKEG-LSLLCKTGNGLAHAYVKLEVKERDLTDISLL
Sus_scrofa|724                     -----------EEWVST-PLTEDMMKEG-LSLLCKTGNGLAHAYVKLEVKDRDLTDIYLL
Bos_taurus|12241                   -----------DQWIST-PLTEDMMKEG-LSLLCKTGNGLAHAYVKLEIKDRDLTDIHLL
Equus_caballus|346                 -----------EEWMPS-PLTEDMMKEG-LSLLCKTGSGLAHAYVKLELKERDLTDIYLL
Loxodonta_africana|16680           -----------EDWMPN-ALTEDLMKEG-LSLLCKTGNGLAHAYVKLEVKDRDLTDISLL
Procavia_capensis|12089            -----------EDWMPN-ALTEELMKEG-LSLLCKTGNGLAHAYVKLELKERDLTDISLL
Tribolium_castaneum|15720          -----------PEVIKEKILTFEEASKC-LNTLGKDETGSRYAYLMITATNRKLTDVSII
Apis_mellifera|3250                LLKKLRDIMNRKKPDVTKALTQTEAGEC-LHTLGKCESGLGYAYLGLNASNRGLTDIKII
Pogonomyrmex_barbatus|13322        ---------DETEQNKLRVLTHNEAGEC-LHTLGKCIALHEYAYLSLDASDRDLTDINVI
                                                                                               

Bombyx_mori|2782                   -KYFKHLQFVDVSNNKLDLEALQAVTELPHLLLIHADKNILRS-GA--LKKMKYLQVIIM
Pediculus_humanus|1825             PKYFVWLLSVDLSGNLLTNETSCPVTKLPNIVALKLNRNNFND-PY--MPPMKHLQYLGL
Danio_rerio|6052                   -SSYIHLRYLDLSSNHLSD--FSPLAGLTQLLWVKGDSNLLQGFEGQPFGQLTFLQWLSI
Gasterosteus_aculeatus|12657       -ASFTHLRFLDVSNNHLID--LSPLASLTQLLWLKVDKNAVETLKGQPFPQLIYLQWLSV
Branchiostoma_floridae|22845       -KDLVHVRYLDLSGNRLTD--LSPLNKMDHLLWLKVDRNALTK-IN--LTERLFLQVASF
Apis_mellifera|3375                ------------------------------------------------------------
Branchiostoma_floridae|9256        -KSFIHLRYVDVSANLLRD--VSALNSLTHLLTLKADRNLLKT-AA--LDELPYLQMASF
Nematostella_vectensis|23957       -NCFIHLRYVDISGNSLKD--LSPLNSLTHLLTLKADRNALSS-AK--LDELPYLQIASF
Xenopus_tropicalis|3131            -QSFIHLRYVDLSQNSLQD--LSPLGALTHLLSLRADHNQLVSVSG--LGELPYLQVASF
Taeniopygia_guttata|17784          -EGFIHLRYVDLSKNKLKD--LAPLSSLTQLLWLKVDGNLLTS-AS--MQELPYLQVISF
Gallus_gallus|16851                -ECFIHLRYVDLSENKLQD--LSPLSSLTHLLWLKVDGNLLSS-AH--MQELPYLQFISF
Spermophilus_tridecemlineatus|3700 -XXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXX-XX--XXXXXXXXXXXX
Vicugna_pacos|3441                 -XXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXX-XX--XXXXXXXXXXXX
Anolis_carolinensis|5415           -QNFIHLRYVDLSDNLIRD--LSPLSSLNHLLWLKVDNNKLTS-AG--MDELLYLQSASF
Dasypus_novemcinctus|13381         -RTYIHLRYVDISENHLTD--LTPLNNLTHLLWLKADGNRLRS-AQ--LDELPYLQIASF
Ornithorhynchus_anatinus|5399      -SSYIHLRYVDVSENFLSD--LSPLNSLTHLLWLKADKNRLRT-AH--LEELPYLQIASF
Echinops_telfairi|6149             -RSYIHLRYVDVSENHLTD--LSPLNHLTHLLWLKADGNRLRT-AR--LNELXXXXXXXX
Macropus_eugenii|183               -SSYIHLRYVDLSGNRLTD--LSPLNNLTHLLWLKADHNRLQS-AQ--MSELPYLQIASF
Monodelphis_domestica|7956         -SSYIHLRYVDLSDNRLVD--LSPLNGLTHLLWLKVDNNRLIS-AR--LTELPYLQIASF
Dipodomys_ordii|3984               -RTYIHLRYVDISENHISD--LSPMNSLTHLLWLKADGNQLRS-AR--LNELPYLQMVSF
Otolemur_garnettii|9765            -RSYIHLRYVDVSENHLTD--LSPLNGLTHLLWLKADGNRLRT-AR--LNELPYLQIHSF
Pteropus_vampyrus|8756             -RSYIHLRYVDVSENHLTD--LSPLNYLTHLLWLKADSNRLRS-VQ--LNELPYLQIANF
Ochotona_princeps|12797            -RSYIHLRYVDISDNHVTD--LSPLNYLTHLLWLKADNNRLHS-AQ--LNELPYLQMASF
Choloepus_hoffmanni|2556           -RSYIHLRYVDISENHLTD--LSPLNYLTHLLWLKAEGNRLRS-AR--LDELPYLQIASF
Tupaia_belangeri|13626             ------------------------------------------------------------
Erinaceus_europaeus|6919           -RSYIHLRYVDISENHLTD--LTPLNYLTHLLWLKADNNQLRS-AR--MNVLPYLQIASF
Sorex_araneus|12623                -QSYIHLRYVDVSENHLAD--LSPLNHLTHLLWLKADNNQLRS-AR--LHELPYLQILSF
Cavia_porcellus|1747               -CSYIHLRYVDISENHLTD--LTPLNNLTHLLWLKADGNQLRS-AQ--LNELPYLQIASF
Mus_musculus|41172                 -RSYIHLRYVDISENHITD--ISPLNSLTHLLWLKADGNQLRS-AR--MNELPYLQIASF
Rattus_norvegicus|8204             -RSYIHLRYVDISENHITD--MSPLNSLTHLLWLKADGNQLRS-AR--LNELPYLQIASF
Canis_familiaris|4971              -RSYIHLRYVDVSENHLTD--LSPLNYLTHLLWLKADGNNLRS-AQ--LNELPYLQVASF
Myotis_lucifugus|12558             -RSYIHLRYVDISENHLTD--VSALNHLTHLLWLKADGNRLRS-AQ--LNELPYLQIASF
Rhesus_macaque|3691                -RSYIHLRYVDVSENHLTD--LSPLNYLTHLLWLKADGNRLRS-AQ--LNELPYLQIASF
Callithrix_jacchus|16211           -RSYIHLRYVDVSENHLTD--LSPLNHLTHLLWLKADGNRLRS-AQ--LNELPYLQTASF
Homo_sapiens|59396                 -RSYIHLRYVDISENHLTD--LSPLNYLTHLLWLKADGNRLRS-AQ--MNELPYLQIASF
Pongo_abelii|21089                 -RSYIHLRYVDISENHLTD--LLSTQLPHPLLWLKADGNRLRS-AQ--LNELPYLQIASF
Gorilla_gorilla|11281              -RSYIHLRYVDISENHLTD--LSPLNYLTHLLWLKADGNRLRS-AQ--LNELPYLQIASF
Pan_troglodytes|9509               -RSYIHLRYVDISENHLTD--LSPLNYLTHLLWLKADGNRLRS-AQ--MNELPYLQIASF
Tursiops_truncatus|7978            -RSYIHLRFVDVSRNHLTD--LSPLNCLTHLLWLKADGNRLRS-AR--LSELPYLQIASF
Oryctolagus_cuniculus|4256         -RSYIHLRYVDISENHLTD--LSPLNYLTHLLWLKADSNQLRS-VQ--LNELPYLQIASF
Microcebus_murinus|1609            -RSYIHLRYVDVSENHLTD--LSPLNHLTHLLWLKADANRLRS-AR--LSELPYLQIASF
Sus_scrofa|724                     -DSYIQLRYVDISENHLTD--LSPLNYLTHLLWLKADGNQLRS-AR--LNELPYLQIANF
Bos_taurus|12241                   -RSYIHLRYVDVSENHLTD--LSPLNHLTHLLWLKADGNQLRS-AR--LNELPYLQIASF
Equus_caballus|346                 -RSYIHLRYVDVSENHLTD--LYPLNYLTHLLWLKADGNRLRS-AQ--LNELPYLQIASF
Loxodonta_africana|16680           -RSYIHLRYVDVSENHLTD--LSPLNYLTHLLWLKADGNRLRS-AQ--LDELPYLQIASF
Procavia_capensis|12089            -RSYIHLRYVDISENHLTD--LSPLNNLTHLLWLKADGNGLRS-VR--LDELPYLQIASF
Tribolium_castaneum|15720          -LRFKHVLFLDLSGNYLTTDALTVLTEMPFLILLKAERNRVDS-AA--LKPMPYLQVLAL
Apis_mellifera|3250                -PMFKYVLYVNVSGNKLNNEALRVLSSMKYLLMLQADKNEVES-AE--LDPMPYLQVLTL
Pogonomyrmex_barbatus|13322        -LSFRHVRHVNVSGNRLTSEALRVLEAMPYLQTLRADRNCLIS-AE--LNSMPYLQELSL
                                                                                               

Bombyx_mori|2782                   NYNELTTVHDVFQPELSTLEVGYNKIRKIN-FDS-RMETIRCLDFRYNLIEDINGLNFPN
Pediculus_humanus|1825             NNNRIKSLHRIYHPNLETLDLNYNHVRDVDPRDCWKLPKLTQLELRGNLLQTTEGIQYQS
Danio_rerio|6052                   ASNRLFDVKGLGGPALETLNLTGNGIQTMQGLDHPNLTNLVTLELRGNCLETTDGIYLPN
Gasterosteus_aculeatus|12657       AGNRLADLDGLVGPSLESLNLTGNRIQRVNGLQSGSLANLVTLELRGNKLDTTDGINLPN
Branchiostoma_floridae|22845       AFNQIATVAGLSHPQLMLLNLTGNRLQRISGLDPCKLRALTTLELRGNGLESTEGLALPS
Apis_mellifera|3375                ------------------------------------------------------------
Branchiostoma_floridae|9256        TNNKINTTEGINHPLLETLVLSYNEIKIASGLDPGKLRNLHTLELRGNRLESTNGIYLPN
Nematostella_vectensis|23957       TQNKIMDTEGINHPLLEHLNLSMNEIVEVSGLDPGKLSRLAILELRGNKLMTTTGMNLEN
Xenopus_tropicalis|3131            AQNRIKSLQGFGHPRLETLNLIGNELRDLEGLECSNLSSLHTLELRSNQLLSTAGLNLPS
Taeniopygia_guttata|17784          DRNRIMDFEGITHPLLANLSLKENKIETVQGLSHNQLFSLEVLELRGNRIKTTAGLGVSK
Gallus_gallus|16851                AHNHIKNMEGITHPHLTSLSLKGNKIPTALGLSQA-LYSLRTLELRGNKLESTAGLYLPK
Spermophilus_tridecemlineatus|3700 XXXXXXXXXXXXXXXXXXXXXXXNHIHMVTGLDPQKLNSLHTLELRGNQLESTLGINLPK
Vicugna_pacos|3441                 XXXXXXXXXXISHPRLASLDLKGNHIHVVTGLDPQKLISLHTLELRGNQLDSTLGINLPK
Anolis_carolinensis|5415           ANNQIKDTNGINHPRLASLNLKGNEIEKVTGLDPEILSNLHTLELRGNNLKSTTGFDLPK
Dasypus_novemcinctus|13381         AYNQITDTEGIAHPRLGSLDLKGNRIHLVTGLDPQKLNCLHTLELRGNQLESTLGINLPK
Ornithorhynchus_anatinus|5399      AHNRISGTEGITHPRLTSLDLKGNFIQRVTGLDPLKLGNLHTIELRGNQLESTAGLHLPK
Echinops_telfairi|6149             XXXXXXXXXXXXXXXXXXXXXXXNRIQMVTGLDPQKLTCLHTLELRGNQLNNTLGINLPK
Macropus_eugenii|183               AYNQITDTEGIGHPRLGSLDLKGNNIKKITGLDPQKLVNLHTLELRGNQLESTMGIELPK
Monodelphis_domestica|7956         AYNQITDTEGILHPRLVSLDLKGNNIKKVTGLDPQKLGNLHTLELRGNQLESTQGIELPK
Dipodomys_ordii|3984               AYNQITDTEGITHPRLGSLDLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Otolemur_garnettii|9765            AYNQITDTEGIFH-RLGSLDLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Pteropus_vampyrus|8756             AYNQITDTEGISHPRLGSLDLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Ochotona_princeps|12797            AYNQITDTEGIAHPRLASLDLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Choloepus_hoffmanni|2556           AYNQIIDTEGISHPRLSSLDLKGNHIRIVTGLDPQKLNNLHTLELRGNQLESTLGINLPK
Tupaia_belangeri|13626             -----------------------NRIRMVTGLDPQKLNSLHTLELRGNQLESTLGINLPK
Erinaceus_europaeus|6919           AYNQIGDTEGILHPRLSSLDLKGNRIQMVTGLDPMKLRSLHTLELRGNHLTSTLGLELPT
Sorex_araneus|12623                AYNQITDTEGISHPRLTSLDLKGNRIQTLTGLDPK--LSLQTLELRGNQLISTLGLNLPK
Cavia_porcellus|1747               AYNQITDTEGITHPRLASLDLKGNRIQVVTGLDPEKLKSLHTLELRANQLYTTVGINLPK
Mus_musculus|41172                 SYNQIIDTEGIFHPRLGSLDLKGNRIHQVTGLDPERLSSLHTLELRGNQLESTKGIYLPK
Rattus_norvegicus|8204             SYNQITDTEGIIHPRLGSLDLKGNRIHQVTGLDPERLTNLHTLELRANQLETTIGINLPK
Canis_familiaris|4971              AHNQITDTEGISHPRLGSLDLKGNRIRRVTGLDPQKLLSLHTLELRGNQLESTLGINLPK
Myotis_lucifugus|12558             AYNQIADTEGISHPRLGILNLKGNHIRLVTGMDPEKLISLHTLELRGNQLESTVGINVPT
Rhesus_macaque|3691                AYNQITDTEGISHPRLETLNLKGDQKRWPSAL-----------------------IGLPG
Callithrix_jacchus|16211           AYNQITDTEGISHPRLGSVNLKGNNIHMVTGLDPQKLISLHTLELRGNQLESTLGINLPK
Homo_sapiens|59396                 AYNQITDTEGISHPRLETLNLKGNSIHMVTGLDPEKLISLHTVELRGNQLESTLGINLPK
Pongo_abelii|21089                 AYNQITDTEGISHPRLETLNLKGNSIHTVTGLDPQKLISLHTVELRGNQLESTLGINLPK
Gorilla_gorilla|11281              AYNQITDTEGISHPRLETLNLKGNSIHTVTGLDPEKLISLHTVELRGNQLESTLGINLPK
Pan_troglodytes|9509               AYNQITDTEGISHPRLETLNLKGNSIHMVTGLDPEKLISLHTVELRGNQLESTLGINLPK
Tursiops_truncatus|7978            AYNQITDTEGISHPRLASLDLKGNHIHMVTGLDPQKLMSLHTLELRGNQLNSTVGINLPK
Oryctolagus_cuniculus|4256         AYNQIIDTEGIAHPRLRSLDLKGNRIQMVTGLDPQKLNSLHTLELRGNQLKSTLGINLPK
Microcebus_murinus|1609            AYNQITDTEGISHPRLGSLDLKGNRIRLVTGLDPQNLISLHTLELRGNQLESTLGINLPK
Sus_scrofa|724                     AYNQITDTEGISHPRLASLDLKGNRIPMVTGLDPQKLISLHTLELRGNQLSSTLGINLPK
Bos_taurus|12241                   AYNQITDTEGISHPRLASLDLKGNRIHMVTGLDPQKLISLHTLELRGNQLNSTLGINLPK
Equus_caballus|346                 AHNQITDTEGISHPRLGSLDLKGNRIRMVTGLDPQKLISLHTLELRGNLLDSTLGINLPK
Loxodonta_africana|16680           AYNQITDTEGISHPRLGSLDLKGNRIRMVTGLDPQKLNSLHTLELRGNQLDSTLGINLPK
Procavia_capensis|12089            AYNQITDTEGISHPRLVSLDLKGNRIHMVTGLDPQKLNSLHTLELRGNQLETTQGINLPK
Tribolium_castaneum|15720          NQNQIKQVGNIDQPLLDCLEMNYNDIYS-TEFETANLKQLKQLEMRSNLLFEISGFYPPN
Apis_mellifera|3250                NNNKLNSTSGISHKFLECLELNHNNIEEIT-LNPYDLENLKTLEIGGNILTTTNGIFFPG
Pogonomyrmex_barbatus|13322        NQNKLRDAAGIHHRLLERLELNHNDICTVA-IDPQNLPNLKTLELRGNALVSTTEICCPT
                                                                                               

Bombyx_mori|2782                   LDSLYLAGNQINSLIGLE--SCVNLRILHVRNNPIKLLNGFVPDLGRLQYVNLRNCKVST
Pediculus_humanus|1825             LVNLYLAQNKITELRGFE--ILINLERLHLRENPLSDLTGFTKSNVKLKYLNVRKCEIGN
Danio_rerio|6052                   LRHLYLAQNNIKKLEGLE--KLERLITLHLRHNQLETLDGLSASMKCLEYLNVRGNLISS
Gasterosteus_aculeatus|12657       LRQLYLAQNAIKHLEGLE--KLERLTTLHLRDNQLDALDGLSPNMKCLQYLNVRNNVISD
Branchiostoma_floridae|22845       LRELYL------------------------------------------------------
Apis_mellifera|3375                --------------------------------------------MRNLQYINMRGNMVSD
Branchiostoma_floridae|9256        LKNLFLGANMIKRVEGLE--RLEKLTTLHLRDNQIDTLDGFAESMKSLQYINLRGNNMTS
Nematostella_vectensis|23957       LRELYLAANTIRKVEGLD--RLEHLTKLHLRDNQIDSLEGFSENMKNLQYLNLRGNSISS
Xenopus_tropicalis|3131            LRELYLGQNNISRLEGLE--ALVNLTTLHLRDNQLESLDGFSEHLQALQYLNLRSNMVAK
Taeniopygia_guttata|17784          LKKLYLAKNTICSLEGLE--EFEQLETLHLRDNKLEALDGFSNSMKCLQYLNLRSNGIKS
Gallus_gallus|16851                LKNLYLAQNAIRSLEGLE--ALEQLSTLHLRDNELETLDGFSSSMKCLQYLNLRNNGISS
Spermophilus_tridecemlineatus|3700 LKNLFLAQNLLKKVEGLE--NLSNLTTLHLRDNQIETLNGFSMEMKSLQYLNLRGNMVSD
Vicugna_pacos|3441                 LKNLFLSDML--------------------------------------------------
Anolis_carolinensis|5415           LKNLYLAQNSLTYLEGLT--ELGQLTTLHLRDNQLETLDGFSEDMKSLQYLNLRGNAISQ
Dasypus_novemcinctus|13381         LKNLYLAQNLLKKVEGLE--KLSNLTTLHLRDNQIETLSGFSKEMKSLQYLNLRGNMVSD
Ornithorhynchus_anatinus|5399      LKYLYLAQNNLRQLEGLE--SLEHLCTLHLRDNQVEVLDGFSPSMKALQYLNLRGNMIAD
Echinops_telfairi|6149             LKNLYLAQNMLKKVEGLE--TLSNLTTLHLRDNQIETLSGFSGTMKSLQYLNLRGNMVAD
Macropus_eugenii|183               LKNLFLAQNQLKKIEGIE--GLSYLTTLHLRDNQISVLSGFSREMKSLQYLNL-------
Monodelphis_domestica|7956         LKNLFLAQNQLKQIEGLE--NLEHLTTLHLRDNQINTLSGFSSEMKSLQYLNLRGNLVAN
Dipodomys_ordii|3984               XXXXXXAQNMLKKVEGLE--NLSSLTTLHLRDNQIENLSGFSKEMKSLQYLNLRGNMVSS
Otolemur_garnettii|9765            XXXXXXAQNLLKKVEGLE--ELTGLTTLHLRDNQIETLSGFSEKMYSLQYLNLRSNMVTD
Pteropus_vampyrus|8756             XXXXXXAQNMLKKVEGLE--NLKNLTTLHLRDNHIETLSGFSKEMQSLQYLNL-------
Ochotona_princeps|12797            XXXXXXAQNMLKKVEGLE--NLSSLTTLHLRDNQIETLSGFSKEMKSLQYLNLRGNMVAD
Choloepus_hoffmanni|2556           LKNLFLXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNMVTS
Tupaia_belangeri|13626             LKNLYLXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNMVTD
Erinaceus_europaeus|6919           LKNLFLAQNMLKKVEGLE--NLANLNTLHLRDNQIETLSGFSKEMKSLQYLNLRSNMVAD
Sorex_araneus|12623                LK-LFLAQNQLTKVEGLE--NLSNLTTLHLRDNMITTLNGFSKEMKSLQYINLRGNMVSD
Cavia_porcellus|1747               LKKLFLGQNMLKKVEGLE--NLSDLTTLHLRDNHIETLSGFSKEMQSLQYLNLRGNSISS
Mus_musculus|41172                 LKNLYLAQNLLKKVEGLE--NLSNLTTLHLRDNQIETLNGFSQEMKSLQYLNLRSNMISD
Rattus_norvegicus|8204             LKNLYLAQNLLKKVEGLE--NLSNLTTLHLRDNQIETLDGFSKEMKSLQYLNLRSNMISD
Canis_familiaris|4971              LKNLYLAQNMLKKVEGLE--NLSNLTTLHLRDNQIETLSGFSKEMASLQYLNLRGNMVTH
Myotis_lucifugus|12558             LKNLFLAQNMLKKVEGLE--HLKNLTTLHLRDNQIDTLSGFSEGMKSLQYLNL-------
Rhesus_macaque|3691                ------------------------------------------------------------
Callithrix_jacchus|16211           LKNLYLAQNLLKKVEGLE--NLSNLTTLHLRDNQIDTLSGFSKEMKSLQYLNLRGNLVAN
Homo_sapiens|59396                 LKNLYLVAHWVRGW----------------------------------------------
Pongo_abelii|21089                 LKNLYLAQNMLKKVEGLE--DLSNLTTLHLRDNQIDTLSGFSREMKSLQYLNLRGNMVAN
Gorilla_gorilla|11281              LKNLYLAQNMLKKVEGLE--DLSNLTTLHLRDNQIDTLSGFSREMKSLQYLNLRGNMVAN
Pan_troglodytes|9509               LKNLYLAQNMLKKVEGLE--DLSNLTTLHLRDNQIDTLSGFSREMKSLQYLNLRGNMVAD
Tursiops_truncatus|7978            LKNLFLXXXXXXXXXGLE--SLSNLTTLH-RDNQIETLSGFSKEMESLQYLNLRGNMVAD
Oryctolagus_cuniculus|4256         LKNLYLAQNMLKKVEGLE--NLTNLTTLHLRDNQIETLSGFSKEMKSLQYLNLRGNMVTD
Microcebus_murinus|1609            LKNLYLAQNLLKKVEGLE--NLSNLTTLHLRDNHIETLNGFSGEMKSLQYLNLRGNMVAD
Sus_scrofa|724                     LKNLFLAQNMLKKVEGLE--NLSNLTTLHLRDNQIDTLSGFSKEMKSLQYLNLRGNMVTD
Bos_taurus|12241                   LKNLFLAQNMLKKVEGLE--NLSNLTTLHLRDNQIETLSGFSKEMKSLQYLNLRGNMVAD
Equus_caballus|346                 LKNLFLAQNLLKKVEGLE--NLSNLTTLHLRDNQIETLSGFSKEMKSLQYLNLRGNMVTD
Loxodonta_africana|16680           LKNLFLAQNMLKKVEGLE--NLSNLTTLHLRDNQIETLSGFSGEMKSLQYLNLRGNMVTD
Procavia_capensis|12089            LKNLYLAQNMLKKVEGLE--NLSNLTTLHLRDNQIETLSGFSGEMKSLQYLNLRGNMITD
Tribolium_castaneum|15720          LRKLYMAANKITTINSPEFAKLSRLETLHLRENSIQNLDGFSEAQTSLKYLNLRNNKIEK
Apis_mellifera|3250                LIRLYLGENQIERLEGLE--ILVNLKILHLRSNKISNLSGFDSRCAKLNYLNLRNNEISK
Pogonomyrmex_barbatus|13322        LTQLFLAENQIEKIEGLD--ALVNLRTLHLRNNKLANLDGFTERCHSLKYLNLRNNEISR
                                                                                               

Bombyx_mori|2782                   LRQVKKLKVLPS-LETLILKGCPYMGGTGEETPEVADE--------EE------------
Pediculus_humanus|1825             VEEFKKLSVLAG-LKELVIKGNVFNAEPGEEAQSDENNENESENEEQDGGRRGAEEEQEV
Danio_rerio|6052                   MRALQTLASVGQTLKALVLLDNPI----------------------AK------------
Gasterosteus_aculeatus|12657       EKALEGLARVSKTLRALVLSDNPL----------------------VD------------
Branchiostoma_floridae|22845       ---VEKLHHLNR-LRTLSLAGNPL----------------------AE------------
Apis_mellifera|3375                VKETAKMKCLPK-LRALILSENPC----------------------SD------------
Branchiostoma_floridae|9256        VKEVKKLTVLPM-LRALVFLECPV----------------------TE------------
Nematostella_vectensis|23957       NKEVQKLKCLPL-LRALVLMENPV----------------------SD------------
Xenopus_tropicalis|3131            LQEVQKLYCLPR-LRALVLRENPC----------------------EE------------
Taeniopygia_guttata|17784          FQEVEKLQVLPM-LQALVLMDNPC----------------------AE------------
Gallus_gallus|16851                LQEVAKLQVLPM-LQALVLMENPC----------------------SD------------
Spermophilus_tridecemlineatus|3700 LGELAKLRDLPK-LRALVLLENPI----------------------TD------------
Vicugna_pacos|3441                 ------------------------------------------------------------
Anolis_carolinensis|5415           IQELTKLLVLPM-LRALVLLDNPC----------------------SE------------
Dasypus_novemcinctus|13381         LGELAKLRDLPK-LRAMVLLDNPC----------------------TD------------
Ornithorhynchus_anatinus|5399      LAELEKLQVLPK-LRALILLENPC----------------------VD------------
Echinops_telfairi|6149             LGELSKLRDLPK-LRALVLLENPC----------------------TD------------
Macropus_eugenii|183               ------------------------------------------------------------
Monodelphis_domestica|7956         IIELIQLKELPR-LRALILMENPC----------------------TD------------
Dipodomys_ordii|3984               LSEVAKLRELPK-LRALVLMENPC----------------------AD------------
Otolemur_garnettii|9765            LAELAKLRDLPK-LRALVLLDNPI----------------------TD------------
Pteropus_vampyrus|8756             ------------------------------------------------------------
Ochotona_princeps|12797            LSELAKLRDLPK-LRALVLLDNPC----------------------AD------------
Choloepus_hoffmanni|2556           LGELAKLRDLPK-LRALVLLDNPC----------------------TD------------
Tupaia_belangeri|13626             LRELAKLHDLPK-LRALVLLDNPC----------------------TD------------
Erinaceus_europaeus|6919           LAELS-LRDLPK-LRALVLLDNPC----------------------AD------------
Sorex_araneus|12623                MSELAKLRELPK-LRALVLLENPC----------------------SD------------
Cavia_porcellus|1747               VGELAKLRELPK-LRALVLLENPC----------------------TD------------
Mus_musculus|41172                 LAELAKLRDLPK-LRALVLLDNPC----------------------AD------------
Rattus_norvegicus|8204             LGELAKLRDLPK-LRALVLLDNPC----------------------AD------------
Canis_familiaris|4971              LEELAKLRDLPK-LRALVLLDNPC----------------------TD------------
Myotis_lucifugus|12558             ------------------------------------------------------------
Rhesus_macaque|3691                --------------------GPP-------------------------------------
Callithrix_jacchus|16211           LGELAKLQDLPK-LRALVLLDNPC----------------------TD------------
Homo_sapiens|59396                 -----------------------C----------------------RE------------
Pongo_abelii|21089                 LRELAKLRDLPK-LRALVLLDNPC----------------------TD------------
Gorilla_gorilla|11281              LGELAKLRDLPK-LRALVLLDNPC----------------------TD------------
Pan_troglodytes|9509               LGELAKLRDLPK-LRALVLLDNPC----------------------TD------------
Tursiops_truncatus|7978            LGELAKLRNLPK-LRALVLLDNPC----------------------TD------------
Oryctolagus_cuniculus|4256         LTELAKLRDLPK-LRALVLLDNPC----------------------AD------------
Microcebus_murinus|1609            LGELAKLRDLPK-LRALVLLDNPC----------------------AD------------
Sus_scrofa|724                     LGELAKLQDLPK-LRALVLLDNPC----------------------AD------------
Bos_taurus|12241                   LGELAKLRDLPR-LRALVLLDNPC----------------------TD------------
Equus_caballus|346                 LGELAKLRDLPK-LRALVLLDNPC----------------------TD------------
Loxodonta_africana|16680           LGELAKLRDLPK-LRALVLLENPC----------------------TD------------
Procavia_capensis|12089            LAELAKLRDLPK-LRALVLLENPC----------------------TD------------
Tribolium_castaneum|15720          FKEFRKLQCLPN-LETLIVTGNPLPGSEVPQMGGEGGGGGVFGEGGKI------------
Apis_mellifera|3250                ISELEKLNCLPA-LETLIVMENPA----------------------ID------------
Pogonomyrmex_barbatus|13322        ISELEKLSCLSN-LETLIILGNPFLKKEAKEEE-------------EK------------
                                                                                               

Bombyx_mori|2782                   ----------------N--SEL---------------------RVEILAALPKLKKINKT
Pediculus_humanus|1825             EEEEGKSKRKNKGNKTENDDDYGVGDGDKTNEESDMEEEEMENRLKILSYLPHLHRIDKR
Danio_rerio|6052                   ----------------T--DDY---------------------RLYVISQLPHLERVDKD
Gasterosteus_aculeatus|12657       ----------------A--TDY---------------------RLSVLTLLPQLERLDKD
Branchiostoma_floridae|22845       ----------------EEAEHY---------------------VLDALSYIPSLDRIDKN
Apis_mellifera|3375                ----------------D--DEY---------------------RMEVLIGIRRIERLDKD
Branchiostoma_floridae|9256        ----------------E--DDY---------------------RIEVLIALRRIERLDKD
Nematostella_vectensis|23957       ----------------E--DDY---------------------RIEVLIALRRLERLDKD
Xenopus_tropicalis|3131            ----------------E--EGY---------------------RMETLIALPQLERLDKD
Taeniopygia_guttata|17784          ----------------E--PTY---------------------RLEVLSRLPQLQRLDKE
Gallus_gallus|16851                ----------------E--ANY---------------------QQEVLVQLPHLKRLDKE
Spermophilus_tridecemlineatus|3700 ----------------E--TDY---------------------RQEALVQMAHLERLDKD
Vicugna_pacos|3441                 ------------------------------------------------------------
Anolis_carolinensis|5415           ----------------E--GDY---------------------RIEVLVQLPRLERLDKD
Dasypus_novemcinctus|13381         ----------------E--SDY---------------------RQEALVQIAHLERLDKD
Ornithorhynchus_anatinus|5399      ----------------E--GGY---------------------RVEALVHVPHLERLDKD
Echinops_telfairi|6149             ----------------E--SDY---------------------RQEALVQMAHLERLDKE
Macropus_eugenii|183               ------------------------------------------------------------
Monodelphis_domestica|7956         ----------------E--TDY---------------------RQETLVQLPQLERLDKD
Dipodomys_ordii|3984               ----------------E--TDY---------------------RQEALVQIAHLERLDKD
Otolemur_garnettii|9765            ----------------E--SDY---------------------RQEALVQMAQLERLDKD
Pteropus_vampyrus|8756             ------------------------------------------------------------
Ochotona_princeps|12797            ----------------E--TDY---------------------RQEALVQIAHLERLDKD
Choloepus_hoffmanni|2556           ----------------E--NDY---------------------RQEALVQNAHLERLDKD
Tupaia_belangeri|13626             ----------------E--TDY---------------------RQEALVQMVHLERLDKE
Erinaceus_europaeus|6919           ----------------E--NDY---------------------RQDALVQIAQLERLDKG
Sorex_araneus|12623                ----------------E--SEY---------------------RQEALVQMAHLERLDKD
Cavia_porcellus|1747               ----------------E--TDY---------------------RQEALVQMPHLERLDKE
Mus_musculus|41172                 ----------------E--TDY---------------------RQEALVQMAHLERLDKE
Rattus_norvegicus|8204             ----------------E--TDY---------------------RQEALVQMAHLERLDKE
Canis_familiaris|4971              ----------------E--ADY---------------------RQEALVQIAHLERLDKD
Myotis_lucifugus|12558             ------------------------------------------------------------
Rhesus_macaque|3691                ------------------------------------------------------------
Callithrix_jacchus|16211           ----------------D--TNY---------------------RQEALVQMPYLERLDKG
Homo_sapiens|59396                 ----------------E--------------------------GTVLGVRMPAF------
Pongo_abelii|21089                 ----------------E--INY---------------------RQEALVQMPYLERLDKE
Gorilla_gorilla|11281              ----------------E--TSY---------------------RQEALVQMPYLERLDKE
Pan_troglodytes|9509               ----------------E--TSY---------------------RQEALVQMPYLERLDKE
Tursiops_truncatus|7978            ----------------E--NDY---------------------RREALVQV---------
Oryctolagus_cuniculus|4256         ----------------E--TDY---------------------RQEALVQIAHLERLDKD
Microcebus_murinus|1609            ----------------E--TDY---------------------RQEALVQMAHLERLDKD
Sus_scrofa|724                     ----------------E--SDY---------------------RQEALVQLAHLERLDKD
Bos_taurus|12241                   ----------------E--NDY---------------------RQEALVQIAHLERLDKE
Equus_caballus|346                 ----------------E--NDY---------------------RQEALVQMAHLERLDKD
Loxodonta_africana|16680           ----------------E--SDY---------------------RQEALVQMAHLERLDKD
Procavia_capensis|12089            ----------------E--SDY---------------------RQEALVQMAHLERLDKD
Tribolium_castaneum|15720          ----------------R--DPV---------------------VIPLLVLLPKLKRINKT
Apis_mellifera|3250                ------------EREMEEEATY---------------------RHIILAMLPNLTRIDKD
Pogonomyrmex_barbatus|13322        ----------------EARQEY---------------------RYIILTILPKLKRIDKD
                                                                                               

Bombyx_mori|2782                   VVTPEERAEAKELITQWIEDG---AADEEAEEEQQPEEHDNDDD-------
Pediculus_humanus|1825             IVTETERQMMREMIE----------DEEEEEE-------------------
Danio_rerio|6052                   PVTPEEKFEAQ--------------KKEFEDDNAEDQEDD-----------
Gasterosteus_aculeatus|12657       PVSPEERVEARER--------------------------------------
Branchiostoma_floridae|22845       PISEEDRSEAEALAELRRQEL---SSSDSLAHLPHEQMFSSASSEFSSDMM
Apis_mellifera|3375                DYNEEERQEAEEIYETRRA------EELAAGEVC-----------------
Branchiostoma_floridae|9256        EYTEDERQEAEEIYEQRRQEE----QPPEGAEEVIEDQDDADAD-------
Nematostella_vectensis|23957       EYTEDERQEAEEIYNQRQEEE---LAAQQGGHEIIHTDEDD----------
Xenopus_tropicalis|3131            FFEEEEKREAAETKKAREE--------EEMAEPGEKGN-------------
Taeniopygia_guttata|17784          SIEEEEREEAEKICQARKE------KEKQQPEAKRPPEP------------
Gallus_gallus|16851                PV-EQNHAEANEICK-RQE------NEK-----------------------
Spermophilus_tridecemlineatus|3700 FYEEEERIEADEIRQRIKE------EQEQEAEPEHDLELDQPLV-------
Vicugna_pacos|3441                 -----------------------------------KVELENSLT-------
Anolis_carolinensis|5415           FFEEDERAEAEDIRQRRKE-------EELELEREREQEKEQE---------
Dasypus_novemcinctus|13381         FYEEEERAEAEEIRQRLKE------EQEHEPE-QHYQDVDHPST-------
Ornithorhynchus_anatinus|5399      FYDEEERAEADETRQRLRE------EQERDLPPGPSGDREHPGGVS-----
Echinops_telfairi|6149             IFEEEERVEAEEMRQRLRE------------EQEREADQDGPTC-------
Macropus_eugenii|183               ---------------------------------------------------
Monodelphis_domestica|7956         FYEEEERAEADEIRQRLKEEQEIDLDQDLSPDPEKEVSKEQAGV-------
Dipodomys_ordii|3984               FYEEEERADADEVRQRLKE------ELEQEADTENDLEH------------
Otolemur_garnettii|9765            YFEEEERAEASEIRQRLKE------DQEQEAEPEHDPEQDQEVM-------
Pteropus_vampyrus|8756             ---------------------------------------------------
Ochotona_princeps|12797            FFEEEEQAEAEEIRQRLKEEQ----EQEQEAEQGQNPDQDPALQ-------
Choloepus_hoffmanni|2556           FYEEEERAEAEEIRNRLKEEQEQ--EPEPEPEPKHYQDLDQTLA-------
Tupaia_belangeri|13626             FYEEEERAEAEEIRQRLKE------EQEQDGEMEHDLEPIQPLP-------
Erinaceus_europaeus|6919           FYDDDERAEAEEARQRIGE-------QEQEAESDHDVVLDALL--------
Sorex_araneus|12623                FYEEEERLEADEIRQRLREEP----EMEQDVEQEHETASHPPA--------
Cavia_porcellus|1747               FYEEEERAEADEIRQRIKD------EQEQEPEPEHDLDPDQSSM-------
Mus_musculus|41172                 FYEDDDRAEAEEIRQRLKE------EQDQDLDPDQDMEPYLPPV-------
Rattus_norvegicus|8204             YYEDEDRAEAEEIRQRLKE------EQEQELDPDQDMEPYLPPT-------
Canis_familiaris|4971              FYEEEERADADEIRQRLKE------TQEQEAEVEHDSELEQTSM-------
Myotis_lucifugus|12558             ---------------------------------------------------
Rhesus_macaque|3691                ---------------------------------------------------
Callithrix_jacchus|16211           FYEEEEQAEADEIRRRLKE--------NQEQEPQRDLEPEQSLIY------
Homo_sapiens|59396                 ---------------------------------------------------
Pongo_abelii|21089                 FYEEEERAEADEIRQRLKE------EKEQEPEPERDLELEQSLI-------
Gorilla_gorilla|11281              FYEEEERAEADEIRQRLKE------EKEQEPEPERDLEPEQSLI-------
Pan_troglodytes|9509               FYEEEERAEADEIRQRLKE------EKEQEPEPQRDLEPEQSLI-------
Tursiops_truncatus|7978            ---------------------------------------------------
Oryctolagus_cuniculus|4256         FFEEEEQAEAEEIRQRLKE------EREQEAEQEHSLDLDQAPM-------
Microcebus_murinus|1609            FYEEEERVEANEIRQRLKE------DQEQEVDPEHDMESDHPLTY------
Sus_scrofa|724                     FYEEEERAEADEIRQRMKE------EQEQEAEPEAESELDQSSI-------
Bos_taurus|12241                   FYEEEERAEADEIRQRMKE------EQEQEAEVEPESELDQSST-------
Equus_caballus|346                 FFEEEERAEADEIRQRMKEEQ----DQEQEAEPEHDLELDQPST-------
Loxodonta_africana|16680           FYEEEERAEADEIRQRLKE------DQEHQAEPDHEEDLDQS---------
Procavia_capensis|12089            FYEEEERAEADEIRQRMKE------DQEHKSEQGHGEDLDQSTN-------
Tribolium_castaneum|15720          VITMEDRIDAEDMENDVIEAL---LRDDETAQDTDRETTTTDYKQESDLDG
Apis_mellifera|3250                PVLYDERKEAKEFRRQMFL----------DGTTFADLDYNFLAG-------
Pogonomyrmex_barbatus|13322        PVLDFERNETVYLQRKFYF------------KFRYEL--------------