Orthologs Set ID: EOG4006CZ


Orthology Database
OrthoDB4
Gene Symbol(s)
LOXL5B

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Fugu rubripes 22544 96, 472, 658, 767, 905, 1062, 1158, 1283
Gasterosteus aculeatus 3719 658, 767, 905, 1062, 1158, 1283
Oryzias latipes 8894 343, 658, 767, 905, 1062, 1158, 1283
Tetraodon nigroviridis 21768 24, 96, 300, 472, 658, 767, 905, 1062, 1158
Tetraodon nigroviridis 6729 24, 96, 472, 658, 767, 905, 1062, 1158

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Fugu rubripes 22544 ENSTRUT00000023128 101062132 ENSTRUG00000009159 loxl5b fr2
Gasterosteus aculeatus 3719 ENSGACT00000022383 ENSGACG00000016914 loxl5b gasAcu1
Oryzias latipes 8894 ENSORLT00000022535 ENSORLG00000017995 loxl5b oryLat2
Tetraodon nigroviridis 21768 ENSTNIT00000001650 ENSTNIG00000000510 loxl5b (1 of 2) tetNig2
Tetraodon nigroviridis 6729 ENSTNIT00000018170 ENSTNIG00000014902 loxl5b (2 of 2) tetNig2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Fugu rubripes 23032 ENSTRUP00000023032 101062132 ENSTRUG00000009159 loxl5b fr2
Gasterosteus aculeatus 21935 ENSGACP00000022341 ENSGACG00000016914 loxl5b gasAcu1
Oryzias latipes 21724 ENSORLP00000022534 ENSORLG00000017995 loxl5b oryLat2
Tetraodon nigroviridis 791 ENSTNIP00000017946 ENSTNIG00000014902 loxl5b (2 of 2) tetNig2
Tetraodon nigroviridis 20390 ENSTNIP00000002807 ENSTNIG00000000510 loxl5b (1 of 2) tetNig2

multiple sequence alignment in CLUSTALW format


Tetraodon_nigroviridis|6729  TTCAGGTTTCTGTGGGAGGCGCTGATCACCCTGAAATATCAA---------------CGC
Tetraodon_nigroviridis|21768 TTCAGGTTTCTGTGGGAGGCGCTGATCACCCTGAAATATCAA---------------CGC
Oryzias_latipes|8894         ---------ATGGCAAAAGGCCTTCTGGTCATTTGGTATTTT---------------TTC
Fugu_rubripes|22544          ---ATTTACATAGCGCGCCCCTCTCTCAGCCTCGGGTATCTCCACTCAGCCACAGCAAGG
Gasterosteus_aculeatus|3719  ------------------------------------------------------------
                                                                                         

Tetraodon_nigroviridis|6729  TGCAAGATTGCAAAAGTGGTAAGGCTGACctttaaggagcagcagcgcgccGTTGGCCCG
Tetraodon_nigroviridis|21768 TGCAAGATTGCAAAAGTGGTAAGGCTGACctttaaggagcagcagcgcgccGTTGGCCCG
Oryzias_latipes|8894         CACGGACTACTTTCTCTGACT------------TCTGGACAGCAGCGCACTGCGGGCCCT
Fugu_rubripes|22544          CAGGGGTTAATTCTTCTAGGATTTGACTGTGTCTCAGAGCAGCGGCGCGCTGCCGGCCCG
Gasterosteus_aculeatus|3719  ------------------------------------------------------------
                                                                                         

Tetraodon_nigroviridis|6729  TGGCGCCATCGCTTCCAATGGGAAAACAACGGGCAGGTTTACAGTTTACTGAGCACCGGG
Tetraodon_nigroviridis|21768 TGGCGCCATCGCTTCCAATGGGAAAACAACGGGCAGGTTTACAGTTTACTGAGCACCGGG
Oryzias_latipes|8894         TGGCGGCACCACATCCAGTGGGAGAACAACGGTCAGGTTTACAGCTTGATGAGCACTGGA
Fugu_rubripes|22544          TGGCGGCATCGCTTCCAATGGGAAAACAACGGGCAGGTTTACAGTTTACTCAGCACCGGG
Gasterosteus_aculeatus|3719  ------------------------------------------------------------
                                                                                         

Tetraodon_nigroviridis|6729  TCAGAATACCAGGCCCCGGTTCGGTCCAGGAATCAGCAGAGGGTTTATGTGAGCAGTAGA
Tetraodon_nigroviridis|21768 TCAGAATACCAGGCCCCGGTTCGGTCCAGGAATCAGCAGAGGGTTTATGTGAGCAGTAGA
Oryzias_latipes|8894         TCGGAATTCCAGAGTCCGGTTCGGTCCAGAATTCTAGCGAGGGTTTTTCTGAGCAGCAGG
Fugu_rubripes|22544          TCAGAATACCAAGCCCCGGTTCGGTCAAGGAACCAGCCGAGGGTTTACGTGAGCAGTAGA
Gasterosteus_aculeatus|3719  ------------------------------------------------------------
                                                                                         

Tetraodon_nigroviridis|6729  ------------------------AATAGGGATGGCACCGGGGCCAGGCAGCTGAGGACC
Tetraodon_nigroviridis|21768 ------------------------AATAGGGATGGCACCGGGGCCAGGCAGCTGAGGACC
Oryzias_latipes|8894         ATGCCCAGCAGCGACATCCCAGGGACGCGCGGGGGAGGCGGGCAGCCTGAGTCCAGGACC
Fugu_rubripes|22544          ------------------------AAGAGGGATGACCCCGGCACCAGTCAGCTGTGGACC
Gasterosteus_aculeatus|3719  ------------------------------------------------------------
                                                                                         

Tetraodon_nigroviridis|6729  GACTTTTCCGCAGAGCCAGGAGCTTCTCCGGCGCACGGACGGGATGCGCCGAGGACCAGA
Tetraodon_nigroviridis|21768 ------AGCCAGGAGCTTCTCCGGCGCACGGACGGGATGCGCCGAGGACCAGACAGCTGC
Oryzias_latipes|8894         AGG---ACCGACCACACGGTGGCAGGACCTCTGGCCCCTGAAGAATCCACCAACAGCTCC
Fugu_rubripes|22544          GACCCCTCTGCAGATCTCGGCACTTCTCCGGCGCACGGACAGGATGAAGCGCAGATCAGA
Gasterosteus_aculeatus|3719  ------------------------------------------------------------
                                                                                         

Tetraodon_nigroviridis|6729  CAGCTGCCCGGACCCCGGCGcggagcagaggctgcagggtACCCAGGAGCTCGACGCCTC
Tetraodon_nigroviridis|21768 CCGGACCCCGGCGCGGAGCAG------AAGGCTGCAGGGTACCCAGGAGCTCGACGCCTC
Oryzias_latipes|8894         CTGCGTTCAACAGCCAGAGAGGATGCTGAGAACGAACCAGATCCCGATCCAGAGCAGATC
Fugu_rubripes|22544          CACCCCGGCGGATCA------------GAGGCTGCGGGGCATCCGGGGGCGCGACGCATC
Gasterosteus_aculeatus|3719  ------------------------------------------------------------
                                                                                         

Tetraodon_nigroviridis|6729  AGCACTGAGCAATCCAGCAGTAACCATACTCCAGCTTTAGGGAATTTCACAGATGCTCCA
Tetraodon_nigroviridis|21768 AGCACTGAGCAATCCAGCAGTAACCATACTCCAGCTTTAGGGAATTTCACAGATGCTCCA
Oryzias_latipes|8894         ATGGACACGCACACCTCTGCGTATCCCGCAGGCCCTCCCGCACACTTTCCAGCTCTCAGC
Fugu_rubripes|22544          CGCACCGAACAACCCAGCAGTAACAACGCC------------------TCAGATGCTCCA
Gasterosteus_aculeatus|3719  ------------------------------------------------------------
                                                                                         

Tetraodon_nigroviridis|6729  AACGAAGCAGTTAGT------CACGAAGAAAACATGATTAACGACGAGCCTCGAAACCCC
Tetraodon_nigroviridis|21768 AACGAAGCAGTTAGT------CACGAAGAAAACATGATTAACGACGAGCCTCGAAACCCC
Oryzias_latipes|8894         GCAGATTTTTCAAACGAGATCAGTGATGAGGACATGATGAACGACGACCCGCGAAGCCCC
Fugu_rubripes|22544          AACGAAGCACTCGGT------TATGAAGAGAACATGGTTAACGACGACCCTCGAAGCCCC
Gasterosteus_aculeatus|3719  ---------------------------------ATGGTTAATGACGACCCTAGAAACCCG
                                                              ***.* ** ***** ** .***.*** 

Tetraodon_nigroviridis|6729  TTTAAAACCCACAGGAATTCTGTCTTTTACAACCCGTATCCCTCCACC------------
Tetraodon_nigroviridis|21768 TTTAAAACCCACAGGAATTCTGTCTTTTACAACCCGTATCCCTCCACC------------
Oryzias_latipes|8894         TTCAAAAGCCACCGGAACTCCGTCTTCTACAACCTGTACCCCAGCAGGGGCAGGTCAGGG
Fugu_rubripes|22544          TTTAAAAACCACAGGAATTCGGTGTTATACAACATGTATCCCGCCAGC------------
Gasterosteus_aculeatus|3719  TTTAAAAACCACATGAATTCGGTTTTCTACAACTCCTACCCCGCAAGAGGGAGGTCAGTG
                             ** **** ****. *** ** ** ** ******   ** ***  .*              

Tetraodon_nigroviridis|6729  GGTCGCGCACACCGTCCACCTGGTTTGGGA---TATGGAACGCGATATTTCCAAAACGGT
Tetraodon_nigroviridis|21768 GGTCGCGCACACCGTCCACCTGGTTTGGGA---TATGGAACGCGATATTTCCAAAACGGT
Oryzias_latipes|8894         GCCCGCGCGCTCCGTCCGCCGGGCGCAGGAGGATACGGGACACGGTATTTCCAAAACGGA
Fugu_rubripes|22544          AGCCGCACACGCCATCCACCCAGTCTGGGA---TACGGGACGAGATATTTCCAAAACGGT
Gasterosteus_aculeatus|3719  ACCCGCACGCGTCGTCCCTCTGGCACAGGA---TATGGAACAAGATATTTCCAAAATGGA
                             .  ***.*.*  *.***  * .*   .***   ** **.**..*.*********** **:

Tetraodon_nigroviridis|6729  CTGCCAGATCTGGTACCGGACCCTTATGCAATCCAAGCTGGCACTTACATCCAGCGCATG
Tetraodon_nigroviridis|21768 CTGCCAGATCTGGTACCGGACCCTTATGCAATCCAAGCTGGCACTTACATCCAGCGCATG
Oryzias_latipes|8894         CTGCCCGATCTGGTGCCGGACCCCTACGCCATCCAGGCAGGTGCTTACGTCCAGCGCATG
Fugu_rubripes|22544          CTGCCAGATCTGGAACCAGACCCATATGCAATCCAAGCAGGTACCTACATCCAACGAATG
Gasterosteus_aculeatus|3719  CTTCCAGACCTCATACCAGACCCGTATGCTATCCAGGCCGGTGCTTATATCCAACGCATG
                             ** **.** ** .:.**.***** ** ** *****.** ** .* ** .****.**.***

Tetraodon_nigroviridis|6729  CAGATGTACGCGCTCCGCTGCGCTGCTGAGGAAAACTGTCTGGCCAGGTCAGCTTACGGG
Tetraodon_nigroviridis|21768 CAGATGTACGCGCTCCGCTGCGCTGCTGAGGAAAACTGTCTGGCCAGGTCAGCTTACGGG
Oryzias_latipes|8894         CAGATGTACGCGCTGCGCTGTGCAGCCGAGGAGAACTGCCTGTCCAGGTCAGCTTACGCA
Fugu_rubripes|22544          CAAATGTACGCGCTCCGCTGCGCTGCTGAGGAGAACTGCCTGGCCAGGTCAGCTTATGGA
Gasterosteus_aculeatus|3719  CAGATGTTTGCTCTCCGCTGTGCCGCTGAGGAGAACTGTCTCGCCAGGTCGGCTTACGGA
                             **.****: ** ** ***** ** ** *****.***** **  *******.***** * .

Tetraodon_nigroviridis|6729  CCAAATGTGAGAGACATCGACTTCAGGGTCCTTCTGCGCTTCCCCCAAAAAGTGAAGAAC
Tetraodon_nigroviridis|21768 CCAAATGTGAGAGACATCGACTTCAGGGTCCTTCTGCGCTTCCCCCAAAAAGTGAAGAAC
Oryzias_latipes|8894         CCCACGGTCAGGGACATCGACTTCAGGGTCCTGCTGCGGTTCCCACAGAAGGTGAAGAAC
Fugu_rubripes|22544          CCAACTGTGAGAGACATCGACTTCAGGGTCCTCCTGCGTTTCCCCCAGAAAGTGAAGAAC
Gasterosteus_aculeatus|3719  CCTGCCGTGAGAGACATCGACTTCAGAGTCCTGCTGCGGTTCCCACAGAAAGTAAAGAAC
                             ** .. ** **.**************.***** ***** *****.**.**.**.******

Tetraodon_nigroviridis|6729  CAGGGAACGGGTGACTTTCTTCCTGTCAAGCCGAGATATCAGTGGGACTGGCACAGCTGT
Tetraodon_nigroviridis|21768 CAGGGAACCGGTGACTTTCTTCCTGTCAAGCCGAGATATCAGTGGGACTGGCACAGCTGT
Oryzias_latipes|8894         CAAGGAACCTCAGACTTCCTCCCTGTTAAGCCTCGACACCAGTGGGACTGGCACAGTTGT
Fugu_rubripes|22544          CAGGGCACTGGTGACTTCCTTCCTGTCAAGCCAAGATATCAGTGGGACTGGCACAGTTGC
Gasterosteus_aculeatus|3719  CAAGGCACCACTGACTTCCTTCCAGTCAAGCCGAGGTATCAGTGGGATTGGCACAGCTGT
                             **.**.**   :***** ** **:** ***** .*. * ******** ******** ** 

Tetraodon_nigroviridis|6729  CACCAACACTACCACAGCATGGACGCCTTCAGCAACTACGACCTGCTGGACACGGTCACG
Tetraodon_nigroviridis|21768 CACCAACACTACCACAGCATGGACGCCTTCAGCAACTACGACCTGCTGGACACGGTCACG
Oryzias_latipes|8894         CACCAGCACTTCCACAGCATGGACGCCTTCAGTAACTACGACCTGCTGGACGTCGTCAGC
Fugu_rubripes|22544          CACCAACACTACCACAGCATGGACGCGTTCAGCAACTACGACCTCCTCGACTCCGTCACT
Gasterosteus_aculeatus|3719  CACCAACACTTCCACAGCATGGAGGCCTTCAGTAACTACGACCTGCTGGACATCACCACT
                             *****.****:************ ** ***** *********** ** ***   . **  

Tetraodon_nigroviridis|6729  GGGCGCAAGGTGGCCGAGGGACACAAGGCCAGTTTCTGCCTGGAGGACACGGGCTGTGAC
Tetraodon_nigroviridis|21768 GGGCGCAAGGTGGCCGAGGGACACAAGGCCAGTTTCTGCCTGGAGGACACGGGCTGTGAC
Oryzias_latipes|8894         GGGCTGAAGGTGGCTGAGGGCCACAAGGCCAGCTTTTGCCTGGAGGACACCGGCTGTGAA
Fugu_rubripes|22544          GGACTCAAAGTTGCGGAAGGACACAAGGCCAGTTTCTGCCTAGAGGACACAGGCTGTGAT
Gasterosteus_aculeatus|3719  GAAAGGAAAGTTGCAGAGGGTCACAAGGCCAGTTTTTGCCTGGAGGACACCGGCTGTGAC
                             *...  **.** ** **.** *********** ** *****.******** ******** 

Tetraodon_nigroviridis|6729  CCAGGATTCAGGCGGCGCTACGCGTGCACGTCCCACACACAGGGACTGAGCCCAGGATGC
Tetraodon_nigroviridis|21768 CCAGGATTCAGGCGGCGCTACGCGTGCACGTCCCACACACAGGGACTGAGCCCAGGATGC
Oryzias_latipes|8894         CCTGGATTCAGGCGGCGCTACGCCTGTACAACACACACGCAGGGTCTGAGTCCGGGCTGC
Fugu_rubripes|22544          CCAGGATTCAGGCGGCGCTACGCTTGCACGTCCCACACACAGGGACTGAGTCCAGGATGC
Gasterosteus_aculeatus|3719  CCCGGATTCAGGCGGCGCTACGCCTGCACGTCTCACACACAGGGACTGAGTCCGGGCTGC
                             ** ******************** ** **.:* *****.*****:***** **.**.***

Tetraodon_nigroviridis|6729  TTCGACATATATGCTGCCAACATCGACTGTCAGTGGATCGACATCACCGATGTTCCTCCT
Tetraodon_nigroviridis|21768 TTCGACATATATGCTGCCAACATCGACTGTCAGTGGATCGACATCACCGATGTTCCTCCT
Oryzias_latipes|8894         CATGACACTTACGCCGCCAACATCGACTGTCAGTGGATCGACATCACTGACGTCCCCCCA
Fugu_rubripes|22544          TTTGACATATATGCCGCCAACATTGACTGTCAGTGGATCGACATCACAGATGTTCCTCCT
Gasterosteus_aculeatus|3719  CACGACACCTACGCTGCAAACATCGACTGTCAGTGGATCGACATTACGGACGTACCTCCA
                              : ****  ** ** **.***** ******************** ** ** ** ** **:

Tetraodon_nigroviridis|6729  GGAAACTACGTCTTGAAGGTTACTGTAAATCCCAATTTCCAAGTCCTGGAGTCAGACTTT
Tetraodon_nigroviridis|21768 GGAAACTACGTCTTGAAGGTTACTGTAAATCCCAATTTCCAAGTCCTGGAGTCAGACTTT
Oryzias_latipes|8894         GGAAACTACATCCTGAAGGTCACCGTCAATCCTAATCTGTACGTTCTGGAGTCGGACTTC
Fugu_rubripes|22544          GGAAACTACATCTTAAAGGTTACTGTAAATCCTAATTTCCTTGTCCTGGAGTCAGACTTT
Gasterosteus_aculeatus|3719  GGAAACTACATCCTGAAGGTTACTGTCAATCCCAATTTCCACGTCCTGGAGTCAGACTTC
                             *********.** *.***** ** **.***** *** *  : ** ********.***** 

Tetraodon_nigroviridis|6729  ACTAACAACGTAGTGAGGGTGCGA---------------TCTCACATACACCGGCGTCTA
Tetraodon_nigroviridis|21768 ACTAACAACGTAGTAAGGGTGCGA---------------TCTTACATACACCGGCGTCTA
Oryzias_latipes|8894         TCCAACAACATCGTGAGATGTGACGTCACCTACACAGGAATTTATGTCCAGACCCGC---
Fugu_rubripes|22544          ACCAACAACGTAGTGAGGTGTGATGTGACCTACACCGGGGTCTACGTCCAGACACGA---
Gasterosteus_aculeatus|3719  ACCAACAACGTAGTGAGATGTGATATCATATACACAGGAACTTATGTCCAGACACGC---
                             :* ******.*.**.**.    .                    * .*.** .  **    

Tetraodon_nigroviridis|6729  CGTCCAAACGCGACACTGTCGAGTCAC---
Tetraodon_nigroviridis|21768 CGTCCAAACGCGACACTGTCGAGTCAC---
Oryzias_latipes|8894         ------AACTGCAGAGTAACGAGGGGCTGA
Fugu_rubripes|22544          ------CACTGCCAGGTCACCAGATGG---
Gasterosteus_aculeatus|3719  ------AACTGTCGGGTATCAAGAGGGTGA
                                   .**   . . * :* **  .    

multiple sequence alignment in CLUSTALW format


Tetraodon_nigroviridis|791   FRFLWEALITLKYQ-----RCKIAKVVRLTFKEQQRAVGPWRHRFQWENNGQVYSLLSTG
Tetraodon_nigroviridis|20390 FRFLWEALITLKYQ-----RCKIAKVVRLTFKEQQRAVGPWRHRFQWENNGQVYSLLSTG
Oryzias_latipes|21724        ---MAKGLLVIWYF-----FHGLLSLT----SGQQRTAGPWRHHIQWENNGQVYSLMSTG
Fugu_rubripes|23032          -IYIARPSLSLGYLHSATARQGLILLGFDCVSEQRRAAGPWRHRFQWENNGQVYSLLSTG
Gasterosteus_aculeatus|21935 ------------------------------------------------------------
                                                                                         

Tetraodon_nigroviridis|791   SEYQAPVRSRNQQRVYVSSR--------NRDGTGARQLRTDFSAEPGASPAHGRDAPRTR
Tetraodon_nigroviridis|20390 SEYQAPVRSRNQQRVYVSSR--------NRDGTGARQLRT--SQELLRRTDGMRRGPDSC
Oryzias_latipes|21724        SEFQSPVRSRILARVFLSSRMPSSDIPGTRGGGGQPESRTR-TDHTVAGPLAPEESTNSS
Fugu_rubripes|23032          SEYQAPVRSRNQPRVYVSSR--------KRDDPGTSQLWTDPSADLGTSPAHGQDEAQIR
Gasterosteus_aculeatus|21935 ------------------------------------------------------------
                                                                                         

Tetraodon_nigroviridis|791   QLPGPRRGAEAAGYPGARRLSTEQSSSNHTPALGNFTDAPNEAVS--HEENMINDEPRNP
Tetraodon_nigroviridis|20390 PDPGAEQ--KAAGYPGARRLSTEQSSSNHTPALGNFTDAPNEAVS--HEENMINDEPRNP
Oryzias_latipes|21724        LRSTAREDAENEPDPDPEQIMDTHTSAYPAGPPAHFPALSADFSNEISDEDMMNDDPRSP
Fugu_rubripes|23032          HPGGS----EAAGHPGARRIRTEQPSSNNA------SDAPNEALG--YEENMVNDDPRSP
Gasterosteus_aculeatus|21935 ---------------------------------------------------MVNDDPRNP
                                                                                *:**:**.*

Tetraodon_nigroviridis|791   FKTHRNSVFYNPYPST----GRAHRPPGLG-YGTRYFQNGLPDLVPDPYAIQAGTYIQRM
Tetraodon_nigroviridis|20390 FKTHRNSVFYNPYPST----GRAHRPPGLG-YGTRYFQNGLPDLVPDPYAIQAGTYIQRM
Oryzias_latipes|21724        FKSHRNSVFYNLYPSRGRSGARALRPPGAGGYGTRYFQNGLPDLVPDPYAIQAGAYVQRM
Fugu_rubripes|23032          FKNHRNSVLYNMYPAS----SRTRHPPSLG-YGTRYFQNGLPDLEPDPYAIQAGTYIQRM
Gasterosteus_aculeatus|21935 FKNHMNSVFYNSYPARGRSVTRTRRPSGTG-YGTRYFQNGLPDLIPDPYAIQAGAYIQRM
                             **.* ***:** **:      *: :*.. * ************* *********:*:***

Tetraodon_nigroviridis|791   QMYALRCAAEENCLARSAYGPNVRDIDFRVLLRFPQKVKNQGTGDFLPVKPRYQWDWHSC
Tetraodon_nigroviridis|20390 QMYALRCAAEENCLARSAYGPNVRDIDFRVLLRFPQKVKNQGTGDFLPVKPRYQWDWHSC
Oryzias_latipes|21724        QMYALRCAAEENCLSRSAYAPTVRDIDFRVLLRFPQKVKNQGTSDFLPVKPRHQWDWHSC
Fugu_rubripes|23032          QMYALRCAAEENCLARSAYGPTVRDIDFRVLLRFPQKVKNQGTGDFLPVKPRYQWDWHSC
Gasterosteus_aculeatus|21935 QMFALRCAAEENCLARSAYGPAVRDIDFRVLLRFPQKVKNQGTTDFLPVKPRYQWDWHSC
                             **:***********:****.* ********************* ********:*******

Tetraodon_nigroviridis|791   HQHYHSMDAFSNYDLLDTVTGRKVAEGHKASFCLEDTGCDPGFRRRYACTSHTQGLSPGC
Tetraodon_nigroviridis|20390 HQHYHSMDAFSNYDLLDTVTGRKVAEGHKASFCLEDTGCDPGFRRRYACTSHTQGLSPGC
Oryzias_latipes|21724        HQHFHSMDAFSNYDLLDVVSGLKVAEGHKASFCLEDTGCEPGFRRRYACTTHTQGLSPGC
Fugu_rubripes|23032          HQHYHSMDAFSNYDLLDSVTGLKVAEGHKASFCLEDTGCDPGFRRRYACTSHTQGLSPGC
Gasterosteus_aculeatus|21935 HQHFHSMEAFSNYDLLDITTERKVAEGHKASFCLEDTGCDPGFRRRYACTSHTQGLSPGC
                             ***:***:********* .:  *****************:**********:*********

Tetraodon_nigroviridis|791   FDIYAANIDCQWIDITDVPPGNYVLKVTVNPNFQVLESDFTNNVVRVR-----SHIHRRL
Tetraodon_nigroviridis|20390 FDIYAANIDCQWIDITDVPPGNYVLKVTVNPNFQVLESDFTNNVVRVR-----SYIHRRL
Oryzias_latipes|21724        HDTYAANIDCQWIDITDVPPGNYILKVTVNPNLYVLESDFSNNIVRCDVTYTGIYVQTR-
Fugu_rubripes|23032          FDIYAANIDCQWIDITDVPPGNYILKVTVNPNFLVLESDFTNNVVRCDVTYTGVYVQTR-
Gasterosteus_aculeatus|21935 HDTYAANIDCQWIDITDVPPGNYILKVTVNPNFHVLESDFTNNVVRCDIIYTGTYVQTR-
                             .* ********************:********: ******:**:**        ::: * 

Tetraodon_nigroviridis|791   RPNATLSSH
Tetraodon_nigroviridis|20390 RPNATLSSH
Oryzias_latipes|21724        --NCRVTRG
Fugu_rubripes|23032          --HCQVTRW
Gasterosteus_aculeatus|21935 --NCRVSRG
                               :. ::