Orthologs Set ID: EOG4006D0


Orthology Database
OrthoDB4
Gene Symbol(s)
MVB12A

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Anolis carolinensis 7337 132, 243, 340, 470, 593, 645, 730, 798, 858
Bos taurus 23458 132, 243, 340, 470, 617, 730, 792, 858
Callithrix jacchus 23800 132, 243, 340, 470, 617, 730, 801, 858
Canis familiaris 11101 132, 243, 340, 470, 617, 730, 792, 858
Cavia porcellus 23468 115, 243, 340, 470, 617, 730, 792, 858
Dipodomys ordii 7682 132, 243, 340, 470, 617, 730, 792, 858
Echinops telfairi 15925 132, 243, 340, 470, 617, 699, 730, 792, 858, 897
Equus caballus 13886 132, 243, 340, 470, 617, 730, 792, 858
Fugu rubripes 33181 132, 228, 340, 470, 617, 730, 789, 858
Gallus gallus 21465 132, 243, 340, 470, 626, 730, 807, 858
Gasterosteus aculeatus 6585 107, 132, 240, 340, 470, 617, 730, 789, 858
Gorilla gorilla 22562 132, 243, 340, 470, 617, 730, 792, 858
Homo sapiens 38957 132, 243, 340, 470, 617, 730, 792, 858
Loxodonta africana 12620 132, 243, 340, 470, 617, 730, 792, 858
Macropus eugenii 9106 132, 243, 340, 470, 620, 639, 644, 730, 792, 858
Microcebus murinus 9301 34, 49, 59, 71, 132, 243, 340, 470, 587, 593, 617, 730, 792, 858
Monodelphis domestica 15689 132, 253, 340, 470, 593, 730, 792, 858
Mus musculus 42065 132, 243, 340, 470, 617, 730, 792, 858
Myotis lucifugus 7160 470, 552, 612, 624, 730, 792, 822, 858
Ochotona princeps 834 132, 243, 340, 470, 492, 546, 617, 730
Ornithorhynchus anatinus 6288 132, 243, 340, 470, 610, 730, 792
Oryzias latipes 1078 132, 240, 340, 470, 617, 730, 789, 858
Oryzias latipes 22093 249, 340, 470
Pan troglodytes 18587 132, 243, 340, 470, 617, 730, 792, 858
Pongo abelii 13752 132, 243, 340, 470, 617, 730, 792, 858
Procavia capensis 7303 132, 243, 340, 470, 617, 730, 792, 858
Pteropus vampyrus 11712 132, 243, 340, 470, 617, 730, 792
Rattus norvegicus 13882 132, 243, 340, 470, 617, 730, 792, 858
Sorex araneus 13889 470, 617, 730, 792, 858
Spermophilus tridecemlineatus 3440 132, 243, 340, 470, 617
Tupaia belangeri 13804 132, 243, 340, 470, 617, 629, 649, 656, 730, 792, 809, 837, 858
Tursiops truncatus 11671 132, 243, 340, 470, 617, 730, 792, 858, 911
Xenopus tropicalis 23459 132, 246, 340, 470, 608, 730, 792, 858

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 7337 ENSACAT00000004713 100565974 ENSACAG00000004718 MVB12A anoCar1
Bos taurus 23458 ENSBTAT00000005111 507199 ENSBTAG00000003914 MVB12A bosTau4
Callithrix jacchus 23800 ENSCJAT00000026759 100402572 ENSCJAG00000013764 MVB12A calJac3
Canis familiaris 11101 ENSCAFT00000024337 ENSCAFG00000015332 MVB12A canFam2
Cavia porcellus 23468 ENSCPOT00000004541 100733012 ENSCPOG00000004492 MVB12A cavPor3
Dipodomys ordii 7682 ENSDORT00000003275 ENSDORG00000003275 Mvb12a dipOrd1
Echinops telfairi 15925 ENSETET00000015488 ENSETEG00000015488 MVB12A TENREC
Equus caballus 13886 ENSECAT00000010523 100070171 ENSECAG00000010140 MVB12A equCab2
Fugu rubripes 33181 ENSTRUT00000034196 101074878 ENSTRUG00000013367 MVB12A fr2
Gallus gallus 21465 ENSGALT00000029792, NM_001031355 426089 ENSGALG00000013433 MVB12A galGal3
Gasterosteus aculeatus 6585 ENSGACT00000024864 ENSGACG00000018771 MVB12A gasAcu1
Gorilla gorilla 22562 ENSGGOT00000034723 101146517 ENSGGOG00000027234 FAM125A gorGor3
Homo sapiens 38957 ENST00000317040 93343 ENSG00000141971 MVB12A hg19,GRCh37
Loxodonta africana 12620 ENSLAFT00000007872 100667316 ENSLAFG00000007872 MVB12A loxAfr3
Macropus eugenii 9106 ENSMEUT00000009107 ENSMEUG00000009083 MVB12A Meug_1.0
Microcebus murinus 9301 ENSMICT00000008654 ENSMICG00000008654 MVB12A micMur1
Monodelphis domestica 15689 ENSMODT00000005603 100014217 ENSMODG00000004453 MVB12A monDom5
Mus musculus 42065 ENSMUST00000034272 73711 ENSMUSG00000031813 Mvb12a mm9
Myotis lucifugus 7160 ENSMLUT00000007063 102426578 ENSMLUG00000007066 MVB12A myoLuc1
Ochotona princeps 834 ENSOPRT00000006347 ENSOPRG00000006351 MVB12A OchPri2.0
Ornithorhynchus anatinus 6288 ENSOANT00000023019 ENSOANG00000014610 MVB12A ornAna1
Oryzias latipes 1078 ENSORLT00000018842 101156951 ENSORLG00000015039 MVB12A oryLat2
Oryzias latipes 22093 ENSORLT00000016635 ENSORLG00000013275 mvb12bb oryLat2
Pan troglodytes 18587 ENSPTRT00000019679 455838 ENSPTRG00000010673 MVB12A panTro2
Pongo abelii 13752 ENSPPYT00000011309 100457421 ENSPPYG00000009713 MVB12A ponAbe2
Procavia capensis 7303 ENSPCAT00000004463 ENSPCAG00000004483 MVB12A proCap1
Pteropus vampyrus 11712 ENSPVAT00000007880 ENSPVAG00000007880 MVB12A pteVam1
Rattus norvegicus 13882 ENSRNOT00000024413, NM_199375 290635 ENSRNOG00000017949 Mvb12a rn4
Sorex araneus 13889 ENSSART00000013674 ENSSARG00000013672 MVB12A sorAra1
Spermophilus tridecemlineatus 3440 ENSSTOT00000003440 101967020 ENSSTOG00000003448 Mvb12a speTri1
Tupaia belangeri 13804 ENSTBET00000013805 ENSTBEG00000013794 MVB12A tupBel1
Tursiops truncatus 11671 ENSTTRT00000002491 101330479 ENSTTRG00000002491 MVB12A turTru1
Xenopus tropicalis 23459 ENSXETT00000006643 100127799 ENSXETG00000003055 mvb12a xenTro2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 4560 ENSACAP00000004607 100565974 ENSACAG00000004718 MVB12A anoCar1
Bos taurus 14509 ENSBTAP00000005111 507199 ENSBTAG00000003914 MVB12A bosTau4
Callithrix jacchus 16029 ENSCJAP00000025321 100402572 ENSCJAG00000013764 MVB12A calJac3
Canis familiaris 23993 ENSCAFP00000022592 ENSCAFG00000015332 MVB12A canFam2
Cavia porcellus 18580 ENSCPOP00000004052 100733012 ENSCPOG00000004492 MVB12A cavPor3
Dipodomys ordii 7217 ENSDORP00000003063 ENSDORG00000003275 Mvb12a dipOrd1
Echinops telfairi 12538 ENSETEP00000012555 ENSETEG00000015488 MVB12A TENREC
Equus caballus 8149 ENSECAP00000008131 100070171 ENSECAG00000010140 MVB12A equCab2
Fugu rubripes 34070 ENSTRUP00000034070 101074878 ENSTRUG00000013367 MVB12A fr2
Gallus gallus 21036 ENSGALP00000029145 426089 ENSGALG00000013433 MVB12A galGal3
Gasterosteus aculeatus 24550 ENSGACP00000024815 ENSGACG00000018771 MVB12A gasAcu1
Gorilla gorilla 17725 ENSGGOP00000026798 101146517 ENSGGOG00000027234 FAM125A gorGor3
Homo sapiens 1131 ENSP00000324810 93343 ENSG00000141971 MVB12A hg19,GRCh37
Loxodonta africana 14048 ENSLAFP00000006610 100667316 ENSLAFG00000007872 MVB12A loxAfr3
Macropus eugenii 8295 ENSMEUP00000008292 ENSMEUG00000009083 MVB12A Meug_1.0
Microcebus murinus 7881 ENSMICP00000007883 ENSMICG00000008654 MVB12A micMur1
Monodelphis domestica 18028 ENSMODP00000005485 100014217 ENSMODG00000004453 MVB12A monDom5
Mus musculus 41959 ENSMUSP00000034272 73711 ENSMUSG00000031813 Mvb12a mm9
Myotis lucifugus 6456 ENSMLUP00000006454 102426578 ENSMLUG00000007066 MVB12A myoLuc1
Ochotona princeps 726 ENSOPRP00000005821 ENSOPRG00000006351 MVB12A OchPri2.0
Ornithorhynchus anatinus 24644 ENSOANP00000023015 ENSOANG00000014610 MVB12A ornAna1
Oryzias latipes 17983 ENSORLP00000018841 101156951 ENSORLG00000015039 MVB12A oryLat2
Oryzias latipes 15773 ENSORLP00000016634 ENSORLG00000013275 mvb12bb oryLat2
Pan troglodytes 12209 ENSPTRP00000018210 455838 ENSPTRG00000010673 MVB12A panTro2
Pongo abelii 6264 ENSPPYP00000010885 100457421 ENSPPYG00000009713 MVB12A ponAbe2
Procavia capensis 6860 ENSPCAP00000004186 ENSPCAG00000004483 MVB12A proCap1
Pteropus vampyrus 11037 ENSPVAP00000007438 ENSPVAG00000007880 MVB12A pteVam1
Rattus norvegicus 10241 ENSRNOP00000024413 290635 ENSRNOG00000017949 Mvb12a rn4
Sorex araneus 12344 ENSSARP00000012345 ENSSARG00000013672 MVB12A sorAra1
Spermophilus tridecemlineatus 3090 ENSSTOP00000003078 101967020 ENSSTOG00000003448 Mvb12a speTri1
Tupaia belangeri 11954 ENSTBEP00000011960 ENSTBEG00000013794 MVB12A tupBel1
Tursiops truncatus 11031 ENSTTRP00000002334 101330479 ENSTTRG00000002491 MVB12A turTru1
Xenopus tropicalis 6781 ENSXETP00000006643 100127799 ENSXETG00000003055 mvb12a xenTro2

multiple sequence alignment in CLUSTALW format


Oryzias_latipes|22093              ------------------------------------------------------------
Oryzias_latipes|1078               ------------------------------ATGTCTGTCAATCAACAAGGCATGCCTCGA
Gasterosteus_aculeatus|6585        ------------------------------ATGTCGTTGATCGAGCACGGGTCAGTCCGG
Fugu_rubripes|33181                ------------------------------ATGGAGCGTGGGAGCGGC------GTTCGT
Xenopus_tropicalis|23459           ------------------------------------------ATGGAGAACACTTCTACA
Gallus_gallus|21465                ------------------------------------ATGGCGGCGGAGGAGGAAGCGGCT
Anolis_carolinensis|7337           ------------------------------------------------------------
Ornithorhynchus_anatinus|6288      ------------------------------ATGGATGCGGCCGCCGCGCCC------ACC
Ochotona_princeps|834              ------------------------------ATGGAGCCGGGGTCTGCGCCCGACGCGGCG
Tupaia_belangeri|13804             ------------------------------ATGGAGTCAGGGTCCGGGACCGAATCGGCA
Microcebus_murinus|9301            ------------------------------ATGGAGCCCGGGCCGCGGGCGGACGCGGCG
Myotis_lucifugus|7160              ------------------------------------------------------------
Mus_musculus|42065                 ------------------------------ATGGAT------CCCGGGACGGACTCGGCG
Rattus_norvegicus|13882            ------------------------------ATGGAT------CCCGGGACGGATTCAACG
Dipodomys_ordii|7682               ------------------------------ATGGATCCCGCGCCC------GATGCGGCG
Sorex_araneus|13889                ------------------------------------------------------------
Cavia_porcellus|23468              ------------------------------ATGCAGCCCGCGCCCGGACCCGACGCAGCG
Echinops_telfairi|15925            ------------------------------ATGGATCCCGGACCCGGGAACGACTCGTTG
Callithrix_jacchus|23800           ------------------------------ATGGATCCCGTACCCGGGACCGACTCGGCG
Pongo_abelii|13752                 ------------------------------ATGGATCCCGTACCCGGGACAGACTCCGTG
Homo_sapiens|38957                 ------------------------------ATGGATCCCGTACCCGGGACAGACTCGGCG
Gorilla_gorilla|22562              CGACCCCGCCTTCGGCGCTCGGCTCGCAGGATGGATCCCGTACCCGGGACAGACTCGGCG
Pan_troglodytes|18587              ------------------------------ATGGATCCCGTACCCGGGACAGACTCGGCG
Loxodonta_africana|12620           ------------------------------------TCGGGGCCCGGGAACGACTCGGCG
Procavia_capensis|7303             ------------------------------ATGGATCTCGGGCCGGGGAACGACTCGGCA
Equus_caballus|13886               ------------------------------ATGGATCCTGGGCCCGGGCCCGACGCGGCG
Spermophilus_tridecemlineatus|3440 ------------------------------ATGGATCCCGGACCCGGGCCCGACGCGACG
Pteropus_vampyrus|11712            ------------------------------ATGGATCTCGGGCAC------GACGCGGCG
Canis_familiaris|11101             ------------------------------ATGGATCCAGGACCGGGGACCGACACGGCG
Bos_taurus|23458                   ------------------------------ATGGATCCGGGGCCCGGGGCCAACGGGATG
Tursiops_truncatus|11671           ------------------------------ATGGATCCGGGGTCCGGGGCCGACGCGGCC
Monodelphis_domestica|15689        ------------------------------ATGGATCCCGGGCCCGCCCCTGACGGGGCC
Macropus_eugenii|9106              ------------------------------ATGGATTCCGGGCCCGCCCCTGAAGGGGCC
                                                                                               

Oryzias_latipes|22093              ------------------------------------------------------------
Oryzias_latipes|1078               CCAGTCACTGCGGTGGCTTGGACCTCCAACTCCTCCACCTGCCCTAAAGACTTCACC---
Gasterosteus_aculeatus|6585        CCAGTTACAGCGGTCGGCTGGACCTCCAACACCGGCACCTGCCCCAATAAGTACACAACT
Fugu_rubripes|33181                CCAGTTACGGCAGTGGCGTGGACCTCCAACGCCAGCACCTGCCCTAAAGATTTCATC---
Xenopus_tropicalis|23459           CCCATCACTGGATTAGCCTGGATATCTAGCGTCACTCTCTGTCCCAGGACTTACAAT---
Gallus_gallus|21465                CCGCTGAGCGGTGTGGGCTGGGCGGCGGGGCCCGAGTCGGCTCCAGCGGGCTGGAGC---
Anolis_carolinensis|7337           CCGCTGACCGGCCTCGCCTGGACCTCGGCCAACGTGGCAAGCGCG---GGATGGACT---
Ornithorhynchus_anatinus|6288      CCCTTGGCCGGACTGGCCTGGGTTCCGGCTGCGGCCGCTCCCCCGAGGGGCTACAGC---
Ochotona_princeps|834              CCTCTGGCCGGCCTGGCCTGGTCGTCGGCCTCGGCGCCGCCGCCGCGGGGCTTCAGT---
Tupaia_belangeri|13804             CCGTTGGCCGGGCTGGCCTGGTCATCGGCTTCGGCACCTCCTCCACGGGGATTCAGT---
Microcebus_murinus|9301            CCGCTGGCTGGCCTGGTGTGGTCGTCGGCCTCGGCGTCTCCGCCGCGGGGGTTCAGC---
Myotis_lucifugus|7160              ------------------------------------------------------------
Mus_musculus|42065                 CCGCTTGCTGGCTTGGTTTGGTCGTCGGCCTCGGCGCCGCCGCCGCCGGGTTTCAGC---
Rattus_norvegicus|13882            CCGCTTGCCGCCCTGGTTTGGTCGTCCGCCTCGGCGCCGCCGCCGCCGGGTTTCAGC---
Dipodomys_ordii|7682               CCGCTGTCCGGCCTGGTCTGGTCGTCGGCCTCGGCGCCCCCGCCGCGGGGATTCAGC---
Sorex_araneus|13889                ------------------------------------------------------------
Cavia_porcellus|23468              CCGCTGGCCAGCCTGGCTTGGTCGTCGGCCTCGGCGCCGCCGCCGCGGGGATTCAACCGC
Echinops_telfairi|15925            CCGCTGACCGGCCTGGCCTGGTCCTCGGCCTCGGCGCCCCCGCCGCGAGGATTCAGC---
Callithrix_jacchus|23800           CCGCTGGCCGGCCTGGCCTGGTCGTCGGCCTCTGCACCCCCGCCTCGGGGGTTCAGC---
Pongo_abelii|13752                 CCGCTGGCTGGCCTGGCCTGGTCGTCGGCCTCTGCACCCCCGCCGCGGGGTTTCAGC---
Homo_sapiens|38957                 CCGCTGGCTGGCCTGGCCTGGTCGTCGGCCTCTGCACCCCCGCCGCGGGGGTTCAGC---
Gorilla_gorilla|22562              CCGCTGGCTGGCCTGGCCTGGTCGTCGGCCTCTGCACCCCCGCCGCGGGGGTTCAGC---
Pan_troglodytes|18587              CCGCTGGCTGGCCTGGCCTGGTCGTCGGCCTCTGCACCCCCGCCGCGGGGGTTCAGC---
Loxodonta_africana|12620           CCTCTGGCCGGCTTGGCCTGGTCATCGGCCTCGGCGCCCCCGCCGCGAGGGTTCAGC---
Procavia_capensis|7303             CCGCTGACTGGCTTGGCCTGGTCGTCGGCCTCGGCGCCCCCGCCGCGAGGATTCAGC---
Equus_caballus|13886               CCGCTGACTGGCCTGGCCTGGTCGTCGGCCTCGGCGCCCCCGCCGCGGGGATTCAGC---
Spermophilus_tridecemlineatus|3440 CCACTAGCCAGCCTGGTCTGGTCGTCAGCCTCGGCGCCCCCGCCGCGTGGATTCAGC---
Pteropus_vampyrus|11712            CCCCTGACTGGCCTGGTCTGGTCGTCAGCCTCGGCGGCTCCGCCGCGGGGATTCAGT---
Canis_familiaris|11101             CCGCTAACTGGCCTGGTCTGGTCGTCGGCGTCGGCGCCTCCGCCGCGGGGATTCAGT---
Bos_taurus|23458                   CCGTTGGCTGGCTTAGCCTGGTCGTCGGCCTCGGCGCCCCCGCCGCGGGGATTCAGT---
Tursiops_truncatus|11671           CCGTTGGCTGGTTTGGCCTGGTCGTCGGCCTCGGGGCCCCCGCCGCGGGGGTTCAGT---
Monodelphis_domestica|15689        CCGATAGCTGGCCTGGCCTGGGCTTTGGCTTCTGCTGTTCCGCCCCGGGGCTACAGC---
Macropus_eugenii|9106              CCGATAGCCGGCCTGGCCTGGGCTTTGGCTTCGGCCGTCCCGCCCCGGGGCTACAGC---
                                                                                               

Oryzias_latipes|22093              ------------gTTGCACAAACAACAGATGGTGGTGACGCCGACCTGTGGAAGGACGGC
Oryzias_latipes|1078               ---------CTGATCAATATCACAGAAGACGGCGTCGCAGCAAATTTCACACGC------
Gasterosteus_aculeatus|6585        ---------CAAATCAGCATCACAGAAGACGGAGCAGCAGCAAACTTTACTCGCAGC---
Fugu_rubripes|33181                ---------ATGATCAACGTCACGGAAGACGGAGCAGCGGCAAACTTCACGCGCAGC---
Xenopus_tropicalis|23459           ---------ATGATTGTGGCAACAGTGGAAGGAGCATCTGCTAACTTTCTTAAGGGG---
Gallus_gallus|21465                ---------GTGATCACCACCAGCGTTGAGGGCAGCGCGGCCAACCTGGGCAAAGGC---
Anolis_carolinensis|7337           ---------TCGATCACATCAACCGTGGAAGGAACATCTGCAAACTTTGGGAAAGGA---
Ornithorhynchus_anatinus|6288      ---------GCGATTTCGACCACCGTGGAGGGAGCACCTGCCAACTTCGGAAAAGGG---
Ochotona_princeps|834              ---------GCGATCTCCTGCACCGTGGAGGGCACCCCCGCCAGCTTCGGCAAGAGC---
Tupaia_belangeri|13804             ---------GCGATCTCCTGCACCGTCGAGGGGACCCCCGCCAGCTTCGGCAAGAGC---
Microcebus_murinus|9301            ---------GCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---
Myotis_lucifugus|7160              ------------------------------------------------------------
Mus_musculus|42065                 ---------GCGATCACCTGCACCGTGGAGGGCGGGACGGCCAGCTTCGGCCGAGGC---
Rattus_norvegicus|13882            ---------GCGATCACCTGTACCGTGGAGGGCGCGACGGCCAGCTTCGGCCGAGGC---
Dipodomys_ordii|7682               ---------GCGATCGCCTGCACCGTGGAGGGCGCGCCCGCCAGCTTCGGCAAGGGC---
Sorex_araneus|13889                ------------------------------------------------------------
Cavia_porcellus|23468              GTTCCCCTGCAGATCTCCTGCACCGTGGAGGGCGCGCCCGCCAGCTTCGGCAAGAGC---
Echinops_telfairi|15925            ---------GCTGTCTCCTGCACTGTCGAGGGGGCGCCCGCCAGCTTTGGCAAGAGC---
Callithrix_jacchus|23800           ---------GCGATCTCCTGCACCGTCGAGGGGGCACCCGCCAACTTTGGCAAGACC---
Pongo_abelii|13752                 ---------GCGATCTCCTGCACCGTCGAGGGGGCACCCGCCAGCTTTGGCAAGAGC---
Homo_sapiens|38957                 ---------GCGATCTCCTGCACCGTCGAGGGGGCACCCGCCAGCTTTGGCAAGAGC---
Gorilla_gorilla|22562              ---------GCGATCTCCTGCACCGTCGAGGGGGCACCCGCCAGCTTTGGCAAGAGC---
Pan_troglodytes|18587              ---------GCGATCTCCTGCACCGTCGAGGGGGCACCCGCCAGCTTTGGCAAGAGC---
Loxodonta_africana|12620           ---------GCGATCTCTTGCACCGTCGAGGGGACGCCGGCCAGCTTCAGCAAGAGC---
Procavia_capensis|7303             ---------GCGATCTCTTGTACCGTCGAGGGGACGCCCGCCAGCTTCGGCAAGAGC---
Equus_caballus|13886               ---------GCGATCTCCAGCACCGTGGAGGGGACGCCCGCCAGCTTCGGCAAGAGC---
Spermophilus_tridecemlineatus|3440 ---------GCGATCTCCTGCACTGTGGAGGGCGCGCCCGCCAGCTTTGGCAAGAGC---
Pteropus_vampyrus|11712            ---------GCGATCTCTTGCACCGTGGAGGGAGCGCCCGCCAGTTTCGGCAAGAGC---
Canis_familiaris|11101             ---------GCGATCTCCTGCACCGTGGAAGGGGCGCCCGCCAGCTTCGGCAAGACC---
Bos_taurus|23458                   ---------GCGATCTCCTGCACTGTGGAGGGGACGCCCGCCAGCTTCGGCAAGACT---
Tursiops_truncatus|11671           ---------GCGATCTCCTGCACTGTGGAGGGGGCGCCCGCCAGCTTCGGCAAGACT---
Monodelphis_domestica|15689        ---------GCGATCACCAGCACAGTAGAGGGGACACCTGCCAACTTCGGAAAGGGG---
Macropus_eugenii|9106              ---------GCGATCACAAGCACAGTGGAGGGGACACCTGCCAACTTTGGAAAGGGA---
                                                                                               

Oryzias_latipes|22093              TTATTCAAATCCAAGGTCACCCGTTACCTGTGTTTCTCCAAAGAAATAGTAAGCATGACT
Oryzias_latipes|1078               ---TTTGGGATCAAGTCCGGGTATTACCTCTGTTACAGC------------------AAG
Gasterosteus_aculeatus|6585        ---TTTGCGATTAAATCTGGATATTACCTCTGTTACAGC------------------AAG
Fugu_rubripes|33181                ---TTTGGGATGAAATCCGGATACTACCTTTGTTTCAGT------AAGCTTCCTCTGCAG
Xenopus_tropicalis|23459           ---TTTAATCAGAAATCAGCTGTGTACCTTGGTTACAGC---------------ACAGCC
Gallus_gallus|21465                ---TTCGGACACAAGGGCGGGTAC---CTGTGTGTGAGC------------ACCGCAGCT
Anolis_carolinensis|7337           ---TTTGCACAGAAGTCTGGTTACTACCTCTGTTATACG------TCAATGATAAACAAT
Ornithorhynchus_anatinus|6288      ---TTTGCGCAAAAGTCCGGGTATTTCCTCTGCTACTTG------ACCTTGGGCACCTCT
Ochotona_princeps|834              ---TTCGCGCAGAAGTCGGGCTACTTCCTGTGCCTCTGC------GCCCTCGGCAGCCTG
Tupaia_belangeri|13804             ---TTCGCGCAGAAATCGGGTTACTTCCTGTGCCTGAGT------CCTCTGGCCAGCCTG
Microcebus_murinus|9301            ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNN
Myotis_lucifugus|7160              ------------------------------------------------------------
Mus_musculus|42065                 ---TTCGCGCAGAAAGCCGGCTACTTCCTGTGCCTGAGC------ACGCTGGGCATCCCG
Rattus_norvegicus|13882            ---TTCGCGCAGAAGGCCGGCTACTTCCTGTGCCTGAGC------ACACTGGGTATCCCA
Dipodomys_ordii|7682               ---TTCGCGCAGAAGTCCGGCTACTTCCTGTGCCTCGGC------GCCCTGGGCAGCCTG
Sorex_araneus|13889                ------------------------------------------------------------
Cavia_porcellus|23468              ---TTCGCGCAGAAGTCGGGCTACTTCCTGTGCCTGAGC------GCCCTGGGCAGCCTG
Echinops_telfairi|15925            ---TTCGCGCAGAAATCCGGCTACTTCCTGTGCCTCTGC------CCGCTGGGCAGCCTG
Callithrix_jacchus|23800           ---TTCGCGCAGAAATCTGGCTACTTCCTGTGCCTTAGT------ACTCTGGGCAGCCTA
Pongo_abelii|13752                 ---TTCGCGCAGAAATCTGGCTACTTCCTGTGCCTTAGT------TCTCTGGGCAGCCTA
Homo_sapiens|38957                 ---TTCGCGCAGAAATCTGGCTACTTCCTGTGCCTTAGT------TCTCTGGGCAGCCTA
Gorilla_gorilla|22562              ---TTCGCGCAGAAATCTGGCTACTTCCTGTGCCTTAGT------TCTCTGGGCAGCCTA
Pan_troglodytes|18587              ---TTCGCGCAGAAATCTGGCTACTTCCTGTGCCTTAGT------TCTCTGGGCAGCCTA
Loxodonta_africana|12620           ---TTCGCGCAGAAATCCGGCTACTTTCTGTGTCTCAGC------CCCCTGGGCAGCCTC
Procavia_capensis|7303             ---TTCGCTCAGAAGTCCGGCTACTTCCTGTGCCTCAGT------CCCCTGGGCAGCCTC
Equus_caballus|13886               ---TTCGCGCAGAAATCTGGCTACTTCCTGTGTGTCAGT------CTCTTGGGCAGTCTG
Spermophilus_tridecemlineatus|3440 ---TTCGCGCAGAAATCTGGCTACTTCCTGTGCCTTAGT------CCCCTGGGCAGCCTA
Pteropus_vampyrus|11712            ---TTCGCACAGAAATCTGGTTACTTCCTGTGTCTCAGT------ACCTTGGGCAATTTG
Canis_familiaris|11101             ---TTCGCGCAGAAGTCTGGCTACTTTCTGTGCCTCAGT------TCTTTGGGCAGCCTG
Bos_taurus|23458                   ---TTCGCTCAGAAATCTGGCTACTTCCTGTGCCTCAAT------CCTTTGGGCAGCCTA
Tursiops_truncatus|11671           ---TTCGGGCAGAAATCCGGCTACTTCCTGTGTCTCAAT------CCTTTGGGCAGCCTA
Monodelphis_domestica|15689        ---TTTGCACAAAAGTCTGGCTACTTCCTGTGCCTCAGTACTGGGGAAATTGGGACTGGC
Macropus_eugenii|9106              ---TTTGCACAAAAGTCTGGCTACTTCCTGTGCCTCAGT---------------------
                                                                                               

Oryzias_latipes|22093              GCAAACTTTAGGCCAGAAGTTGTTGTGGATATAAAGCTAATTGACAGCAAGGATCCATTA
Oryzias_latipes|1078               GACTTGGCGGGCGGCGTGGTGGTGACGGACATTCAGATCATTACAGACAAGGAGGCCATT
Gasterosteus_aculeatus|6585        GAGTTGACATCTGGTATGGTGGTGTCGGACATTCAGCTCATCTCAGACAAGGAGGCTATT
Fugu_rubripes|33181                GATTTAGCTTGCGGGATGGTAGTCGCAGATATTCAGCTTATTTCTGATAAGGAATCTATT
Xenopus_tropicalis|23459           CTAGAGGGTCTGGAGCAAGTTATCACTGACATTCAAATACTGAATGAAAAGACTGTGCTG
Gallus_gallus|21465                CCGGGCTCGGCCGGGCCTGTGGTGACCGATGTCCAGGTGCTGAGCGATCGAAATCCGCAA
Anolis_carolinensis|7337           ATGAATCCTGGAGGAGATGTACTCTATGACGTCATAATCTTGAGTGAGAAAACACCATTG
Ornithorhynchus_anatinus|6288      GAGAACACCCAGCAGAGTGTGGTGAACGACATCCAGATTCTGAGCGAAAAAACACCTCTC
Ochotona_princeps|834              GAGAACCCACAGGAGAACGTGGTGGTGGACATTCAGATCGTGGTGGACAAGAGCTCCGTG
Tupaia_belangeri|13804             GAGAATCCGCAAGAGAATGTCGTGGCCGAGATCCAGGTCGTGATGGACAAGAGTCCCCTC
Microcebus_murinus|9301            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Myotis_lucifugus|7160              ------------------------------------------------------------
Mus_musculus|42065                 GAGAACCCTCAGGACAATGTGGTAGTGGACATGCAGATCGTGATGGACAAGGGCCCACTG
Rattus_norvegicus|13882            GAGAACCCTCAGGACAATGTGGTAGTGGACATGCAGATCGTGATGGACAAGGGGCCCCTG
Dipodomys_ordii|7682               GAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Sorex_araneus|13889                ------------------------------------------------------------
Cavia_porcellus|23468              GAGAACCCACAAGACAACGTGGTGGCGGACGTCGCGATCGTAGCTGACAAGAGCGCCCTG
Echinops_telfairi|15925            GAGAACCCGCAGGAAAATGTCGTGGCTGAGATCCAGGTCCTGGCGGACAAGAGCCCACTC
Callithrix_jacchus|23800           GAGAACCCGCTGGAGAACGTGGTGGGCGATATCCAGATCGTGGTGGACAAGAGCCCCCTG
Pongo_abelii|13752                 GAGAACCCGCAGGAGAACGTGGTGGCCGATATCCAGATCGTGGTGGACAAGAGCGCCCTG
Homo_sapiens|38957                 GAGAACCCGCAGGAGAACGTGGTGGCCGATATCCAGATCGTGGTGGACAAGAGCCCCCTG
Gorilla_gorilla|22562              GAGAACCCGCAGGAGAACGTGGTGGCCGATATCCAGATCGTGGTGGACAAGAGCCCCCTG
Pan_troglodytes|18587              GAGAACCCGCAGGAGAACGTGGTGGCCGATATCCAGATCGTGGTGGACAAGAGCCCCCTG
Loxodonta_africana|12620           GAGAACCCGCAGGAGAACGTGGTGGCCGAGATCCAGGTCCTGGTGGACAAAAGTCCCCTT
Procavia_capensis|7303             GAGAACCCGCAGGAGAACGTAGTAGCTGAGATCCAGATCCTGGTGGACAAAAGCCCCCTC
Equus_caballus|13886               GAGAATCCGCAGGAGAACGTGGTGGCCGAAATCCAGGTCCTGGTGGACAAGAGCCCTCTC
Spermophilus_tridecemlineatus|3440 GAGAACCCGCAGGAGAATGTGGTGGTCGACATCCAGGTCGTGGTGGACAAGAGCTCCCTG
Pteropus_vampyrus|11712            GAGAATCCGCAGGAGAACGTGGTGGCCGATATCCAGATCCTGGTAGACAAGAGCCCCCTC
Canis_familiaris|11101             GAGAATCCGCAGGAGAATGTGGTGGCCGATATCCAGGTCCTGGTGGACAAGAGCCCCCTC
Bos_taurus|23458                   GAGAATCCACAGGAGAACGTGGTGGTCGACATCCAGATCCTAGTGGACAAGAGCCCCCTC
Tursiops_truncatus|11671           GAGAATCCACAGGAGAACGTGGTGGTCGATATCCAGGTCCTGGTGGACAAGAGCCCCCTT
Monodelphis_domestica|15689        AGTGGCAACAGCAAAAATGTGGTTACAGATATCCAAATTCTAAATGAGAAAACACCTCTT
Macropus_eugenii|9106              CCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                                                                               

Oryzias_latipes|22093              CCGGAGTTCTTCACGGCTATGCCAGAAACAATTGACACAAaggaagctgccatgaggaag
Oryzias_latipes|1078               CCTCACGGCTACTGCTACATACCAGAGCACCTGGATTCCAAGGCTGCTGTTTCCAAGAgg
Gasterosteus_aculeatus|6585        CCTCACGGTTACAGCTACATAGAAGAGCACCTCGAACCAAAGGCCTCCGTGTGGAAGAAG
Fugu_rubripes|33181                CCTCATGGTTACTGCTACATAGCAGAGCACCTTGAACCAAAGGCGACCGTCTCGAAGAAG
Xenopus_tropicalis|23459           CCTGTTGGGTATGCTTTCATTGGGGAACACCTAGACCCAAAGATCTCTGTTCCAAAGAAA
Gallus_gallus|21465                CCCGCGGGCTACAGCCGTGCCCCCGAGTTCCCAGAGCCTCGTTCGGGTGTGTCCCGTAAG
Anolis_carolinensis|7337           CCTTCTGGATATACTTATGTTAAAGATTTTTCAGATTCAAAGACATCCGTCTCTAAGAAG
Ornithorhynchus_anatinus|6288      CCCATTGGCTTCTCCTTTATCAACGAATTCCTGGACGCCAAATCCTCGGTGTCCAAGAAG
Ochotona_princeps|834              CCTCCGGGCTTCTCCCCGGTCAGCGACCCCCAGGATTCTANNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|13804             CCGCCAGGCTTCTCCCCGGTCTGCGATCCCCAGGACTCAANNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|9301            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Myotis_lucifugus|7160              ------------------------------------------GCCTCTGTGTCTAAGAAG
Mus_musculus|42065                 CCGTCAGGCTTCTCTGCAGTCAACGACCCTCAGGATATCAAGGCCTCTGTGTCCAAGAAG
Rattus_norvegicus|13882            CCACCAGGCTTCTCTACAGTCAACGACCCTCAGGATGCCAGGACCTCTGTGTCCAAGAAG
Dipodomys_ordii|7682               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGCCTCCGTGTCCAAGAAG
Sorex_araneus|13889                ------------------------------------------GCCTCCATCTCCAAGAAG
Cavia_porcellus|23468              CCGCCCGGCTTCTCCGCGGTCTGCGACCCCTTAGACGCCAAGGCCTCCGTGTCCAAGAAA
Echinops_telfairi|15925            CCGCCCGGCTTCTCTCCTGTCAGCGATCCCCAGGACTCCAAGGCTTCCATGTCCAAGAAG
Callithrix_jacchus|23800           CCGCTGGGCTTCTCCCCGGTCAGCGACCCCATGGACTCCAAGGCCTCTGTGTCCAAGAAG
Pongo_abelii|13752                 CCGCTGGGCTTCTCCCCGGTCTGCGACCCCATGGATTCCAAGGCCTCTGTGTCCAAGAAG
Homo_sapiens|38957                 CCGCTGGGCTTCTCCCCCGTCTGCGACCCCATGGATTCCAAGGCCTCTGTGTCCAAGAAG
Gorilla_gorilla|22562              CCGCTGGGCTTCTCCCCCGTCTGCGACCCCATGGATTCCAAGGCCTCTGTGTCCAAGAAG
Pan_troglodytes|18587              CCGCTGGGCTTCTCCCCCGTCTGCGACCCCATGGATTCCAAGGCCTCTGTGTCCAAGAAG
Loxodonta_africana|12620           CCACCCGGCTTCTCCCCGGTCTGCGACCCCCAGGATTCCAGGGCCTCAGTGTCCAAGAAG
Procavia_capensis|7303             CCACCCGGCTTCTCACCGGTCTGCGACCCCCAGGACTCCAGGGCCTCTGTGTCCAAGAAG
Equus_caballus|13886               CCGCCCGGCTTCTCCCCGGTCTGCGACCCCCTGGACTCCAAGGCCTCCGTGTCCAAGAAG
Spermophilus_tridecemlineatus|3440 CCGCCCGGCTTCTCTCCTGTCTGCGACCCCTTGGACTCCAAGGCCTCTGTGTCCAAGAAG
Pteropus_vampyrus|11712            CCGCCGGGCTTCTCCCCGGTCTGCGACCCCCTGGACTCCAAGGCCTCCATGTCCAAGAAG
Canis_familiaris|11101             CCACCGGGCTTTTCCCCGGTCTGCGACCCCCTGGACTCCAAGGCCTCTGTGTCCAAGAAG
Bos_taurus|23458                   CCGCCGGGATTCTCACCAGTCTGCGACCCCCTGGACTCGAAGGCCTCCGTGTCCAAGAAG
Tursiops_truncatus|11671           CCGCCGGGATTCTTTCCGGTCTGCGACCCCCTGGACTCCAAGGCCTCCGTGTCCAAGAAG
Monodelphis_domestica|15689        CCCAATGGCTTCACCTATATCAGCGAGTTCCTAGACACTAAGGCATCAGTATCAAAAAAG
Macropus_eugenii|9106              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGCATCAGTATCAAAAAAG
                                                                                               

Oryzias_latipes|22093              aggaggttgTGTGTGAAAATGATGCCTCGTGAGGCTGCGGAAAGGGCTATATATGACATA
Oryzias_latipes|1078               aagcgtgtgtgtgtgcgcgtgacCCCAGTGGGCAGCGTGGACACGGCTGTGCTGGAGATC
Gasterosteus_aculeatus|6585        AAACGGGCGTGCATGCTCGTCGTCCCAATGGGCAGCGTGGACACAGCTGTGTTGGACATC
Fugu_rubripes|33181                AAGCGGTTGTGTGCGCGGCTCCTCCCAGTGGGCAGTGTGGACACAGCTGTGTTGGATATC
Xenopus_tropicalis|23459           AAGAGGCTGTGTGTAAAGCAGATGCCTATGCATACTGCAGAAACTGCTGTCTGTGAGATT
Gallus_gallus|21465                AAGCGGCTCTATGTGAGGCTGCAGCCCCGTGGGGCTGCTGAGACGGCCGTGTTTGACATC
Anolis_carolinensis|7337           AAGAGACTGTGTGTCAAGCTAATCCCGTTCGGTGCTGCAGAAACAGCCGTCTTTGACATC
Ornithorhynchus_anatinus|6288      AAAAGAGTCTGCATGAAGCTGGTTCCCCTGGGGGCAACGGATATAGCCGTCTTGGATGTC
Ochotona_princeps|834              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|13804             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|9301            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Myotis_lucifugus|7160              AAGCGCATGTGTATGAAGTTGGTGCCCCTGGGAGCTGCGGACACAGCTGTGTTTGATATC
Mus_musculus|42065                 AAACGCATGTGTGTGAAGCTGATGCCCCTGGGGACAGCTGACGTGGTTGTGAGTGACGTG
Rattus_norvegicus|13882            AAGCGCATGTGTGTGAAGCTGATGCCCCTGGGGACGGCAGACGTGGTAGTGAGTGACGTG
Dipodomys_ordii|7682               AAACGAATGTGCATGAAGCTGATGCCTCTGGGGGCTGCAGATGTGGCTGTGTTTGATGTA
Sorex_araneus|13889                AAGCGCTTGTGTATGAAGCTGGTGCCGCTGGGCGCAGCAGAGATGGTTGTGGTTGATGTC
Cavia_porcellus|23468              AAGCGCATGTGTGTGAAGCTGGTGCCCCTGGGTGCTGCAGACATGGTCGTGTTTGACATC
Echinops_telfairi|15925            AAACGGATGTGTGTGAAGCTGGTGCCCCTGGGGGCTTCGGACACGGCCGTGTTTGACGTC
Callithrix_jacchus|23800           AAACGCATGTGTGTGAAGTTGTTACCCCTGGGGGCTGCGGACACCGCCGTGTTTGATGTC
Pongo_abelii|13752                 AAACGCATGTGTGTGAAGCTGTTGCCCCTGGGAGCCGCGGACACGGCTGTGTTTGATGTC
Homo_sapiens|38957                 AAACGCATGTGTGTGAAGCTGTTGCCCCTGGGAGCCACGGACACGGCTGTGTTTGATGTC
Gorilla_gorilla|22562              AAACGCATGTGTGTGAAGCTCTTGCCCCTGGGAGCTGCGGACATGGCTGTGTTTGATGTC
Pan_troglodytes|18587              AAACGCATGTGTGTGAAGCTGTTGCCCCTGGGAGCCGCGGACACGGCTGTGTTTGATGTC
Loxodonta_africana|12620           AAACGCATGTGTGTGAAGCTGGTGCCCCTGGGGGCTGCAGACACGGCCGTGTTTGACGTC
Procavia_capensis|7303             AAACGGATGTGCGTGAGGCTGGTGCCCTTGGGGGCTGCAGACACAGCCGTGTTTGACGTC
Equus_caballus|13886               AAGCGCATGTGTGTGAGGCTGGTGCCCCTGGGGGCTGTGGACACGGCTGTGTTTGACGTC
Spermophilus_tridecemlineatus|3440 AAACGCATGTGCGTGAAGCTGGTGCCCCTGGGGGCTGCAGACATGGCTGTGTTTGATGTC
Pteropus_vampyrus|11712            AAGCGCATGTGTGTGAAGTTGGTGCCCCTGGGTGCCGCGGACACAGCTGTGTTTGACATT
Canis_familiaris|11101             AAACGCATGTGTGTGAAGCTGGTGCCACTGGGGGCTGCAGACATGGCTGTGTTCGATGTG
Bos_taurus|23458                   AAACGCATGTGCGTGAAGCTGGTGCCCTTGGGGGCCGCGGACACAGCTGTCTTTGACATC
Tursiops_truncatus|11671           AAACGCATGTGTGTGAAGCTGGTGCCCTTGGGGGTCGCGGACACAGCTGTCTTTGACGTC
Monodelphis_domestica|15689        AAACGGGTCTGCATGAAGCTGGTCCCCATTGGAGTGGCTGACATGGCTGTGTTTGATGTC
Macropus_eugenii|9106              AAACGGGTCTGCATGAAGCTGGTCCCTCTTGGAGTGGCTGATACGGCTGTGTTTGATGTC
                                       .    .                             .     .   .    .   . 

Oryzias_latipes|22093              CAAATCACCGCCAAATCTAAGTACCAGGTGGTGAACTACACCTGTATAGGtgaagTAAAC
Oryzias_latipes|1078               AAACTGACAGCCAGAAACAAAATGATGCTGCAGTACTACACATACGTGGGAGACATCAAC
Gasterosteus_aculeatus|6585        AAAGTGACTGCCAAAAGCAAAATGATGCTGCAGCACTACACGTGCCTTGGAGACATCCAC
Fugu_rubripes|33181                AAACTGACAGCCAAAAGCAAAATGATGTTGCATCACCACACATATGTGGGAGACATCCAT
Xenopus_tropicalis|23459           AAATTTTCCATGAAAAGCAAGCATATTGGGGCTCCTTTTGAACGTATTGGTGAAATTAGT
Gallus_gallus|21465                AAACTGAGTGGGAAGAGCAGAGCTGTG---CCTCAGTACATGAAGATCGGGGAAATCGGT
Anolis_carolinensis|7337           CTGCTGAGCAGCAAAAGCAGAGTGGTC---CCAAACTACTTGCGCATAGGGGAAATGGGT
Ornithorhynchus_anatinus|6288      AAGCTGAGTAGCAAGAGCAGAGCTGTG---CCAGGCTACATGCGTGTAGGAGACCTGGGG
Ochotona_princeps|834              NNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|13804             NNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|9301            NNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNGGACATGGGC
Myotis_lucifugus|7160              CGGCTGAGCGGGAAGACCAAGACGGTG---CCTGGATACCTTCGAATAGGGGACATGGGT
Mus_musculus|42065                 AAGCTGAGTGGGAAGACTAAGACCGTG---CCTGGATACCTGCGTGTGGGGGACATTGGT
Rattus_norvegicus|13882            AAGCTCAGTGGGAAAACCAAGACCGTG---CCTGGGTATCTGCGAGTGGGGGACATTGGT
Dipodomys_ordii|7682               CGGCTGAGTGGGAAGACTAAGACTGTG---CCCGGATACCTGCGAGTTGGGGACATGGGT
Sorex_araneus|13889                CGACTCAGTGGCAAGACCAAGACAGTT---CCTGGGTACCATCGTGTGGGGGACATGGGG
Cavia_porcellus|23468              CGGCTCAGTGGGAAGACCAAGACGGTA---CCCGGGTACCTACGCATAGGGGACATGGGC
Echinops_telfairi|15925            CGGCTGAGCGGGAAGACCAAGACGGTG---CCTGGATACCTGCGAGTAGGGGACATGGGT
Callithrix_jacchus|23800           CGGCTGAGTGGGAAGACAAAGACAGTG---CCTGGATACCTTCGAGTAGGGGACATGGGC
Pongo_abelii|13752                 CGGCTGAGTGGGAAGACCAAGACAGTG---CCTGGATACCTTCGAATAGGGGACATGGGC
Homo_sapiens|38957                 CGGCTGAGTGGGAAGACCAAGACAGTG---CCTGGATACCTTCGAATAGGGGACATGGGC
Gorilla_gorilla|22562              CGGCTGAGTGGGAAGACCAAGACAGTG---CCTGGATACCTTCGAATAGGGGACATGGGT
Pan_troglodytes|18587              CGGCTGAGTGGGAAGACCAAGACAGTG---CCTGGATACCTTCGAATAGGGGACATGGGC
Loxodonta_africana|12620           TGCCTGAGCGGGAAGACCAAGACGGTG---CCTGGATACCTACGAGTAGGGGATATGGGT
Procavia_capensis|7303             CGGCTGAGTGGGAAGAACAAGACAGTG---CCTGGGTTCCTGCGAATAGGGGATATGGGT
Equus_caballus|13886               CGGCTGAGCGGGAAGACCAAGACAGTG---CCTGGGTACCTGCGAGTAGGGGACATGGGT
Spermophilus_tridecemlineatus|3440 CGACTGAGCGGAAAGACCAAGACGGTG---CCTGGATACCTTCGAGTAGGGGACATGGGT
Pteropus_vampyrus|11712            CGGCTGAGTGGGAAGACCAAGACTGTG---CCTGGATACCTGCGAGTAGGGGACATGGGT
Canis_familiaris|11101             CGGCTGAGTGGGAAGACCAAGACGGTG---CCTGGATACCTGCGAGTAGGAGACATGGGG
Bos_taurus|23458                   CGACTGAGTGGGAAAACCAAGACAGTC---CCTGGATACCTGCGAGTAGGGGACATGGGG
Tursiops_truncatus|11671           CGGCTGAGTGGGAAAACCAAGACGGTG---CCTGGATACCTGCGAGTAGGGGACATGGGG
Monodelphis_domestica|15689        CGTCTGAGTGGCAAGAACAAAGTGGTG---CCAGGATACATACGTGTTGGGGAAATAGGT
Macropus_eugenii|9106              CGGCTGAGTGGCAAGAGCAGAGTGGTG---CCAGGATACATGCGTGTTGGGGAAATAGGC
                                       .                                         . .. .   .    

Oryzias_latipes|22093              AATATGGGAATATGGTGCAAGGTGGGAGATGTC------------GCTCGT---------
Oryzias_latipes|1078               GGGTACGTTCTGTGGTGCAGTAAGGGGCAGTTTTCTGCC------CCGCCTCCTCAAACC
Gasterosteus_aculeatus|6585        GGCTATGTGTTGTGGTGCAGAAAGGGACATTTTTCCAGC------CCGATGCCTAAAGCA
Fugu_rubripes|33181                GGCTATGTGCTGTGGTGCAGAAAGGGCTACTTTTCCAGC------CCTTTTCCTCAGGCA
Xenopus_tropicalis|23459           GGACTGGTATTTTGGTGCAGAAAAGGTAGTGTACCTTCT------CCCAAACCAACGCCA
Gallus_gallus|21465                AGCTTTGCCATCTGGTGTAAGAAAGGAGCCCTTCCCCAATGCAGCCCTCCTCCTGTCCCC
Anolis_carolinensis|7337           GGATTTGCACTTTGGTGTCGAAAGGAGTCTGTTGCCAAA------CCCACACCTCTCCCT
Ornithorhynchus_anatinus|6288      GGCTTTGCAATTTGGTGTAAAAAAGGAAACATCTCCAAG------CCCCAACCGTTGCCT
Ochotona_princeps|834              NNNNNNNNNNNNTGGTGCCGGAAAGTCAAGGTG------------CCCAAGCCGGTGCCC
Tupaia_belangeri|13804             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------NNNNNNNNNNNNNNN
Microcebus_murinus|9301            GGCTTTGCCATCTGGTGCAAGAAGGCCAAGGCC------------CCCAGGCCGGTGCCC
Myotis_lucifugus|7160              GGCTTTGCCATCTGGTGCAAGAAGGCAAAGGCT------------CCTCGGCCAGTGCCC
Mus_musculus|42065                 GGCTTTGCCATCTGGTGCAAGAAATCCAAAGCC------------CCAAGGCCGGTGCCC
Rattus_norvegicus|13882            GGCTTTGCCATCTGGTGCAAGAAATCCAAAGCC------------CCAAAGCTGGTGCCC
Dipodomys_ordii|7682               GGCTTTGCCATCTGGTGCAAGAAGGCCAAGGCA------------CCACGGCCGGTGCCC
Sorex_araneus|13889                GGCTTCGCCATCTGGTGCAAGACGGCCAAGGCC------------CCACGGCCAGTGCCC
Cavia_porcellus|23468              GGCTTCGCCATCTGGTGCAAGAAGGCCAAAGCC------------CCAAGGCCGGTGCCC
Echinops_telfairi|15925            GGCTTTGCCATCTGGTGCAAGAAGGCCAAGACC------------CCGAAGCCAGTGCCT
Callithrix_jacchus|23800           GGCTTTGCCATCTGGTGCAAGAAAGCGAAGGTC------------CCGAGGCCCGTGCCC
Pongo_abelii|13752                 GGCTTTGCTATCTGGTGCAAGAAGGCCAAGGCC------------CCGAGGCCAGTGCCC
Homo_sapiens|38957                 GGCTTTGCCATCTGGTGCAAGAAGGCCAAGGCC------------CCGAGGCCAGTGCCC
Gorilla_gorilla|22562              GGCTTTGCCATCTGGTGCAAGAAGGCCAAGGCC------------CCGAGGCCAGTGCCC
Pan_troglodytes|18587              GGCTTTGCCATCTGGTGCAAGAAGGCCAAGGCC------------CCCAGGCCAGTGCCC
Loxodonta_africana|12620           GGCTTTGCCATCTGGTGCAAGAAGGCCAAGGCC------------CCGCGGCCAGTGCCC
Procavia_capensis|7303             GGCTTTGCCATCTGGTGTAAGAAGGCCAAGGCC------------CCGAGACCAGTGCCC
Equus_caballus|13886               GGCTTCGCCATCTGGTGCAAGAAGGCCAAGGTC------------CCTCGGCCGGTGCCC
Spermophilus_tridecemlineatus|3440 GGCTTTGCCATCTGGTGCAAGAAGGCCAAGGCC------------CCAAAGCCAGTGCCC
Pteropus_vampyrus|11712            GGCTTTGCCATCTGGTGCAAGAAAGCAAAGGCC------------CCCCGGCCAGTACCC
Canis_familiaris|11101             GGCTTTGCCATTTGGTGCAAGAAGGCCAAGGCC------------CCAAGGCCGGTGCCC
Bos_taurus|23458                   GGCTTTGCCATTTGGTGCCGGAAGGCCAAGGCC------------CCTCGGCCAGTGCCC
Tursiops_truncatus|11671           GGCTTCGCCATCTGGTGCAAGAAGGCCAAGGCC------------CCGCGGCCAGTGCCC
Monodelphis_domestica|15689        GGCTTTGCAGTTTGGTGTAAGAAAGGTAAAGTCTCCAAG------CCCAAGCCCCTTCCT
Macropus_eugenii|9106              GGCTTTGCAGTTTGGTGTAAGAAAGGTAAAGTCTCCAAG------CCCAAGCCCCTTCCT
                                         .   . .....                                           

Oryzias_latipes|22093              ------------------------------------------------------------
Oryzias_latipes|1078               AAGCCCCGCAGCGTCAGCCTTGACCTGCACCGGCTCTCTCTGGAGCAGGTCAACCCTCCC
Gasterosteus_aculeatus|6585        AAGCCCCGGAGTGTCAGCCTGGACATCCGCAGGCTCTCATTGGAGCAGCCGTCTGCTCCT
Fugu_rubripes|33181                AAGCCCCGCAGCGTAAGCTTGGACTTCGGCAGACTGAGCCTGGACCAGCCGACTGCCCCT
Xenopus_tropicalis|23459           AAACCTCGAAACATTACTAGTGGCATTAAAGGGCTTTCTCTCGATATCAACACCCCAGTC
Gallus_gallus|21465                AAGCCCAGGACAGTCAGCCTGGGGCTGAAGCAGCTCTCGTTGGCCGAC------------
Anolis_carolinensis|7337           AAGCCACGGAATATCAGTTTAGAAATGAAAAGGCTCTCGCTAGAACCAGAAAAT------
Ornithorhynchus_anatinus|6288      CGTTCGAGGAACGTCACCTCAGAGTTGAAGAGTCTCTCCCTGGACCTACCTCGG------
Ochotona_princeps|834              AAGCCC---GGTCTCAGCCGTGACCTGCAGGGGCTGTCGCTGGACACGCCCAGC------
Tupaia_belangeri|13804             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------
Microcebus_murinus|9301            AAGCCCCGAGGTCTCAGCCGGGACATGCGGGGGCTCTCCCTGGACCCAGCCAGC------
Myotis_lucifugus|7160              AAGCCTCGAGCTCTCAGCCGGGACATGCAGGGCTGT------------------------
Mus_musculus|42065                 AAGCCCCGCACGCTCAGCCAGGACATGCGAGGCCTCTCCCTGGACCCACCCAAA------
Rattus_norvegicus|13882            AAGCCCGGCACACTCAGCCAGGACATGCGAGGCCTCTCACTGGACCAACCCAAA------
Dipodomys_ordii|7682               AAGCCCCGAGCGCTCAGCCGTGACATGCGGGGCCTCTCGCTGGACCCCGCCGGC------
Sorex_araneus|13889                AAGCCCAGGGCGCTCAGCAAGGAGATGCAGGGTCTGTCCCTGGACCCTCCAGGC------
Cavia_porcellus|23468              AAGCCCCGCAGCCTGAGCAAGGAAGTACGTGGCCTCTCCCTGGATGCCACCAGC------
Echinops_telfairi|15925            AAGCCCCGTGGCCTCAGCCGGGACATGCGGGGCCTCTCCCTGGACCCGCCGGGC------
Callithrix_jacchus|23800           AAGCCCCGAGGTCTCAGCCGGGACATGCAGAGCCTCTCTCTGGATGCACCCAGC------
Pongo_abelii|13752                 AAGCCCCGAGGTCTCAGCCGGGACATGCAGGGCCTCTCTCTGGATGCAGCCAGC------
Homo_sapiens|38957                 AAGCCCCGAGGTCTCAGCCGGGACATGCAGGGCCTCTCTCTGGATGCAGCCAGC------
Gorilla_gorilla|22562              AAGCCCCGAGGTCTCAGCCGGGACATGCAGGGCCTCTCTCTGGATGCAGCCAGC------
Pan_troglodytes|18587              AAGCCCCGAGGTCTCAGCCGGGACATGCAGGGCCTCTCTCTGGATGCAGCCAGC------
Loxodonta_africana|12620           AAGCCCCGCGGGCTCAGCCGGGACATGCAGGGCCTCTCCTTGGACCCTCCGGGC------
Procavia_capensis|7303             AAACCCCGAGGGCTCAGCCGGGACATGCAGAGTCTCTCCTTGGACCCTCCAGGC------
Equus_caballus|13886               AAGCCCCGAGCTCTCAGCCAGGACATGAGGGGCCTCTCCCTGGACCCTCCCGGC------
Spermophilus_tridecemlineatus|3440 AAGCCCCGAGGTCTCAGCCGGGAAATGCGGGGCCTCTCCCTGGACCCACCTAGC------
Pteropus_vampyrus|11712            AAGCCCCGAGCTCTCAGCCGGGATATGCAGGGCCTCTCCCTGGACCCACCGAAC------
Canis_familiaris|11101             AAGCCCCGGGCTCTCAGTCGGGACATGCGGGGCCTCTCCCTGGACCCACCTGCT------
Bos_taurus|23458                   AAGCCCCGAGCTCTTAGCCGAGACGTGAGGGACCTCTCCCTGGACTCGCCGGGC------
Tursiops_truncatus|11671           AAGCCCCGAGCTCTCAGCCGAGACATGAGAGACCTCTCCCTGGACCCACCTGGC------
Monodelphis_domestica|15689        AAGCCTCGGAGCATCAGCTTGGAGATGAAAGGCCTCTCCCTGGATAGGTCCAGT------
Macropus_eugenii|9106              AAGCCTCGAAGCATCAGCTTGGGGATGAGTGGCCTCTCCCTGGATAAG------------
                                                                                               

Oryzias_latipes|22093              ------------------------------------------------------------
Oryzias_latipes|1078               TCTCTGCTCAAACCCAGCAACCCTCCT---CCTCGTCTGCTACCCGGCAGGATAAGTCAG
Gasterosteus_aculeatus|6585        CTGCCCCTTCAACCCAGCCGCCCCAATCATCCAACGGCACCA---AATAAACTGAGTCAC
Fugu_rubripes|33181                CAGCCCCTCAGACCCAGCAACCCTCCACCTCCTCCACTGCCCGCGAATAAACTCAGTCAG
Xenopus_tropicalis|23459           CAGCCAGTAAGACGAGCAAGTGCTCCAGTTCCAGATGCAGGGCAAGTTGTTCCACAGAGT
Gallus_gallus|21465                ---------------TCTGAACAGCAGGCACCAGGGAAGCCCGTGGCTCAGTCTGGCTCC
Anolis_carolinensis|7337           ---------AACAAACCAGCATCCTACTTTTTGAAACAAGTCCTTCCCGCAGTCCCCACA
Ornithorhynchus_anatinus|6288      ---------TTTCCGACTGGAGATAGATCTCAGGAGAAACCTCTGTCCAGATCCGGCTCG
Ochotona_princeps|834              ---------CAGCCCAGCAAGGGC------CCGGAGCGCACGCTGTCCCGGCTGGGCTCG
Tupaia_belangeri|13804             ---------NNNNNNNNCAAAAGCCGGCTCCCTGAAAGGACGCTGTCCCGGCTGGGCTCT
Microcebus_murinus|9301            ---------CAGCCCAGCAAGGGCGGCTTCCCCGAGCGGACGCTGTCGCGGCTGGGCTCC
Myotis_lucifugus|7160              ---------CTTCCCAGCAGCCCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|42065                 ---------GAGCCCAGCAAAGGAAGCCACCCAGAGCGGACCCTGTCCAGGCTGGGCTCT
Rattus_norvegicus|13882            ---------GAGCCCAGCAAAGGTAGCCACCCAGAGCGGACACTGTCCAGACTGGGCTCT
Dipodomys_ordii|7682               ---------CAGCCCAGCAAAAACAGCTTGCCAGAGCGCACCCTG------------TCC
Sorex_araneus|13889                ---------TCGCCCAGCAAGGCCGGCGGCCAGGCGCCCACACTGTCGAGGCTGAGCTCT
Cavia_porcellus|23468              ---------CAGCCCAGCAAGAGCAGTGGCCTGGAGCGGACCCTGTCACGCCTGGGCTCC
Echinops_telfairi|15925            ---------CAGCCCAGCAAGAGCGGCCTCCCGGAGCGGACACTGTCTCGGCTGGGCTCC
Callithrix_jacchus|23800           ---------CAGCCCAGCAAGGGCGGCCTCCTGGAGCGGACACTGTCAAGGCTGGGCCCT
Pongo_abelii|13752                 ---------CAGCCAAGTAAGGGCGGCCTCCTGGAGCGGACACCGTCAAGGCTGGGCTCT
Homo_sapiens|38957                 ---------CAGCCAAGTAAGGGCGGCCTCCTGGAGCGGACAGCGTCAAGGCTGGGCTCT
Gorilla_gorilla|22562              ---------CAGCCAAGTAAGGGCGGCCTCCTGGAGCGGACACCGTCAAGGCTGGGCTCT
Pan_troglodytes|18587              ---------CAGCCAAGTAAGGGCGGCCTCCTGGAGCGGACACCGTCAAGGCTGGGCTCT
Loxodonta_africana|12620           ---------CAGCCCAGCAAGGGCAGCTTCCCAGAGCGGACACTTTCGCGGCTAGGCTCA
Procavia_capensis|7303             ---------CAGCCCAGCAAGGATGGCTTTCCAGGGCGGACACTGTCGCGGCTAGGCTCA
Equus_caballus|13886               ---------CAGCCCAGCAGGAGTGGCTTGCCGGAGCGGACGCTGTCGAGGATGGGCTCG
Spermophilus_tridecemlineatus|3440 ---------CAGCCCAGCAAAAGCGGCTTTCCAGAACGGACGCTGTCAAGGCTGGGCTCT
Pteropus_vampyrus|11712            ---------AAGCCCAGCAAGGGCGGCTTCCCGGAGCGGACGCTGTCGAGACTGGGCTCG
Canis_familiaris|11101             ---------CAACCCAGCAAGGATGGCTTTCCAGAGCGGACCCTGTCCAGGTTAGGCTCT
Bos_taurus|23458                   ---------CAGCCGAGCAAAGGTGGCTTCCCGGAGCGGACACTATCCAGACTGGGCTCT
Tursiops_truncatus|11671           ---------CAGCCCAGCAAGGGTGGCTTCCCGGAGCGGACGCTCTCGAGGCTGGGCTCT
Monodelphis_domestica|15689        ---------GACAGCTCTGAGAAG------------------CTATCCCCATTGAGCTCA
Macropus_eugenii|9106              ---------------TCCAGTGATTATGGTACCCTACAGACAGCATCCACATTGAGCTCA
                                                                                               

Oryzias_latipes|22093              ------------------------------------------------------------
Oryzias_latipes|1078               CGGCGCCACAGCCTGAATCCTGGCAGCGACTCAGTCCAACATTTTGATGGCAGCTTGCAG
Gasterosteus_aculeatus|6585        AGACGCCACAGCTTCAAAAAACAGGACAACCTCGACAAACCAGCCGACGGCAGCATCCAG
Fugu_rubripes|33181                AGAAGACACACCCTCAAGAATAAGGACAACGGTGACAAACCTGCTGATGGCAGCATCCCC
Xenopus_tropicalis|23459           AATGGTAAATGGCCATTATCAGAGAATGCTATCTACGATTCTTCA------AATATTTAT
Gallus_gallus|21465                AGGCATGCATCGTTCACACTGCACAACTCAGCTGATGATGGCTCC------AGCATCTAC
Anolis_carolinensis|7337           AGGCCAGCAGCTCTTAAGCGACACGAGTCAATATATGAAAGTTCA------AATGTCTAC
Ornithorhynchus_anatinus|6288      AGCCTGGCCACTCTTCAGCATAACGACTCCGTCTACGAGGCATCC------GGTCTCTAT
Ochotona_princeps|834              CGCGCGTCTACCCTGCACAGGAACGACTCCATCTATGAGGCCTCC------AGCCTGTAC
Tupaia_belangeri|13804             CGGGCCTCCACCCTGCGAAGGAATGACTCCATTTATGAGGCTTCC------AGCCTCTAT
Microcebus_murinus|9301            CGGGCGTCCACCCTGAGGCGGAATGACTCCATCTACGAGGCCTCG------AGCCTCTAT
Myotis_lucifugus|7160              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|42065                 CGGGCCTCCACTCTACGGAGGACCGACTCCATCTATGAGGCATCC------AGTCTCTAT
Rattus_norvegicus|13882            CGGGCTTCCACCCTAAGGAGGAACGACTCCATCTATGAGGCATCC------AGTCTCTAT
Dipodomys_ordii|7682               CGGGCCTCCACGCTTCGCAGGAGCGACTCCATCTACCAGGCATCC------AGCCTCTAC
Sorex_araneus|13889                CGGGCCTCCACCCTGCGGAGGAACGACTCTATCTATGACGCCTCC------AATCTCTAT
Cavia_porcellus|23468              AGGGCATCCACCCTGCGGCGGAGTGACTCCATCTATGAGGCCTCC------AGTCTCTAC
Echinops_telfairi|15925            AGGACATCCACCCTGCGCAGAAGCGACTTCATCTACGAG---TCT------AGCCTCTAC
Callithrix_jacchus|23800           CGGGCATCCACTCTGCGGAGGAATGACTCCATCTACGAGGCCTCC------AGCCTCTAT
Pongo_abelii|13752                 CGGGCATCCACTCTGCGGAGGAATGACTCCATCTACGAGGCCTCC------AGCCTCTAT
Homo_sapiens|38957                 CGGGCATCCACTCTGCGGAGGAATGACTCCATCTACGAGGCCTCC------AGCCTCTAT
Gorilla_gorilla|22562              CGGGCATCCACTCTGCGGAGGAATGACTCCATCTACGAGGCCTCC------AGCCTCTAT
Pan_troglodytes|18587              CGGGCATCCACTCTGCGGAGGAATGACTCCATCTACGAGGCCTCC------AGCCTCTAT
Loxodonta_africana|12620           CGGACGTCCACCTTACGGAGGAATGATTCCATCTATGAGGGCTCC------AGCCTCTAT
Procavia_capensis|7303             AGGGCATCCACCCTACGGAGGAATGATTCTATCTACGAAGCCTCC------AGCCTCTAT
Equus_caballus|13886               CGGGCGTCCACCCTGCGGAGGAACGACTCCATCTACGAGGCCTCC------AACCTCTAT
Spermophilus_tridecemlineatus|3440 CGGGCGTCCACCCTTCGGAGGAGTGACTCCATCTATGAGGCATCC------AGTCTCTAT
Pteropus_vampyrus|11712            CGGGCTTCTACCCTGCGGAGGAGTGACTCCATATATGAGGCTTCC------AACCTCTAT
Canis_familiaris|11101             CGGGCATCTACTCTGAGGAGGAGTGACTCCATCTATGAGGCCTCC------AACCTCTAT
Bos_taurus|23458                   CGGGCTTCTACCCTGCGGAGGAACGACTCCATCTATGAGGCCTCC------AACCTCTAT
Tursiops_truncatus|11671           CGGGCGTCTACACTTCGGAGGAGCGACTCCATCTACGAGGCCTCC------AACCTCTAC
Monodelphis_domestica|15689        AGACAAGGAACTATCAGGCGGAGTGATTCCATCTATGAAGCATCC------AGTCTATAT
Macropus_eugenii|9106              AGACAAGGGACCATCAGAAGGAATGATTCCATTTATGAGGCTTCT------AGTCTGTAT
                                                                                               

Oryzias_latipes|22093              ------------------------------------------------------------
Oryzias_latipes|1078               GGAATCACAGCTCTGGATGGAGTTCCCTTCAGCCTGCACCCCGACTTTAACACCCAATCG
Gasterosteus_aculeatus|6585        GGGATCACAGCTTTAGATGGAGTTCCTTTTAGCCTCAGCCCAAATTTCGATGGCCAGGCA
Fugu_rubripes|33181                GGGATTAACGCTCTGGATGGAGTTCCTTTCAGCCTCCACCCCAAGTTTGACATGAGAGTA
Xenopus_tropicalis|23459           GGCATATCTGCTATAGATGGGATTCCTTTTACAATTCACCCAATGTTTGAGAATACGGTT
Gallus_gallus|21465                AACCTCTCAGCGATGGATGGAGTCCCTTTCACACTACACCCCAAATTCGAG---CGCAGT
Anolis_carolinensis|7337           GGCATCTCGGCCATGGATGGAGTTCCTTTCACCCTGCACCCCAAGTTTGAGAGCAGCGTC
Ornithorhynchus_anatinus|6288      GGCATCTCTGCTCTGGATGGGGTCCCCTTTACGCTGCACCCGAGGTTTGAGAGCCGTGGC
Ochotona_princeps|834              GGCATCTCTGCTATGGACGGGGTGCCTTTCACCCTGCACCCCCGGTTTGAAGGCAAGAGC
Tupaia_belangeri|13804             GGCATCTCAGCTATGGATGGGGTTCCCTTCACGCTGCACCCCCGATTTGAGGGCAAGGGC
Microcebus_murinus|9301            GGCATCTCAGCCATGGACGGGGTTCCCTTTACCCTGCACCCCCGATTCGAGGGCAAGAGC
Myotis_lucifugus|7160              NNNNNNNNNNCCATGGACGGGGTTCCCTTCACGCTGCACCCCCGATTCGAAGGCAAGAGC
Mus_musculus|42065                 GGCATATCAGCCATGGACGGAGTCCCCTTTACCCTGCACCCAAGATTTGAGGGCAAGAGC
Rattus_norvegicus|13882            GGCATTTCAGCCATGGATGGGGTTCCCTTTACCCTGCACCCGAGATTTGAGGGCAAGAGC
Dipodomys_ordii|7682               GGGATCTCCGCCATGGATGGGGTTCCTTTCACGCTGCACCCACGTTTTGAGGGCAAGGGC
Sorex_araneus|13889                GGCATCTCACCCATGGATGGGGTCCCCTTCACACTGCACCCTCGATTCGAGGGCCGAACC
Cavia_porcellus|23468              GGCATCTCTGCCATGGATGGGGTTCCCTTCACACTGCACCCACGATTCGAGGGCAAGAGC
Echinops_telfairi|15925            TGCATCTCAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Callithrix_jacchus|23800           GGCATCTCAGCTATGGATGGGGTTCCCTTCACACTACACCCCCGATTCGAGGGCAAGAGT
Pongo_abelii|13752                 GGCATCTCAGCCATGGATGGGGTTCCCTTCACACTCCACCCACGATTTGAGGGCAAGAGC
Homo_sapiens|38957                 GGCATCTCAGCCATGGATGGGGTTCCCTTCACACTCCACCCACGATTTGAGGGCAAGAGC
Gorilla_gorilla|22562              GGCATCTCAGCCATGGATGGGGTTCCCTTCACACTCCACCCACGATTTGAGGGCAAGAGC
Pan_troglodytes|18587              GGCATCTCAGCCATGGATGGGGTTCCCTTCACACTCCACCCACGATTTGAGGGCAAGAGC
Loxodonta_africana|12620           GGCATCTCAGCCATGGATGGGGTTCCCTTCACGCTGCACCCCAGATTCGAGGGCAAGAGC
Procavia_capensis|7303             GGCATCTCGGCCATGGATGGGGTTCCCTTCACGCTGCACCCAAGATTCGAGGGCAAGAGC
Equus_caballus|13886               GGCATCTCCGCCATGGATGGGGTTCCCTTCACACTGCACCCCCGGTTTGAGGGCAAGAGC
Spermophilus_tridecemlineatus|3440 GGCATCTCA---------------------------------------------------
Pteropus_vampyrus|11712            GGCATCTCAGCCATGGATGGAGTTCCCTTCACGCTGCATCCCCGATTCGAGGGCAAGAGC
Canis_familiaris|11101             GGCATCTCAGCCATGGATGGTGTTCCCTTCACACTGCACCCCCGGTTCGAGGGCAAGAGC
Bos_taurus|23458                   GGCATCTCAGCCATGGATGGGGTTCCCTTCACGCTGCACCCCCGATTCGAGGGCAAGAGC
Tursiops_truncatus|11671           GGCATCTCAGCCATGGATGGGGTTCCCTTCACGCTGCACCCCCGATTCGAGGGCAAGAGC
Monodelphis_domestica|15689        GGCATCTCAGCCATGGATGGGGTCCCCTTCGTCCTGCACCCCAAGTTTGAAGGCAAAGAC
Macropus_eugenii|9106              GGCATCTCAGCCATGGATGGGGTTCCCTTCATCCTGCACCCCAAGTTTGAAGGCAAAGAC
                                                                                               

Oryzias_latipes|22093              ------------------------------------------------------------
Oryzias_latipes|1078               GATGGGATGCTG------------AGCTCTCAGATGAACGACATCTATATCAAGTCCCTC
Gasterosteus_aculeatus|6585        AACGGCACGGCT---CTTCAGCTAAACTCTCAACTACACAACATCCGTATAAAGTCCCTT
Fugu_rubripes|33181                AACGCGACGGCT---------CTGAATAATCCATTAAAAGACATTCACATTAAGTCTCTC
Xenopus_tropicalis|23459           AACAATACTTCG------GTGGTCACTTCAGACTTCAGAGATCTACATATTAAAACATTG
Gallus_gallus|21465                CCCAAATCCGAC---------AGCAGTGCCATCCTCACTGACCTGACTGTCAAATCGCTC
Anolis_carolinensis|7337           AGTGGGGGCAAT---CATGTCTCCTTTTCTCTTTATCAAAACTTCAATATCAAGTCTCTT
Ornithorhynchus_anatinus|6288      CCCGGCCCCACC---------GGATTCTCTGCCTTCACTGACCTGAACATCAAGTCTCTG
Ochotona_princeps|834              TGTGGCCCCCTG------------------------------------------------
Tupaia_belangeri|13804             TGTAGCCCCCTG---------TCCTTGTTTGCTTTTGGCGACCTGACCATCAAGTCCCTG
Microcebus_murinus|9301            TGCGGCCCCCTG---------GCCTTCTCTGCCTTCGGGGACCTGACCATCAAGTCTCTG
Myotis_lucifugus|7160              TGCGGCCCTCTG---------GCATTCTCTGCCATTGCTGATCTGACCCTCAAGTCGCTG
Mus_musculus|42065                 TGTGGGCCCTTG---------AACTTGTCTGCTTTTGGGGACCTGACGATCAAATCACTG
Rattus_norvegicus|13882            TGCGGACCCTTG---------AACTTGTCTGCCTTTGGGGACCTGACGATTAAATCACTG
Dipodomys_ordii|7682               TGTGGCCCCCTG---------GCCTGCTCTGCCTTCGGGGACCTGACCATCAAGTCGCTG
Sorex_araneus|13889                TGCGGGTCCCTG---------GCTTTCTCCGCCTTCGGGAATCTGACCATCAAGTCACTG
Cavia_porcellus|23468              TGTGGCCCCTTG---------GCCTTCTCTGCCTTTGGTGAGCTGACTATCAAGTCACTG
Echinops_telfairi|15925            NNNNNNNNNNNN---------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Callithrix_jacchus|23800           TGCAGCCCGTTGGTGAGTCAGACCTTCTCTGCATTTGGGGACCTGACCATCAAGTCTCTG
Pongo_abelii|13752                 TGCAGCCCCCTG---------GCCTTCTCTGCATTTGGGGACCTGACCATCAAGTCTCTG
Homo_sapiens|38957                 TGCAGCCCCCTG---------GCCTTCTCTGCTTTTGGGGACCTGACCATCAAGTCTCTG
Gorilla_gorilla|22562              TGCAGCCCCCTG---------GCCTTCTCTGCTTTTGGGGACCTGACCATCAAGTCTCTG
Pan_troglodytes|18587              TGCAGCCCCCTG---------GCCTTCTCTGCTTTTGGGGACCTGACCATCAAGTCTCTG
Loxodonta_africana|12620           TGTGGCCCCCTG---------GCCTTCTCTGCCTTTGCTGACCTGACCATCAAGTCACTG
Procavia_capensis|7303             TGTGGTCCCCTG---------GCCTTCTCTGCCTTTGCTGACCTGACCATCAAGTCACTG
Equus_caballus|13886               TGCAGCCCCCTG---------GCCTTCTCTGCCTTTGCTGATCTGACCATCAAGTCGCTG
Spermophilus_tridecemlineatus|3440 ------------------------------------------------------------
Pteropus_vampyrus|11712            TGTGGCCCCCTG---------GCCTTCTCTGCCTTTGCTGATCTTACCATCAAGTCGCTG
Canis_familiaris|11101             TGTGGCCCCCTG---------GCCTTCTCTGCTTTTGCCGATCTGACCATCAAGTCACTG
Bos_taurus|23458                   TGTGGTCCCCTG---------GCCTTCTCTGCCTTTGCTGATCTGACCATCAAATCGCTG
Tursiops_truncatus|11671           TGTGGTCCCCTG---------GCCTTCTCTGCCTTCGCTGATCTGACCATCAAGTCACTG
Monodelphis_domestica|15689        AATGGTCCAATG---------GGCTTCTCTGCTTTAGCAGACCTGACCATCAAGTCTCTG
Macropus_eugenii|9106              AATGGTCCAACG---------GGTTTCTCTACTTTTGCAGACCTGACCATCAAATCACTA
                                                                                               

Oryzias_latipes|22093              ------------------------------------------------------------
Oryzias_latipes|1078               AAGGAGATCGAAAACGAGTATAGCTACACATTTGCTGTTGAGGAATCCGCCGCCAGAAGA
Gasterosteus_aculeatus|6585        CAAGACATTGAGAATGAGTATAACTACACTTTTGCGACCGAA---ACCGCCGCAAAGACA
Fugu_rubripes|33181                CAAGACATTGAAAATGAGTATAATTACACTTTTGTTGTGGAGGAATCTGCTGCTAAGAGG
Xenopus_tropicalis|23459           TCTGAGATTGAAAGTGAGTACAATTATGGATTTGTGGTCGAAAGGACAGCAGCGGCTCGT
Gallus_gallus|21465                GCTGACATTGAGAAAGAGTACAACTACACTTTTGTAGTGGAACGGACGGCAGCCGCTCGC
Anolis_carolinensis|7337           GCTGACATTGAGAAAGAGTATGACTATGGGTTTGTAGTTGAAAGAACTGCGGCTGCCAGA
Ornithorhynchus_anatinus|6288      GCTGACATCGAGGAAGAAGTAGGTTAC---------------------------------
Ochotona_princeps|834              ------------------------------------------------------------
Tupaia_belangeri|13804             GCGGACATAGAGGAGGAGTACAATTACGGCTTCGTGGTGGAGAAGACGGCAGCGGCCCGC
Microcebus_murinus|9301            GCGGACATCGAGGAGGAGTACAACTACGGCTTCGTGGTGGAGAAGACGGCCGCTGCCCGC
Myotis_lucifugus|7160              GCAGACATTGAGGAGGACTACAACTACGGTTTCGTGGTGGAGAAAACAGCAGCTGCACGC
Mus_musculus|42065                 GCAGACATTGAGAAGGAGTATAACTATGGCTTCGTGGTGGAGAAGACTGCAGCTGCACGC
Rattus_norvegicus|13882            GCAGACATTGAGAAGGAGTATAACTATGGCTTCGTGGTGGAGAAGACCGCAGCTGCACGC
Dipodomys_ordii|7682               GCAGACATCGAGGAGGAGTACAACTATGGCTTTGTGGTGGAGAAGACAGCTGCTGCCCGG
Sorex_araneus|13889                GCAGACATCGAGGAGGAGTATAATTATGGCTTCGTGGTGGAGAAGACAGCGGCGGCTCGC
Cavia_porcellus|23468              GCAGACATCGAGGAGGAGTATAGCTATGGCTTCGTGGTGGAGAAGACTGCGGCTGCCCGC
Echinops_telfairi|15925            NNNNNNNNNNNNNNNNNNTATAACTACGGTTTCGTGGTGGAGAAGACAGCAGCGGCT---
Callithrix_jacchus|23800           GCGGACATTGAGGAGGAGTATAACTATGGCTTCGTGGTGGAGAAGACCGCTGCTGCCCGA
Pongo_abelii|13752                 GCGGACATTGAGGAGGAGTATAACTACGGCTTCGTGGTGGAGAAGACCGCGGCTGCCCGC
Homo_sapiens|38957                 GCGGACATTGAGGAGGAGTATAACTACGGCTTCGTGGTGGAGAAGACCGCGGCTGCCCGC
Gorilla_gorilla|22562              GCGGACATTGAGGAGGAGTATAACTACGGCTTCGTGGTGGAGAAGACCGCGGCTGCCCGC
Pan_troglodytes|18587              GCGGACATTGAGGAGGAGTATAACTACGGCTTCGTGGTGGAGAAGACCGCGGCTGCCCGC
Loxodonta_africana|12620           GCAGACATTGAGGAGGAGTACAACTACGGCTTTGTGGTGGAGAAGACGGCAGCTGCCCGC
Procavia_capensis|7303             GCAGACATCGAGGAAGAGTACAACTACGGCTTTGTGGTGGAGAAGACAGCAGCTGCCCGT
Equus_caballus|13886               GCGGACATTGAGGAGGAGTACAACTACGGCTTCGTGGTGGAGAAGACGGCAGCTGCCCGC
Spermophilus_tridecemlineatus|3440 ------------------------------------------------------------
Pteropus_vampyrus|11712            GCGGACATTGAGGAGGAG------------------------------------------
Canis_familiaris|11101             GCGGATATTGAGGAGGAGTATAACTACGGCTTCGTGGTGGAGAAGACTGCAGCTGCACGC
Bos_taurus|23458                   GCGGACATTGAGGCGGAGTACAACTACGGCTTCGTGGTGGAGAAGACGGCAGCTGCCCGC
Tursiops_truncatus|11671           GCGGACATTGAGGAGGAGTACAACTACGGCTTCGTGGTGGAGAAGACAGCAGCTGCCCGC
Monodelphis_domestica|15689        GCTGACATTGAGGAAGAGTACAACTATGGCTTTGTGGTGGAGAGAACAGCAGCAGCCCGC
Macropus_eugenii|9106              GCTGACATCGAGGAGGAGTACAACTATGGTTTTGTGGTGGAGAGGACAGCAGCAGCCCGC
                                                                                               

Oryzias_latipes|22093              ------------------------------------------------------------
Oryzias_latipes|1078               AACAGGCCGTCGGTATTT------------------------------------------
Gasterosteus_aculeatus|6585        ACCAGACCATCGGTGGCAACAGGAGGCGCCCAGACAGCTCAG------------------
Fugu_rubripes|33181                ATCAAACCGACTGTGTCA------------------------------------------
Xenopus_tropicalis|23459           GTTCCCCCACCTTTGCGT------------------------------------------
Gallus_gallus|21465                CTCCCTCCCTCCATTTGC------------------------------------------
Anolis_carolinensis|7337           CTTCCGCCAAGCATCTCA------------------------------------------
Ornithorhynchus_anatinus|6288      ------------------------------------------------------------
Ochotona_princeps|834              ------------------------------------------------------------
Tupaia_belangeri|13804             CTGCCCCCCAGCGTCTCC------------------------------------------
Microcebus_murinus|9301            CTGCCCCCGAGTGTC---------------------------------------------
Myotis_lucifugus|7160              CTGCCCCCCAGCGTGTCA------------------------------------------
Mus_musculus|42065                 CTGCCTCCCAGCGTCTCA------------------------------------------
Rattus_norvegicus|13882            CTGCCCCCCAGTGTCTCA------------------------------------------
Dipodomys_ordii|7682               CTGCCTCCCAGCGTCTCC------------------------------------------
Sorex_araneus|13889                CTGCCCCCCAGTGTCACG------------------------------------------
Cavia_porcellus|23468              CTGCCGCCCAGCGTCTCA------------------------------------------
Echinops_telfairi|15925            CTGCCACCCAGCGTGTCC------------------------------------------
Callithrix_jacchus|23800           CTCCCCCCCAGCGTCTCG------------------------------------------
Pongo_abelii|13752                 CTGCCCCCCAGCGTCTCA------------------------------------------
Homo_sapiens|38957                 CTGCCCCCCAGCGTCTCA------------------------------------------
Gorilla_gorilla|22562              CTGCCCCCCAGCGTCTCA------------------------------------------
Pan_troglodytes|18587              CTGCCCCCCAGCGTCTCA------------------------------------------
Loxodonta_africana|12620           CTGCCCCCCAGCGTCTCA------------------------------------------
Procavia_capensis|7303             CTGCCCCCCAGCGTCTCG------------------------------------------
Equus_caballus|13886               CTGCCCCCCAGCGTCTCG------------------------------------------
Spermophilus_tridecemlineatus|3440 ------------------------------------------------------------
Pteropus_vampyrus|11712            ------------------------------------------------------------
Canis_familiaris|11101             CTGCCCCCCAGTGTCTCGTATCTCTTCCTCAGGCCCAGGGAAAGCCCGCTGCCCAGCACC
Bos_taurus|23458                   CTGCCTCCAAGCGTCTCT------------------------------------------
Tursiops_truncatus|11671           CTGCCCCCTAGCGTCTCT------------------------------------------
Monodelphis_domestica|15689        CTGCCTCCCAGTGTCTGT------------------------------------------
Macropus_eugenii|9106              CTGCCTTCCAGTGTCTGT------------------------------------------
                                                                                               

Oryzias_latipes|22093              ------------------------------------------------------------
Oryzias_latipes|1078               ------------------------------------------------------------
Gasterosteus_aculeatus|6585        ------------------------------------------------------------
Fugu_rubripes|33181                ------------------------------------------------------------
Xenopus_tropicalis|23459           ------------------------------------------------------------
Gallus_gallus|21465                ------------------------------------------------------------
Anolis_carolinensis|7337           ------------------------------------------------------------
Ornithorhynchus_anatinus|6288      ------------------------------------------------------------
Ochotona_princeps|834              ------------------------------------------------------------
Tupaia_belangeri|13804             ------------------------------------------------------------
Microcebus_murinus|9301            ------------------------------------------------------------
Myotis_lucifugus|7160              ------------------------------------------------------------
Mus_musculus|42065                 ------------------------------------------------------------
Rattus_norvegicus|13882            ------------------------------------------------------------
Dipodomys_ordii|7682               ------------------------------------------------------------
Sorex_araneus|13889                ------------------------------------------------------------
Cavia_porcellus|23468              ------------------------------------------------------------
Echinops_telfairi|15925            ------------------------------------------------------------
Callithrix_jacchus|23800           ------------------------------------------------------------
Pongo_abelii|13752                 ------------------------------------------------------------
Homo_sapiens|38957                 ------------------------------------------------------------
Gorilla_gorilla|22562              ------------------------------------------------------------
Pan_troglodytes|18587              ------------------------------------------------------------
Loxodonta_africana|12620           ------------------------------------------------------------
Procavia_capensis|7303             ------------------------------------------------------------
Equus_caballus|13886               ------------------------------------------------------------
Spermophilus_tridecemlineatus|3440 ------------------------------------------------------------
Pteropus_vampyrus|11712            ------------------------------------------------------------
Canis_familiaris|11101             CCTGACACACCCCAGGACTGGCAGCTACCCCACCCTGCAGCATCTTGGGAACCTTGGTGG
Bos_taurus|23458                   ------------------------------------------------------------
Tursiops_truncatus|11671           ------------------------------------------------------------
Monodelphis_domestica|15689        ------------------------------------------------------------
Macropus_eugenii|9106              ------------------------------------------------------------
                                                                                               

Oryzias_latipes|22093              ---------------
Oryzias_latipes|1078               ---------------
Gasterosteus_aculeatus|6585        ------------TGA
Fugu_rubripes|33181                ---------------
Xenopus_tropicalis|23459           ------------TAA
Gallus_gallus|21465                ------------TGA
Anolis_carolinensis|7337           ------------TAG
Ornithorhynchus_anatinus|6288      ---------------
Ochotona_princeps|834              ---------------
Tupaia_belangeri|13804             ------------TAG
Microcebus_murinus|9301            ---------------
Myotis_lucifugus|7160              ------------TAG
Mus_musculus|42065                 ------------TAG
Rattus_norvegicus|13882            ------------TAG
Dipodomys_ordii|7682               ------------TAG
Sorex_araneus|13889                ------------TAG
Cavia_porcellus|23468              ------------TAG
Echinops_telfairi|15925            ------------TAG
Callithrix_jacchus|23800           ------------TAG
Pongo_abelii|13752                 ------------TAG
Homo_sapiens|38957                 ------------TAG
Gorilla_gorilla|22562              ------------TAG
Pan_troglodytes|18587              ------------TAG
Loxodonta_africana|12620           ------------TAG
Procavia_capensis|7303             ------------TAG
Equus_caballus|13886               ------------TAG
Spermophilus_tridecemlineatus|3440 ---------------
Pteropus_vampyrus|11712            ---------------
Canis_familiaris|11101             TGCAGGGCTTTCTAG
Bos_taurus|23458                   ------------TAG
Tursiops_truncatus|11671           ------------TAG
Monodelphis_domestica|15689        ------------TAG
Macropus_eugenii|9106              ------------TAG
                                                  

multiple sequence alignment in CLUSTALW format


Oryzias_latipes|15773              --------------------------------------------VAQTTDGGDADLWKDG
Oryzias_latipes|17983              ----------MSVNQQGMPRPVTAVAWTSNSSTCPKDFT----LINITEDGVAANFTR--
Gasterosteus_aculeatus|24550       ----------MSLIEHGSVRPVTAVGWTSNTGTCPNKYTT---QISITEDGAAANFTRS-
Fugu_rubripes|34070                ----------MERGSG--VRPVTAVAWTSNASTCPKDFI----MINVTEDGAAANFTRS-
Xenopus_tropicalis|6781            --------------MENTSTPITGLAWISSVTLCPRTYN----MIVATVEGASANFLKG-
Gallus_gallus|21036                ------------MAAEEEAAPLSGVGWAAGPESAPAGWS----VITTSVEGSAANLGKG-
Anolis_carolinensis|4560           --------------------PLTGLAWTSANVASA-GWT----SITSTVEGTSANFGKG-
Ornithorhynchus_anatinus|24644     ----------MDAAAAP--TPLAGLAWVPAAAAPPRGYS----AISTTVEGAPANFGKG-
Ochotona_princeps|726              ----------MEPGSAPDAAPLAGLAWSSASAPPPRGFS----AISCTVEGTPASFGKS-
Tupaia_belangeri|11954             ----------MESGSGTESAPLAGLAWSSASAPPPRGFS----AISCTVEGTPASFGKS-
Microcebus_murinus|7881            ----------MEPGPRADAAPLAGLVWSSASASPPRGFS----AXXXXXXXXXXXXXXX-
Myotis_lucifugus|6456              ------------------------------------------------------------
Mus_musculus|41959                 ----------MD--PGTDSAPLAGLVWSSASAPPPPGFS----AITCTVEGGTASFGRG-
Rattus_norvegicus|10241            ----------MD--PGTDSTPLAALVWSSASAPPPPGFS----AITCTVEGATASFGRG-
Dipodomys_ordii|7217               ----------MDPAP--DAAPLSGLVWSSASAPPPRGFS----AIACTVEGAPASFGKG-
Sorex_araneus|12344                ------------------------------------------------------------
Cavia_porcellus|18580              ----------MQPAPGPDAAPLASLAWSSASAPPPRGFNRVPLQISCTVEGAPASFGKS-
Echinops_telfairi|12538            ----------MDPGPGNDSLPLTGLAWSSASAPPPRGFS----AVSCTVEGAPASFGKS-
Callithrix_jacchus|16029           ----------MDPVPGTDSAPLAGLAWSSASAPPPRGFS----AISCTVEGAPANFGKT-
Pongo_abelii|6264                  ----------MDPVPGTDSVPLAGLAWSSASAPPPRGFS----AISCTVEGAPASFGKS-
Homo_sapiens|1131                  ----------MDPVPGTDSAPLAGLAWSSASAPPPRGFS----AISCTVEGAPASFGKS-
Gorilla_gorilla|17725              RPRLRRSARRMDPVPGTDSAPLAGLAWSSASAPPPRGFS----AISCTVEGAPASFGKS-
Pan_troglodytes|12209              ----------MDPVPGTDSAPLAGLAWSSASAPPPRGFS----AISCTVEGAPASFGKS-
Loxodonta_africana|14048           ------------SGPGNDSAPLAGLAWSSASAPPPRGFS----AISCTVEGTPASFSKS-
Procavia_capensis|6860             ----------MDLGPGNDSAPLTGLAWSSASAPPPRGFS----AISCTVEGTPASFGKS-
Equus_caballus|8149                ----------MDPGPGPDAAPLTGLAWSSASAPPPRGFS----AISSTVEGTPASFGKS-
Spermophilus_tridecemlineatus|3090 ----------MDPGPGPDATPLASLVWSSASAPPPRGFS----AISCTVEGAPASFGKS-
Pteropus_vampyrus|11037            ----------MDLGH--DAAPLTGLVWSSASAAPPRGFS----AISCTVEGAPASFGKS-
Canis_familiaris|23993             ----------MDPGPGTDTAPLTGLVWSSASAPPPRGFS----AISCTVEGAPASFGKT-
Bos_taurus|14509                   ----------MDPGPGANGMPLAGLAWSSASAPPPRGFS----AISCTVEGTPASFGKT-
Tursiops_truncatus|11031           ----------MDPGSGADAAPLAGLAWSSASGPPPRGFS----AISCTVEGAPASFGKT-
Monodelphis_domestica|18028        ----------MDPGPAPDGAPIAGLAWALASAVPPRGYS----AITSTVEGTPANFGKG-
Macropus_eugenii|8295              ----------MDSGPAPEGAPIAGLAWALASAVPPRGYS----AITSTVEGTPANFGKG-
                                                                                               

Oryzias_latipes|15773              LFKSKVTRYLCFSKEIVSMTANFRPEVVVDIKLIDSKDPLPEFFTAMPETIDTKEAAMRK
Oryzias_latipes|17983              -FGIKSGYYLCYS------KDLAGGVVVTDIQIITDKEAIPHGYCYIPEHLDSKAAVSKR
Gasterosteus_aculeatus|24550       -FAIKSGYYLCYS------KELTSGMVVSDIQLISDKEAIPHGYSYIEEHLEPKASVWKK
Fugu_rubripes|34070                -FGMKSGYYLCFS--KLPLQDLACGMVVADIQLISDKESIPHGYCYIAEHLEPKATVSKK
Xenopus_tropicalis|6781            -FNQKSAVYLGYS-----TALEGLEQVITDIQILNEKTVLPVGYAFIGEHLDPKISVPKK
Gallus_gallus|21036                -FGHKGGY-LCVS----TAAPGSAGPVVTDVQVLSDRNPQPAGYSRAPEFPEPRSGVSRK
Anolis_carolinensis|4560           -FAQKSGYYLCYT--SMINNMNPGGDVLYDVIILSEKTPLPSGYTYVKDFSDSKTSVSKK
Ornithorhynchus_anatinus|24644     -FAQKSGYFLCYL--TLGTSENTQQSVVNDIQILSEKTPLPIGFSFINEFLDAKSSVSKK
Ochotona_princeps|726              -FAQKSGYFLCLC--ALGSLENPQENVVVDIQIVVDKSSVPPGFSPVSDPQDSXXXXXXX
Tupaia_belangeri|11954             -FAQKSGYFLCLS--PLASLENPQENVVAEIQVVMDKSPLPPGFSPVCDPQDSXXXXXXX
Microcebus_murinus|7881            -XXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Myotis_lucifugus|6456              ------------------------------------------------------ASVSKK
Mus_musculus|41959                 -FAQKAGYFLCLS--TLGIPENPQDNVVVDMQIVMDKGPLPSGFSAVNDPQDIKASVSKK
Rattus_norvegicus|10241            -FAQKAGYFLCLS--TLGIPENPQDNVVVDMQIVMDKGPLPPGFSTVNDPQDARTSVSKK
Dipodomys_ordii|7217               -FAQKSGYFLCLG--ALGSLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASVSKK
Sorex_araneus|12344                ------------------------------------------------------ASISKK
Cavia_porcellus|18580              -FAQKSGYFLCLS--ALGSLENPQDNVVADVAIVADKSALPPGFSAVCDPLDAKASVSKK
Echinops_telfairi|12538            -FAQKSGYFLCLC--PLGSLENPQENVVAEIQVLADKSPLPPGFSPVSDPQDSKASMSKK
Callithrix_jacchus|16029           -FAQKSGYFLCLS--TLGSLENPLENVVGDIQIVVDKSPLPLGFSPVSDPMDSKASVSKK
Pongo_abelii|6264                  -FAQKSGYFLCLS--SLGSLENPQENVVADIQIVVDKSALPLGFSPVCDPMDSKASVSKK
Homo_sapiens|1131                  -FAQKSGYFLCLS--SLGSLENPQENVVADIQIVVDKSPLPLGFSPVCDPMDSKASVSKK
Gorilla_gorilla|17725              -FAQKSGYFLCLS--SLGSLENPQENVVADIQIVVDKSPLPLGFSPVCDPMDSKASVSKK
Pan_troglodytes|12209              -FAQKSGYFLCLS--SLGSLENPQENVVADIQIVVDKSPLPLGFSPVCDPMDSKASVSKK
Loxodonta_africana|14048           -FAQKSGYFLCLS--PLGSLENPQENVVAEIQVLVDKSPLPPGFSPVCDPQDSRASVSKK
Procavia_capensis|6860             -FAQKSGYFLCLS--PLGSLENPQENVVAEIQILVDKSPLPPGFSPVCDPQDSRASVSKK
Equus_caballus|8149                -FAQKSGYFLCVS--LLGSLENPQENVVAEIQVLVDKSPLPPGFSPVCDPLDSKASVSKK
Spermophilus_tridecemlineatus|3090 -FAQKSGYFLCLS--PLGSLENPQENVVVDIQVVVDKSSLPPGFSPVCDPLDSKASVSKK
Pteropus_vampyrus|11037            -FAQKSGYFLCLS--TLGNLENPQENVVADIQILVDKSPLPPGFSPVCDPLDSKASMSKK
Canis_familiaris|23993             -FAQKSGYFLCLS--SLGSLENPQENVVADIQVLVDKSPLPPGFSPVCDPLDSKASVSKK
Bos_taurus|14509                   -FAQKSGYFLCLN--PLGSLENPQENVVVDIQILVDKSPLPPGFSPVCDPLDSKASVSKK
Tursiops_truncatus|11031           -FGQKSGYFLCLN--PLGSLENPQENVVVDIQVLVDKSPLPPGFFPVCDPLDSKASVSKK
Monodelphis_domestica|18028        -FAQKSGYFLCLSTGEIGTGSGNSKNVVTDIQILNEKTPLPNGFTYISEFLDTKASVSKK
Macropus_eugenii|8295              -FAQKSGYFLCLS-------PXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASVSKK
                                                                                               

Oryzias_latipes|15773              RRLCVKMMPREAAERAIYDIQITAKSKYQVVNYTCIGEVNNMGIWCKVGDV----AR---
Oryzias_latipes|17983              KRVCVRVTPVGSVDTAVLEIKLTARNKMMLQYYTYVGDINGYVLWCSKGQFSA--PPPQT
Gasterosteus_aculeatus|24550       KRACMLVVPMGSVDTAVLDIKVTAKSKMMLQHYTCLGDIHGYVLWCRKGHFSS--PMPKA
Fugu_rubripes|34070                KRLCARLLPVGSVDTAVLDIKLTAKSKMMLHHHTYVGDIHGYVLWCRKGYFSS--PFPQA
Xenopus_tropicalis|6781            KRLCVKQMPMHTAETAVCEIKFSMKSKHIGAPFERIGEISGLVFWCRKGSVPS--PKPTP
Gallus_gallus|21036                KRLYVRLQPRGAAETAVFDIKLSGKSRAV-PQYMKIGEIGSFAIWCKKGALPQCSPPPVP
Anolis_carolinensis|4560           KRLCVKLIPFGAAETAVFDILLSSKSRVV-PNYLRIGEMGGFALWCRKESVAK--PTPLP
Ornithorhynchus_anatinus|24644     KRVCMKLVPLGATDIAVLDVKLSSKSRAV-PGYMRVGDLGGFAIWCKKGNISK--PQPLP
Ochotona_princeps|726              XXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXWCRKVKV----PKPVP
Tupaia_belangeri|11954             XXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXX----XXXXX
Microcebus_murinus|7881            XXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXDMGGFAIWCKKAKA----PRPVP
Myotis_lucifugus|6456              KRMCMKLVPLGAADTAVFDIRLSGKTKTV-PGYLRIGDMGGFAIWCKKAKA----PRPVP
Mus_musculus|41959                 KRMCVKLMPLGTADVVVSDVKLSGKTKTV-PGYLRVGDIGGFAIWCKKSKA----PRPVP
Rattus_norvegicus|10241            KRMCVKLMPLGTADVVVSDVKLSGKTKTV-PGYLRVGDIGGFAIWCKKSKA----PKLVP
Dipodomys_ordii|7217               KRMCMKLMPLGAADVAVFDVRLSGKTKTV-PGYLRVGDMGGFAIWCKKAKA----PRPVP
Sorex_araneus|12344                KRLCMKLVPLGAAEMVVVDVRLSGKTKTV-PGYHRVGDMGGFAIWCKTAKA----PRPVP
Cavia_porcellus|18580              KRMCVKLVPLGAADMVVFDIRLSGKTKTV-PGYLRIGDMGGFAIWCKKAKA----PRPVP
Echinops_telfairi|12538            KRMCVKLVPLGASDTAVFDVRLSGKTKTV-PGYLRVGDMGGFAIWCKKAKT----PKPVP
Callithrix_jacchus|16029           KRMCVKLLPLGAADTAVFDVRLSGKTKTV-PGYLRVGDMGGFAIWCKKAKV----PRPVP
Pongo_abelii|6264                  KRMCVKLLPLGAADTAVFDVRLSGKTKTV-PGYLRIGDMGGFAIWCKKAKA----PRPVP
Homo_sapiens|1131                  KRMCVKLLPLGATDTAVFDVRLSGKTKTV-PGYLRIGDMGGFAIWCKKAKA----PRPVP
Gorilla_gorilla|17725              KRMCVKLLPLGAADMAVFDVRLSGKTKTV-PGYLRIGDMGGFAIWCKKAKA----PRPVP
Pan_troglodytes|12209              KRMCVKLLPLGAADTAVFDVRLSGKTKTV-PGYLRIGDMGGFAIWCKKAKA----PRPVP
Loxodonta_africana|14048           KRMCVKLVPLGAADTAVFDVCLSGKTKTV-PGYLRVGDMGGFAIWCKKAKA----PRPVP
Procavia_capensis|6860             KRMCVRLVPLGAADTAVFDVRLSGKNKTV-PGFLRIGDMGGFAIWCKKAKA----PRPVP
Equus_caballus|8149                KRMCVRLVPLGAVDTAVFDVRLSGKTKTV-PGYLRVGDMGGFAIWCKKAKV----PRPVP
Spermophilus_tridecemlineatus|3090 KRMCVKLVPLGAADMAVFDVRLSGKTKTV-PGYLRVGDMGGFAIWCKKAKA----PKPVP
Pteropus_vampyrus|11037            KRMCVKLVPLGAADTAVFDIRLSGKTKTV-PGYLRVGDMGGFAIWCKKAKA----PRPVP
Canis_familiaris|23993             KRMCVKLVPLGAADMAVFDVRLSGKTKTV-PGYLRVGDMGGFAIWCKKAKA----PRPVP
Bos_taurus|14509                   KRMCVKLVPLGAADTAVFDIRLSGKTKTV-PGYLRVGDMGGFAIWCRKAKA----PRPVP
Tursiops_truncatus|11031           KRMCVKLVPLGVADTAVFDVRLSGKTKTV-PGYLRVGDMGGFAIWCKKAKA----PRPVP
Monodelphis_domestica|18028        KRVCMKLVPIGVADMAVFDVRLSGKNKVV-PGYIRVGEIGGFAVWCKKGKVSK--PKPLP
Macropus_eugenii|8295              KRVCMKLVPLGVADTAVFDVRLSGKSRVV-PGYMRVGEIGGFAVWCKKGKVSK--PKPLP
                                                                                               

Oryzias_latipes|15773              ------------------------------------------------------------
Oryzias_latipes|17983              KPRSVSLDLHRLSLEQVNPPSLLKPSNPP-PRLLPGRISQRRHSLNPGSDSVQHFDGSLQ
Gasterosteus_aculeatus|24550       KPRSVSLDIRRLSLEQPSAPLPLQPSRPNHPTAP-NKLSHRRHSFKKQDNLDKPADGSIQ
Fugu_rubripes|34070                KPRSVSLDFGRLSLDQPTAPQPLRPSNPPPPPLPANKLSQRRHTLKNKDNGDKPADGSIP
Xenopus_tropicalis|6781            KPRNITSGIKGLSLDINTPVQPVRRASAPVPDAGQVVPQSNGKWPLSENAIYDSS--NIY
Gallus_gallus|21036                KPRTVSLGLKQLSLAD---------SEQQAPGKPVAQSGSRHASFTLHNSADDGS--SIY
Anolis_carolinensis|4560           KPRNISLEMKRLSLEPEN-----NKPASYFLKQVLPAVPTRPAALKRHESIYESS--NVY
Ornithorhynchus_anatinus|24644     RSRNVTSELKSLSLDLPR-----FPTGDRSQEKPLSRSGSSLATLQHNDSVYEAS--GLY
Ochotona_princeps|726              KP-GLSRDLQGLSLDTPS-----QPSKG--PERTLSRLGSRASTLHRNDSIYEAS--SLY
Tupaia_belangeri|11954             XXXXXXXXXXXXXXXXXX-----XXXKSRLPERTLSRLGSRASTLRRNDSIYEAS--SLY
Microcebus_murinus|7881            KPRGLSRDMRGLSLDPAS-----QPSKGGFPERTLSRLGSRASTLRRNDSIYEAS--SLY
Myotis_lucifugus|6456              KPRALSRDMQGC-----------LPSSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Mus_musculus|41959                 KPRTLSQDMRGLSLDPPK-----EPSKGSHPERTLSRLGSRASTLRRTDSIYEAS--SLY
Rattus_norvegicus|10241            KPGTLSQDMRGLSLDQPK-----EPSKGSHPERTLSRLGSRASTLRRNDSIYEAS--SLY
Dipodomys_ordii|7217               KPRALSRDMRGLSLDPAG-----QPSKNSLPERTL----SRASTLRRSDSIYQAS--SLY
Sorex_araneus|12344                KPRALSKEMQGLSLDPPG-----SPSKAGGQAPTLSRLSSRASTLRRNDSIYDAS--NLY
Cavia_porcellus|18580              KPRSLSKEVRGLSLDATS-----QPSKSSGLERTLSRLGSRASTLRRSDSIYEAS--SLY
Echinops_telfairi|12538            KPRGLSRDMRGLSLDPPG-----QPSKSGLPERTLSRLGSRTSTLRRSDFIYE-S--SLY
Callithrix_jacchus|16029           KPRGLSRDMQSLSLDAPS-----QPSKGGLLERTLSRLGPRASTLRRNDSIYEAS--SLY
Pongo_abelii|6264                  KPRGLSRDMQGLSLDAAS-----QPSKGGLLERTPSRLGSRASTLRRNDSIYEAS--SLY
Homo_sapiens|1131                  KPRGLSRDMQGLSLDAAS-----QPSKGGLLERTASRLGSRASTLRRNDSIYEAS--SLY
Gorilla_gorilla|17725              KPRGLSRDMQGLSLDAAS-----QPSKGGLLERTPSRLGSRASTLRRNDSIYEAS--SLY
Pan_troglodytes|12209              KPRGLSRDMQGLSLDAAS-----QPSKGGLLERTPSRLGSRASTLRRNDSIYEAS--SLY
Loxodonta_africana|14048           KPRGLSRDMQGLSLDPPG-----QPSKGSFPERTLSRLGSRTSTLRRNDSIYEGS--SLY
Procavia_capensis|6860             KPRGLSRDMQSLSLDPPG-----QPSKDGFPGRTLSRLGSRASTLRRNDSIYEAS--SLY
Equus_caballus|8149                KPRALSQDMRGLSLDPPG-----QPSRSGLPERTLSRMGSRASTLRRNDSIYEAS--NLY
Spermophilus_tridecemlineatus|3090 KPRGLSREMRGLSLDPPS-----QPSKSGFPERTLSRLGSRASTLRRSDSIYEAS--SLY
Pteropus_vampyrus|11037            KPRALSRDMQGLSLDPPN-----KPSKGGFPERTLSRLGSRASTLRRSDSIYEAS--NLY
Canis_familiaris|23993             KPRALSRDMRGLSLDPPA-----QPSKDGFPERTLSRLGSRASTLRRSDSIYEAS--NLY
Bos_taurus|14509                   KPRALSRDVRDLSLDSPG-----QPSKGGFPERTLSRLGSRASTLRRNDSIYEAS--NLY
Tursiops_truncatus|11031           KPRALSRDMRDLSLDPPG-----QPSKGGFPERTLSRLGSRASTLRRSDSIYEAS--NLY
Monodelphis_domestica|18028        KPRSISLEMKGLSLDRSS-----DSSEK------LSPLSSRQGTIRRSDSIYEAS--SLY
Macropus_eugenii|8295              KPRSISLGMSGLSLDK---------SSDYGTLQTASTLSSRQGTIRRNDSIYEAS--SLY
                                                                                               

Oryzias_latipes|15773              ------------------------------------------------------------
Oryzias_latipes|17983              GITALDGVPFSLHPDFNTQSDGML----SSQMNDIYIKSLKEIENEYSYTFAVEESAARR
Gasterosteus_aculeatus|24550       GITALDGVPFSLSPNFDGQANGTA-LQLNSQLHNIRIKSLQDIENEYNYTFATE-TAAKT
Fugu_rubripes|34070                GINALDGVPFSLHPKFDMRVNATA---LNNPLKDIHIKSLQDIENEYNYTFVVEESAAKR
Xenopus_tropicalis|6781            GISAIDGIPFTIHPMFENTVNNTS--VVTSDFRDLHIKTLSEIESEYNYGFVVERTAAAR
Gallus_gallus|21036                NLSAMDGVPFTLHPKFE-RSPKSD---SSAILTDLTVKSLADIEKEYNYTFVVERTAAAR
Anolis_carolinensis|4560           GISAMDGVPFTLHPKFESSVSGGN-HVSFSLYQNFNIKSLADIEKEYDYGFVVERTAAAR
Ornithorhynchus_anatinus|24644     GISALDGVPFTLHPRFESRGPGPT---GFSAFTDLNIKSLADIEEEVGY-----------
Ochotona_princeps|726              GISAMDGVPFTLHPRFEGKSCGPL------------------------------------
Tupaia_belangeri|11954             GISAMDGVPFTLHPRFEGKGCSPL---SLFAFGDLTIKSLADIEEEYNYGFVVEKTAAAR
Microcebus_murinus|7881            GISAMDGVPFTLHPRFEGKSCGPL---AFSAFGDLTIKSLADIEEEYNYGFVVEKTAAAR
Myotis_lucifugus|6456              XXXXMDGVPFTLHPRFEGKSCGPL---AFSAIADLTLKSLADIEEDYNYGFVVEKTAAAR
Mus_musculus|41959                 GISAMDGVPFTLHPRFEGKSCGPL---NLSAFGDLTIKSLADIEKEYNYGFVVEKTAAAR
Rattus_norvegicus|10241            GISAMDGVPFTLHPRFEGKSCGPL---NLSAFGDLTIKSLADIEKEYNYGFVVEKTAAAR
Dipodomys_ordii|7217               GISAMDGVPFTLHPRFEGKGCGPL---ACSAFGDLTIKSLADIEEEYNYGFVVEKTAAAR
Sorex_araneus|12344                GISPMDGVPFTLHPRFEGRTCGSL---AFSAFGNLTIKSLADIEEEYNYGFVVEKTAAAR
Cavia_porcellus|18580              GISAMDGVPFTLHPRFEGKSCGPL---AFSAFGELTIKSLADIEEEYSYGFVVEKTAAAR
Echinops_telfairi|12538            CISXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXXXXXXXXYNYGFVVEKTAAA-
Callithrix_jacchus|16029           GISAMDGVPFTLHPRFEGKSCSPLVSQTFSAFGDLTIKSLADIEEEYNYGFVVEKTAAAR
Pongo_abelii|6264                  GISAMDGVPFTLHPRFEGKSCSPL---AFSAFGDLTIKSLADIEEEYNYGFVVEKTAAAR
Homo_sapiens|1131                  GISAMDGVPFTLHPRFEGKSCSPL---AFSAFGDLTIKSLADIEEEYNYGFVVEKTAAAR
Gorilla_gorilla|17725              GISAMDGVPFTLHPRFEGKSCSPL---AFSAFGDLTIKSLADIEEEYNYGFVVEKTAAAR
Pan_troglodytes|12209              GISAMDGVPFTLHPRFEGKSCSPL---AFSAFGDLTIKSLADIEEEYNYGFVVEKTAAAR
Loxodonta_africana|14048           GISAMDGVPFTLHPRFEGKSCGPL---AFSAFADLTIKSLADIEEEYNYGFVVEKTAAAR
Procavia_capensis|6860             GISAMDGVPFTLHPRFEGKSCGPL---AFSAFADLTIKSLADIEEEYNYGFVVEKTAAAR
Equus_caballus|8149                GISAMDGVPFTLHPRFEGKSCSPL---AFSAFADLTIKSLADIEEEYNYGFVVEKTAAAR
Spermophilus_tridecemlineatus|3090 GIS---------------------------------------------------------
Pteropus_vampyrus|11037            GISAMDGVPFTLHPRFEGKSCGPL---AFSAFADLTIKSLADIEEE--------------
Canis_familiaris|23993             GISAMDGVPFTLHPRFEGKSCGPL---AFSAFADLTIKSLADIEEEYNYGFVVEKTAAAR
Bos_taurus|14509                   GISAMDGVPFTLHPRFEGKSCGPL---AFSAFADLTIKSLADIEAEYNYGFVVEKTAAAR
Tursiops_truncatus|11031           GISAMDGVPFTLHPRFEGKSCGPL---AFSAFADLTIKSLADIEEEYNYGFVVEKTAAAR
Monodelphis_domestica|18028        GISAMDGVPFVLHPKFEGKDNGPM---GFSALADLTIKSLADIEEEYNYGFVVERTAAAR
Macropus_eugenii|8295              GISAMDGVPFILHPKFEGKDNGPT---GFSTFADLTIKSLADIEEEYNYGFVVERTAAAR
                                                                                               

Oryzias_latipes|15773              --------------------------------------------
Oryzias_latipes|17983              NRPSVF--------------------------------------
Gasterosteus_aculeatus|24550       TRPSVATGGAQTAQ------------------------------
Fugu_rubripes|34070                IKPTVS--------------------------------------
Xenopus_tropicalis|6781            VPPPLR--------------------------------------
Gallus_gallus|21036                LPPSIC--------------------------------------
Anolis_carolinensis|4560           LPPSIS--------------------------------------
Ornithorhynchus_anatinus|24644     --------------------------------------------
Ochotona_princeps|726              --------------------------------------------
Tupaia_belangeri|11954             LPPSVS--------------------------------------
Microcebus_murinus|7881            LPPSV---------------------------------------
Myotis_lucifugus|6456              LPPSVS--------------------------------------
Mus_musculus|41959                 LPPSVS--------------------------------------
Rattus_norvegicus|10241            LPPSVS--------------------------------------
Dipodomys_ordii|7217               LPPSVS--------------------------------------
Sorex_araneus|12344                LPPSVT--------------------------------------
Cavia_porcellus|18580              LPPSVS--------------------------------------
Echinops_telfairi|12538            LPPSVS--------------------------------------
Callithrix_jacchus|16029           LPPSVS--------------------------------------
Pongo_abelii|6264                  LPPSVS--------------------------------------
Homo_sapiens|1131                  LPPSVS--------------------------------------
Gorilla_gorilla|17725              LPPSVS--------------------------------------
Pan_troglodytes|12209              LPPSVS--------------------------------------
Loxodonta_africana|14048           LPPSVS--------------------------------------
Procavia_capensis|6860             LPPSVS--------------------------------------
Equus_caballus|8149                LPPSVS--------------------------------------
Spermophilus_tridecemlineatus|3090 --------------------------------------------
Pteropus_vampyrus|11037            --------------------------------------------
Canis_familiaris|23993             LPPSVSYLFLRPRESPLPSTPDTPQDWQLPHPAASWEPWWCRAF
Bos_taurus|14509                   LPPSVS--------------------------------------
Tursiops_truncatus|11031           LPPSVS--------------------------------------
Monodelphis_domestica|18028        LPPSVC--------------------------------------
Macropus_eugenii|8295              LPSSVC--------------------------------------