Orthologs Set ID: EOG4006D1


Orthology Database
OrthoDB4
Gene Symbol(s)
GE25132,CG31404

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Drosophila melanogaster 16413
Drosophila yakuba 8511

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Drosophila melanogaster 16413 FBtr0083774, NM_169855 318714 FBgn0051404 CG31404 dm3
Drosophila yakuba 8511 FBtr0271650 6535679 FBgn0242218 GE25132 droYak2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Drosophila melanogaster 15082 FBpp0083188 318714 FBgn0051404 CG31404 dm3
Drosophila yakuba 14822 FBpp0270142 6535679 FBgn0242218 GE25132 droYak2

multiple sequence alignment in CLUSTALW format


Drosophila_melanogaster|16413 ATGAATAGTGAAGCTTTTGGAACACACTTGGGCAAAATAAAGACTTCTGAGCCATCGATA
Drosophila_yakuba|8511        ATGAACACTGAAACTTATGGAACCCACTTGGGCAAAACTAAGAGTTCAGAACCGTCAATA
                              ***** * ****.***:******.************* :**** ***:**.**.**.***

Drosophila_melanogaster|16413 GCCGCCATAAACTCCGCTAATGAATTTGTTGAGCAGGAAACATTGTTCGTAAAACCCAAG
Drosophila_yakuba|8511        GGCCCTATTGATTCCGGTCATAATTTTGCTGAGCAGGAAGCTTTGATACTAAAACCCAAG
                              * * * **:.* **** *.**.*:**** **********.*:***:*. ***********

Drosophila_melanogaster|16413 GTGCAAGGGCCGCCGCCCTCTTGGGCGGCATGGTGCGAACGAAACTCAAAGCCCGTGAAA
Drosophila_yakuba|8511        GCTCTAGAGCCGCTGCCCTCTTGGTTGGCGTGGTGCGATCGAAACTCAAAGCCTGTGAAG
                              *  *:**.***** **********  ***.********:************** *****.

Drosophila_melanogaster|16413 CGTGTACGGCCTCGTGAGTCCCGAAAGTTGACCCCGTGGCAGAAAAATGGTCCGATGACC
Drosophila_yakuba|8511        CGGGTTCAGCCTCGGGAGATTCGAATCTTGACCCCTTGGCAGAAAAACGGTCCGATGACC
                              ** **:*.****** ***:  ****: ******** *********** ************

Drosophila_melanogaster|16413 ATTAGGGATTGGAAGCACTTTGGTGCCTGGGCTGCTTTCCGGGCAGGGCCTAAAAATCCA
Drosophila_yakuba|8511        ATAAGAGATTGGAAGCATTTCGGCGCCTGGGCTAGTTTCCGGGCCAGACCCAAAAATCCA
                              **:**.*********** ** ** *********. *********..*.** *********

Drosophila_melanogaster|16413 CAGCTGCAGAGACCTGCAAAACCCTTCTGTGCGGCCAATTACTTGCCATGTGCCTTGAAA
Drosophila_yakuba|8511        AAGCTCAAGAGACCTGCAAAACCTTTCTGTGCGGCCAAATACTTGCCTTGTGCCCTAAGG
                              .**** .**************** **************:********:****** *.*..

Drosophila_melanogaster|16413 AAGAGCCAACTGGACGAGGATGAGTTGCGGGAAAGGATGTTGATGTTGGCAAAGCCCCGA
Drosophila_yakuba|8511        AAGCGCCAGCTGGACGAGGAAGAGTTGCGGGAAAGGATCTTAATGTTGGCCAAGCCCCGG
                              ***.****.***********:***************** **.********.********.

Drosophila_melanogaster|16413 AAGATCACCGAGAAGTATAATACGCCTGACCTACCGCCAGCGTACTCCCCGGCGATCTCT
Drosophila_yakuba|8511        AAGATCACCGAGAAGTATAATACGCCAGACCAACCGCCAGCGTACTCCCCGGCGATCCCT
                              **************************:****:************************* **

Drosophila_melanogaster|16413 TGGGGCAAGCCACCGCATCGCGATCCCGGTCGACCCTTCAAACCTCCTTACGTTCCCGCC
Drosophila_yakuba|8511        TGGGGCAAGCCACCGCATCGCGATCCCGGTCGACCCTTCAATCCTCCCTACGTTCCCGAC
                              *****************************************:***** **********.*

Drosophila_melanogaster|16413 TGTTTTCCAACCGACGAACTGGAGGCGGATTTCTGGGCCCAGCTCAGATTTCCTGTCCGG
Drosophila_yakuba|8511        TGTTTTCCAACCGACGAACTGGAGGCGGACTTCTGGGCCCAGCTCAGATTTCCTGTCCGG
                              ***************************** ******************************

Drosophila_melanogaster|16413 CAGGCAGCCCTCTTCGCAAAGATAACGCTCCGCATCCAGTCTCTGGCCAAACCACGGGTA
Drosophila_yakuba|8511        CAGGCAGCCCTCTTGGGAAAGACTACGCCCCGCATCCAGTCCCTGGCCAAGCCACGGGTA
                              ************** * ***** :**** ************ ********.*********

Drosophila_melanogaster|16413 TATTCACCTACTCCGCACTGCCTCATTAATAAAAAAGTGTTGCATCCGCTGGATGTTCAG
Drosophila_yakuba|8511        TATCCACCAACTCCGCACTGCCCCGTTCCTGAAAAGGTGCTGCATCCGCTGGATGTTCCG
                              *** ****:************* *.**..*.****.*** ******************.*

Drosophila_melanogaster|16413 CCGCCACCGCGAAAGAAGTTCACCAAGCGGGGCTGGCGGTTGCACCAGATCCGACTGTTG
Drosophila_yakuba|8511        CCTCCACCACGAAGGAAGTTTACAAACAGGGGCTGGCGAATGCACCAGATCCGACTGTTA
                              ** *****.****.****** **.** .**********.:*******************.

Drosophila_melanogaster|16413 TACCTGTCCAAGCCGGTTTCTAGAAATGAAACGATATACTTC------------TAA
Drosophila_yakuba|8511        TATCTGTCTAAGCCGGTTTTTAGAAATGAAATGAGTTTCTTCTATAGACAGATGTAA
                              ** ***** ********** *********** ** :*:****            ***

multiple sequence alignment in CLUSTALW format


Drosophila_melanogaster|15082 MNSEAFGTHLGKIKTSEPSIAAINSANEFVEQETLFVKPKVQGPPPSWAAWCERNSKPVK
Drosophila_yakuba|14822       MNTETYGTHLGKTKSSEPSIGPIDSGHNFAEQEALILKPKALEPLPSWLAWCDRNSKPVK
                              **:*::****** *:*****..*:*.::*.***:*::***.  * *** ***:*******

Drosophila_melanogaster|15082 RVRPRESRKLTPWQKNGPMTIRDWKHFGAWAAFRAGPKNPQLQRPAKPFCAANYLPCALK
Drosophila_yakuba|14822       RVQPREIRILTPWQKNGPMTIRDWKHFGAWASFRARPKNPKLKRPAKPFCAAKYLPCALR
                              **:*** * **********************:*** ****:*:*********:******:

Drosophila_melanogaster|15082 KSQLDEDELRERMLMLAKPRKITEKYNTPDLPPAYSPAISWGKPPHRDPGRPFKPPYVPA
Drosophila_yakuba|14822       KRQLDEEELRERILMLAKPRKITEKYNTPDQPPAYSPAIPWGKPPHRDPGRPFNPPYVPD
                              * ****:*****:***************** ********.*************:***** 

Drosophila_melanogaster|15082 CFPTDELEADFWAQLRFPVRQAALFAKITLRIQSLAKPRVYSPTPHCLINKKVLHPLDVQ
Drosophila_yakuba|14822       CFPTDELEADFWAQLRFPVRQAALLGKTTPRIQSLAKPRVYPPTPHCPVPEKVLHPLDVP
                              ************************:.* * ***********.***** : :******** 

Drosophila_melanogaster|15082 PPPRKKFTKRGWRLHQIRLLYLSKPVSRNETIYF----
Drosophila_yakuba|14822       PPPRRKFTNRGWRMHQIRLLYLSKPVFRNEMSFFYRQM
                              ****:***:****:************ ***  :*