Orthologs Set ID: EOG4006D3


Orthology Database
OrthoDB4
Gene Symbol(s)
CAHBETA,BCA-1,GD18582

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Apis mellifera 36898 189, 322, 522, 720
Bombyx mori 13404 522, 720
Branchiostoma floridae 48022 483, 720
Caenorhabditis elegans 23567 153, 239, 364, 662, 771, 829
Caenorhabditis elegans 32240 189, 364, 474, 587, 720, 879
Culex quinquefasciatus 2296 189, 522
Drosophila melanogaster 14375 189, 322, 522
Drosophila sechellia 5228 189, 322, 522
Drosophila simulans 358 189, 322, 522
Linepithema humile 10139 189, 274, 522, 720
Nasonia vitripennis 9635 189, 322, 522
Nematostella vectensis 5208 189, 474, 720
Pogonomyrmex barbatus 9079 189, 322, 522, 724
Tribolium castaneum 6343 189, 322, 522

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Apis mellifera 36898 GB19829-PA apiMel3
Bombyx mori 13404 BGIBMGA003357-TA v2.0
Branchiostoma floridae 48022 e_gw.258.131.1 braFlo1
Caenorhabditis elegans 23567 Y116A8C.28c, NM_001047550 178484 WBGene00013805 bca-2 ce6
Caenorhabditis elegans 32240 T13C5.5, NM_171701 180890 WBGene00000245 bca-1 ce6
Culex quinquefasciatus 2296 CPIJ007527-RA 6039829 CPIJ007527 CpipJ1
Drosophila melanogaster 14375 FBtr0081958, NM_141592 41070 FBgn0037646 CAHbeta dm3
Drosophila sechellia 5228 FBtr0206757 6607179 FBgn0178637 GM23772 droSec1
Drosophila simulans 358 FBtr0218492 6728859 FBgn0190104 GD18582 droSim1
Linepithema humile 10139 LH23235-RA 1.2
Nasonia vitripennis 9635 NV13472-RA 1.2
Nematostella vectensis 5208 estExt_GenewiseH_1.C_840203 Nemve1
Pogonomyrmex barbatus 9079 PB21176-RA 1.2
Tribolium castaneum 6343 GLEAN_14816 Tcas3.0

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Apis mellifera 9826 GB19829 apiMel3
Bombyx mori 3357 BGIBMGA003357-PA v2.0
Branchiostoma floridae 2914 e_gw.258.131.1 braFlo1
Caenorhabditis elegans 16878 Y116A8C.28c 178484 WBGene00013805 bca-2 ce6
Caenorhabditis elegans 25274 T13C5.5 180890 WBGene00000245 bca-1 ce6
Culex quinquefasciatus 4121 CPIJ007527 CpipJ1
Drosophila melanogaster 13178 FBpp0081438 41070 FBgn0037646 CAHbeta dm3
Drosophila sechellia 13379 FBpp0205249 6607179 FBgn0178637 GM23772 droSec1
Drosophila simulans 8422 FBpp0216984 6728859 FBgn0190104 GD18582 droSim1
Linepithema humile 3407 LH23235-PA 1.2
Nasonia vitripennis 3424 NV13472-PA 1.2
Nematostella vectensis 15813 estExt_GenewiseH_1.C_840203 Nemve1
Pogonomyrmex barbatus 11176 PB21176-PA 1.2
Tribolium castaneum 14449 GLEAN_14816 Tcas3.0

multiple sequence alignment in CLUSTALW format


Nematostella_vectensis|5208   ------------------------------------------------------------
Branchiostoma_floridae|48022  ------------------------------------------------------------
Bombyx_mori|13404             ------------------------------------------------------------
Apis_mellifera|36898          ------------------------------------------------------------
Culex_quinquefasciatus|2296   ------------------------------------------------------------
Drosophila_melanogaster|14375 ------------------------------------------------------------
Drosophila_sechellia|5228     ------------------------------------------------------------
Drosophila_simulans|358       ------------------------------------------------------------
Tribolium_castaneum|6343      ATGATCACTCAAGAGGTGGACTTTGAGCATTGTGGGGAGAGGGAAAGCGAGACCTTCAAC
Pogonomyrmex_barbatus|9079    ------------------------------------------------------------
Linepithema_humile|10139      ------------------------------------------------------------
Nasonia_vitripennis|9635      ------------------------------------------------------------
Caenorhabditis_elegans|32240  ------------------------------------------------------------
Caenorhabditis_elegans|23567  ------------------------------------------------------------
                                                                                          

Nematostella_vectensis|5208   ------------------------------------ATGGAAAAAATACTACAGGGCGTT
Branchiostoma_floridae|48022  ------------------------------------------------------------
Bombyx_mori|13404             ------------------------------------------------------------
Apis_mellifera|36898          ------------------------------------ATGGATAAAATAATTAAAGGAATA
Culex_quinquefasciatus|2296   ------------------------------------ATGGATCGAATACTGCGAGGAGTG
Drosophila_melanogaster|14375 ------------------------------------ATGGAGCGTATTTTGAGGGGAATC
Drosophila_sechellia|5228     ------------------------------------ATGGAGCGTATTTTGAGAGGAATC
Drosophila_simulans|358       ------------------------------------ATGGAGCGTATTTTGAGGGGAATC
Tribolium_castaneum|6343      AACTTGTTGCTTTACGATCGTGATGTTTGTTGTAAAATGGATCGGATTCTCAAAGGTATA
Pogonomyrmex_barbatus|9079    ------------------------------------ATGGATAGAATACTCAAAGGAATC
Linepithema_humile|10139      ------------------------------------ATGGATAGGATACTCAAAGGGATC
Nasonia_vitripennis|9635      ------------------------------------ATGGATAGGATACTGAAAGGAGTA
Caenorhabditis_elegans|32240  ------------------------------------ATGAACAAAATCTTGCGTGGAGTG
Caenorhabditis_elegans|23567  ---------------------------ATGCCCGGACTTGAGAGGATTCTGAATGGTGTC
                                                                                          

Nematostella_vectensis|5208   GTGCGATTTCGACATGTTCTTCGACCCTCGCTGTTGCCTAGTTTGCGGGAAGTTGCCGAA
Branchiostoma_floridae|48022  ------------------------------------------------------------
Bombyx_mori|13404             ------------------------------------------------------------
Apis_mellifera|36898          ATGAAATATAGAAAGTGTCATAGAGAAGAAATGGTGAAACAATTTCAAAAAGTTAAAGAC
Culex_quinquefasciatus|2296   ATGCGGTATCGCAACACCACCCGCGAGCAGATGGTGAAGGAGTTTCAGAAAGTCCGGGAC
Drosophila_melanogaster|14375 ATGCGGTACAGAAATACGACAAGGGAGCAAATGGTCAAGGAGTTCCAGAAAGTCCGCGAC
Drosophila_sechellia|5228     ATGCGGTACAGAAATACGACAAGGGAGCAAATGGTCAAGGAGTTCCAGAAAGTCCGCGAC
Drosophila_simulans|358       ATGCGGTACAGAAATACGACAAGGGAGCAAATGGTCAAGGAGTTCCAGAAAGTCCGCGAC
Tribolium_castaneum|6343      ATGAGGTACAGAAATGTCAAGAAGGAAAAAATGGTCAAGCAGTTCAAAGAAGTCAAAGAC
Pogonomyrmex_barbatus|9079    ATGAAGTATAGAAAGTGTCATCGAGAGGGAATGGTAAAGCAATTTCAACAAGTCAGAGAT
Linepithema_humile|10139      ATGAAGTACAGAAAGTGTCATCGAGAAGGAATGGTGAAGCAATTTCAACAAGTCAGGGAT
Nasonia_vitripennis|9635      ATGAAATATCGAAAATGTCACAGAGAAGGAATGGTAAAGCAGTTTCAGCAAGTGAGGGAT
Caenorhabditis_elegans|32240  ATTCAATTTCGGAACACTATTCGAAAGGATCTTGTGAAGCAATTCGAAGAGATCAAAAAC
Caenorhabditis_elegans|23567  ATCAGGTTCCGGCAGACGGTTCGCAAGGATTTGGTGAAACAATTCGAGCGAATTCGTGAT
                                                                                          

Nematostella_vectensis|5208   AAAGTAGCGCCTAAGACTGTGCTGGTTGCATGTGTTGACTGTCGCATTATGCCAGAGACC
Branchiostoma_floridae|48022  ------------------------------------------------------------
Bombyx_mori|13404             ------------------------------------------------------------
Apis_mellifera|36898          TGTCCTGAACCAAAAGCAGCATTCTTTACCTGCATGGATTCCCGGATGATTCCAACTAGA
Culex_quinquefasciatus|2296   AATCCACAGCCCAAAGCGGTGTTCTTCACCTGCATGGACAGTCGGATGATCCCCACCCGG
Drosophila_melanogaster|14375 AATCCAGAACCCAAGGCCGTCTTCTTCACCTGCATGGACAGTAGAATGATTCCCACCCGG
Drosophila_sechellia|5228     AATCCAGAACCCAAGGCCGTCTTCTTCACCTGCATGGACAGTAGAATGATTCCCACCCGG
Drosophila_simulans|358       AATCCAGAACCCAAGGCCGTCTTCTTCACCTGCATGGACAGTAGAATGATTCCCACCCGG
Tribolium_castaneum|6343      AATCCTATGCCGAAAGCTGTTTTCTTTACATGTATTGACAGTAGAATGATACCGACAAGG
Pogonomyrmex_barbatus|9079    CATCCTGAGCCAAAGGCAGTTTTCTTTACTTGCATGGACTCCCGGATGATCCCAACTAGA
Linepithema_humile|10139      CATCCCGAGCCCAAGGCAGTATTTTTCACCTGCATGGACTCCCGAATGATCCCAACTAGA
Nasonia_vitripennis|9635      CATCCCGAGCCCCAGGCAGTGTTCTTTACCTGCATGGACTCCAGGATGATTCCAACAAGG
Caenorhabditis_elegans|32240  AATCCGAGTCCAACTGCGGTGATGTTCACTTGCATGGATTCCAGAATGTTGCCCACACGG
Caenorhabditis_elegans|23567  AATCCTCACCCGACAGCGGTTTTCTTCACTTGTATGGATTCTAGAATGCTGCCGGCAAGA
                                                                                          

Nematostella_vectensis|5208   TACATGAGTAGTGAGCCTGGTGACATGTTTGTC---------------------------
Branchiostoma_floridae|48022  ------------------------------------------------------------
Bombyx_mori|13404             ------------------------------------------------------------
Apis_mellifera|36898          TTTACGGAAACAAATGTTGGAGACATGTTTGTT---------------------------
Culex_quinquefasciatus|2296   TACACGGACACGCACGTGGGCGACATGTTCGTG---------------------------
Drosophila_melanogaster|14375 TACACCGACACTCACGTGGGCGATATGTTTGTG---------------------------
Drosophila_sechellia|5228     TACACCGACACTCACGTGGGCGATATGTTTGTG---------------------------
Drosophila_simulans|358       TACACCGACACTCACGTGGGCGATATGTTTGTG---------------------------
Tribolium_castaneum|6343      TTTACACAAACTAATGTGGGCGATATGTTTGTA---------------------------
Pogonomyrmex_barbatus|9079    TTTACGGAAACGAACGTTGGAGACATGTTTGTT---------------------------
Linepithema_humile|10139      TTTACGGAAACAAATGTTGGAGACATGTTTGTCGAACCGAGAGCAAGACCGGACATATCT
Nasonia_vitripennis|9635      TTTACGGAAACTAATGTTGGAGACATGTTTGTT---------------------------
Caenorhabditis_elegans|32240  TTCACACAATCACAAGTCGGAGACATGTTCGTT---------------------------
Caenorhabditis_elegans|23567  ATCACATCGAGTCAAGTTGGAGACATGTTCGTC---------------------------
                                                                                          

Nematostella_vectensis|5208   ---------------------GTGCGAACAGCAGGAAACCTCCTACCACACGCTAAGCTA
Branchiostoma_floridae|48022  ---------------------------------GGGAACCTGATTCCCCATTCTAAGCTG
Bombyx_mori|13404             ------------------------------------------------------------
Apis_mellifera|36898          ---------------------GTAAGAAATGCTGGTAATATTATTCCTCATTCTCAGCAT
Culex_quinquefasciatus|2296   ---------------------GTGCGAAACGCGGGCAATCTGGTCCCGCACGCCGAACAC
Drosophila_melanogaster|14375 ---------------------GTGCGAAATGCTGGCAATCTGATTCCCCATGCCCAGCAC
Drosophila_sechellia|5228     ---------------------GTGCGAAATGCTGGCAATCTGATTCCACATGCCCAGCAC
Drosophila_simulans|358       ---------------------GTGCGAAATGCTGGCAATCTAATTCCACATGCCCAGCAC
Tribolium_castaneum|6343      ---------------------GTGCGTAATGCTGGCAACATCATCCCGCATTCCCAACAC
Pogonomyrmex_barbatus|9079    ---------------------GTCCGAAACCCCGGTAATGTCGTACCTCATTCGCAGCAT
Linepithema_humile|10139      TTAACAGGATTCATATTTTCAGTCCGAAACCCCGGCAATGTTGTTCCACATTCGCAACAT
Nasonia_vitripennis|9635      ---------------------GTGAGAAATGCTGGTAACATAGTGCCTCATAGTCAACAT
Caenorhabditis_elegans|32240  ---------------------GTTCGAAACGCTGGGAACATGATTCCAGATGCTCCAAAT
Caenorhabditis_elegans|23567  ---------------------GTGAGAAACTCTGGAAATATGATTCCCCATGCGAATAAT
                                                                                          

Nematostella_vectensis|5208   TATGGA------------GATGTAGGATCATGTAGTGAGCTTGCTGCACTTCAGATGGCT
Branchiostoma_floridae|48022  TATGGG------------AAGGAGGTCCTTGGGTCAGAGGTTGCCTCCATGGAGTGGGCA
Bombyx_mori|13404             ------------------------ATGACCAGTTGTGAGCCAGCTGCACTGGAATTAGGT
Apis_mellifera|36898          TTTGAG------------GACGAGTTAGCAATGTGTGAACCGGCAGCCTTAGAACTTGTT
Culex_quinquefasciatus|2296   TTCCAG------------GACGAGTACTTTAGCTGCGAACCGGCAGCGCTGGAGCTGGGC
Drosophila_melanogaster|14375 TTCCAG------------GACGAGTACTTCAGCTGCGAACCGGCAGCTCTGGAGCTCGGA
Drosophila_sechellia|5228     TTCCAG------------GACGAGTACTTCAGCTGCGAACCGGCAGCTCTGGAGCTCGGA
Drosophila_simulans|358       TTCCAG------------GACGAGTACTTCAGCTGCGAACCGGCAGCTCTGGAGCTCGGA
Tribolium_castaneum|6343      TTTTTG------------GACGAACTGACTACCAATGAACCCGCAGCCCTCGAACTGGGC
Pogonomyrmex_barbatus|9079    TTCGTG------------GATGAGTTTACCATGTGCGAATCGGCGGCATTGGAGCTCGGC
Linepithema_humile|10139      TTTGTG------------GACGAATTTACCATGTGTGAATCAGCGGCGTTGGAGCTTGGT
Nasonia_vitripennis|9635      TTCATC------------GATGAGTTGACAATGTGTGAACCTGCTGCTCTAGAATTGGGA
Caenorhabditis_elegans|32240  TACGGTGCCTTCTCT---GAAGTCTCCGTGAATACCGAACCAGCGGCTCTTGAACTTGCT
Caenorhabditis_elegans|23567  TATGGTCCCTCTGGCTATGAGGTCTCTGTAACAACTGAACCAGCGGCACTCGAGTTGGCA
                                                               :  **.   **  *  *  *.   *  

Nematostella_vectensis|5208   ATACAGGAAGGCAAGGTGGAAAATGTGGTGGTGTGTGGTCATTCTAACTGCAAGGGAATG
Branchiostoma_floridae|48022  TGCAGCCAAGGGAGCCTGGAACATGTGATCGTTTGTGGCCACTCCAACTGTCAGGTAAAG
Bombyx_mori|13404             TGCATAATTAATAACATACGTCATATAATAGTCTGCGGCCATAGTGACTGCAAAGCAATG
Apis_mellifera|36898          TGTTTAATGAACGAAATAAAACACATTATAGTTTGCGGCCATAGCGATTGTAAGGCTATG
Culex_quinquefasciatus|2296   TGCGTGGTCAACAACATCAAGCACATCATCGTGTGCGGCCACAGCGATTGCAAAGCCATG
Drosophila_melanogaster|14375 TGCGTGGTGAACGACATTAGACACATAATAGTTTGCGGACACAGCGACTGCAAGGCAATG
Drosophila_sechellia|5228     TGCGTGGTGAACGACATTAGACACATAATAGTTTGCGGACACAGCGACTGCAAGGCCATG
Drosophila_simulans|358       TGCGTGGTGAACGACATTAGACACATAATAGTTTGCGGACACAGCGACTGCAAGGCCATG
Tribolium_castaneum|6343      TGTGTAGTGAACGACATCCGCCACATCATTGTTTGTGGTCACAGTGACTGCAAAGCCATC
Pogonomyrmex_barbatus|9079    TGCGTGGTAAATGACATAAGGCACGTTATAGTTTGCGGCCATAGCGATTGCAAGGCGATG
Linepithema_humile|10139      TGTGTGGTAAATGATATAAGACACGTTATTGTGTGTGGCCACAGCGATTGTAAGGCCATG
Nasonia_vitripennis|9635      TGCGTTGTCAATGACATCAGGCATGTTATCGTATGTGGACACAGTGACTGTAAAGCTATG
Caenorhabditis_elegans|32240  GTCAAACGAGGTGGTATCAGACATATTGTCGTATGCGGGCACTCGGACTGCAAAGCTATC
Caenorhabditis_elegans|23567  GTAAAACGTGGAAAAATCAATCATGTAATTGTGTGTGGACATTCGGATTGTAAAGCAATC
                                       .. ..  *  . .* .* .* ** ** ** ** :  .* ** .*.*  *: 

Nematostella_vectensis|5208   ACATTCCTTTTATCACAT---------------GACTCACGCACAGACAATCATTACATT
Branchiostoma_floridae|48022  TCAATCTTGGATGTGTTGGGCAAGTCACAGATTCAGTCAGCACCAAATTGCAGGTCCTCC
Bombyx_mori|13404             AACCTTCTCTATCAGCTCAGAAGTGAAGAAGCCTCCGATAAAGAGCAAAGAAGAATATCG
Apis_mellifera|36898          AATATGTTATATTCTTTGCGCGAAGAAGAATTAGCATCTAAAGTAAATAGAAGGATATCG
Culex_quinquefasciatus|2296   AACCTGCTGTATCAGCTGCGGGATCCGCAGTTTGCTTCGAGGAAAAATCGTCGAATTTCC
Drosophila_melanogaster|14375 AACCTTTTGTACCAACTGAGAGATCCTGATTTCGCTTCTAAGCTTAACCGACGCCTCTCA
Drosophila_sechellia|5228     AACCTGTTGTACCAACTAAGAGATCCTGATTTCGCCTCTAAGCTTAACCGACGCCTCTCA
Drosophila_simulans|358       AACCTGTTGTACCAACTAAGAGATCCTGATTTCGCCTCTAAGCTTAACCGACGCCTCTCA
Tribolium_castaneum|6343      AATCTCTTATACAAACTACAAGACAGTGAATTTGCTTCTCAGGATAATCGAAGAATATCA
Pogonomyrmex_barbatus|9079    AATCTGCTCTATGCTTTACGGGATGAGGAATTCGCGTCTCAAACGAACAGGAGAATGTCG
Linepithema_humile|10139      AATCTGCTCTACGCTTTACGGGACGAGGAATTTGCATCTCAAATGAACAGAAGAATATCG
Nasonia_vitripennis|9635      AATTTGCTGTATGCCTTGAGAGATGAAGAATTTGCATCACAAGTAAACCGGAGAATATCA
Caenorhabditis_elegans|32240  AACACTCTTTACGGTCTCCACCAA---------TGTCCGAAAAACTTTGATGTTACGTCG
Caenorhabditis_elegans|23567  AATACTTTATATAATCTTCATAAA---------TGTCCAAAATCATTTGATCCAGAATCA
                              :.     *  :     :                    .        :  .       :  

Nematostella_vectensis|5208   CCT---------TGGTTGAAAAAGACTGGTGCCTCCTCGTTGACGAGATTTGAAAAAGTA
Branchiostoma_floridae|48022  CCCTTCCTGTCCTGGCTGACTCAGCATGGTAACAGCACTCTCACACGGTTTGAGAGGTAC
Bombyx_mori|13404             CCATTGAAGTCTTGGTTGTGTACTCATGCTGAGACAAGTTTGAAAAAATTCCTTGAAATG
Apis_mellifera|36898          CCATTAAAAGCATGGCTTTGTGCACACGCTAGTAATAGTTTAACGAGATTTCAACAGCTT
Culex_quinquefasciatus|2296   CCGCTCCGGGCGTGGCTCTGCGAGCACGCCGACACGAGTTTGGAGAAATTCCAAAACCTG
Drosophila_melanogaster|14375 CCATTGCGATCTTGGCTGTGCACCCATGCCAACACCAGCTTGGAGAGGTTCCAGGAATGG
Drosophila_sechellia|5228     CCCTTGAGATCTTGGCTGTGCACCCATGCCAACACCAGCTTGGAGAGGTTTCAGGAATGG
Drosophila_simulans|358       CCCCTGCGATCTTGGCTGTGCACCCATGCCAACACCAGCTTGGAGAGGTTTCAGGAATGG
Tribolium_castaneum|6343      CCCCTTAGAGCCTGGCTATGTACACATGCTCTCACAAGTTTAGAAAAATTTCAACAACTG
Pogonomyrmex_barbatus|9079    CCGCTGAGAGCGTGGCTATGCGCGCACGCCAGTAGCAGTCTGACAAAGTTTCAACATCTC
Linepithema_humile|10139      CCGTTGAGAGCGTGGTTGTGTGCGCACGCCAGCAGCAGCTTGGCAAAGTTTCAGCATCTC
Nasonia_vitripennis|9635      CCACTACGTGCCTGGCTGTGCGCACACGGCAGCAGCAGTCTCGCCAAGTTTCAACAGCTC
Caenorhabditis_elegans|32240  CCAATGGACCATTGGGTTAGAAGAAATGGATTCGCCTCTGTCAAAAGACTCAACGAG---
Caenorhabditis_elegans|23567  CCAATGGATCATTGGCTCCGGCGGCATGGATTTAATTCGATTAGGAAATTGGAAAAACGA
                              **          *** *       .. *        :   * .  ... *  :  .    

Nematostella_vectensis|5208   GACATGTCACAAGAGGGTGGTGTGAAGCTTCTGTTTGAGGATGCT---ACTGGAGGGGAG
Branchiostoma_floridae|48022  GAGATGGAC---AGACTT---CAACCTATCACATTTCAGGGAATC---TCGCCAAAGGAA
Bombyx_mori|13404             AAT---GGC---GATTTTACGAAACCTATGCTATTCACTGCCGAA---ACACCACAGAGG
Apis_mellifera|36898          GAAATCAGT---GATTTCCGTGACCCGATACTTTTTCAAGGTGAG---ACATCTTTACGA
Culex_quinquefasciatus|2296   CAGGAAACC---GGCCTCGACAAACCCATCATATTCTCGTCGGAA---ACGCCTCTGCGG
Drosophila_melanogaster|14375 CGCGACGCT---GGCATGAAAGATCCACTGATTTTCTCTTCGGAG---ACTCCGCTACGT
Drosophila_sechellia|5228     CGCGACGCT---GGCATGAAGGATCCACTGATCTTCTCTTCGGAG---ACTCCGCTCCGC
Drosophila_simulans|358       CGCGACGCT---GGCATGAAGGATCCACTGATCTTCTCTTCGGAG---ACTCCGCTCCGC
Tribolium_castaneum|6343      CAAGTGACA---GACTACGGCAAACCTCTAATTTTTCAAGCCGAA---ACCCCTATGAGA
Pogonomyrmex_barbatus|9079    GAAGTCGCT---GGTTTTCGCGAACCGATCATCTTCCAGGCTGAA---ACGCCGTTGAGA
Linepithema_humile|10139      GAAGTCACC---GGTTTCCACGAGCCGATTATTTTCCAAGCTGAG---ACTCCGCTGCGA
Nasonia_vitripennis|9635      GAGATCACG---GGCTTCCACGAGCCTCTTCTATTCCAAGCCGAG---ACGCCGCTCCGC
Caenorhabditis_elegans|32240  CGCCTTCAT---CGTGGTCCATCATCCATGAAATTTGAATCGGAAGTTGCTCCAAGTCAA
Caenorhabditis_elegans|23567  CTGGCCGAC---AAGAATGCGGGCCCGATTGAGTTTGTCAGTGAT---AATCCGTTGTTC
                                           .           . .*    **       .      .          

Nematostella_vectensis|5208   CCTATGGAGGTGACAATAGATGAAGGGAATAAGTTGGACAGTGTGGATAAACTCTCACAA
Branchiostoma_floridae|48022  TTATGGGATGCATATGTTGACCCTCAGTGCCACTGGACTGACCAGGACCAGTTTTCCCAG
Bombyx_mori|13404             AGATTTGTCGCCTACATAGATCCAGATAATAAATTTTGCATTGAAGATAAACTATCTCAG
Apis_mellifera|36898          AAATTTGTAGCTTATATTGATCCTGAAGATAAATTCGGCGTAGAAGATAAATTATCTCAA
Culex_quinquefasciatus|2296   AAGTTTGTGGCGTACATCGATCCGGAGAACCAGTTCGCCATCGAGGACAAGCTGTCCCAG
Drosophila_melanogaster|14375 CGCTTTGTGGCCTACATCGATGAGGAGCAGAAATTTGCCTTGGAGGACAAATTATCCCAG
Drosophila_sechellia|5228     CGCTTTGTGGCCTACATCGATGAGGAGCAGAAGTTTGCCTTGGAGGACAAACTATCCCAG
Drosophila_simulans|358       CGCTTTGTGGCCTACATCGATGAGGAGCAGAAGTTTGCCTTGGAGGACAAACTATCCCAG
Tribolium_castaneum|6343      AAATTCGTTGCTTACATCGATCCCGAAAACAAATTTACAATAGAAGATAAGCTATCGCAA
Pogonomyrmex_barbatus|9079    AAATTCGTCGCTTATATCGATCCGGAGGACAAGTTTGCCATCGAAGACAAATTGTCGCAA
Linepithema_humile|10139      AAATTTGTCGCTTACATTGATCCAGAAGATAAATTCGCTATTGAAGACAAGTTGTCACAA
Nasonia_vitripennis|9635      AAATTCGTCGCCTATATCGACCCGGAGGACAAGTTCGCGATCGAGGATAAGCTCTCGCAG
Caenorhabditis_elegans|32240  TCATTTGATGCAATAATTGACCCGATGGACACACTCGCAATGGAAGATAAACTTTCCCAA
Caenorhabditis_elegans|23567  TCATTCTCGGCAGTAATTGACCCGGAAGACAAGCTGAATGTCGAGGATAAGCTCTCACAA
                                 :     *     .* **  .     . ..           :.** .*. * ** **.

Nematostella_vectensis|5208   GTAAATGTGCTTCAGCAGCTTCACAACCTCAAGTCGTTCCCATTCATCAGTAACCCACTA
Branchiostoma_floridae|48022  GTGAATGTTTTACAACAGCTGCAGAATGTGTCTTCACACGGCTTCCTGAAGCCCAGGTTG
Bombyx_mori|13404             GTCAATACATTGCAGCAGCTTCAAAATATAGCATCATACGGAATGTTAAAGAAACGCTTA
Apis_mellifera|36898          ATAAATACTTTACAACAATTACAAAATATAGCTTCTTATGGATTTTTAAAAAAACGATTG
Culex_quinquefasciatus|2296   GTGAACACGCTGCAGCAGATCGAGAACATTGCCTCGTACGGGTTTCTGAAGAAGCGGCTC
Drosophila_melanogaster|14375 ATCAACACACTGCAGCAAATGTCCAACATTGCCTCGTACGGCTTCCTCAAGGCTCGCCTA
Drosophila_sechellia|5228     ATCAACACACTGCAACAAATGTCCAACATTGCCTCGTACGGCTTCCTCAAGGCTCGCCTA
Drosophila_simulans|358       ATCAACACACTGCAGCAAATGTCCAACATTGCCTCGTACGGCTTCCTCAAGGCTCGCCTA
Tribolium_castaneum|6343      ATCAATACTTTGCAACAGTTACAAAATATCGCAAGTTATGGCTTTTTAAAAAAGAGATTG
Pogonomyrmex_barbatus|9079    GTCGAT------CAACACATTGCAACAACTTCAAAATATCGCATCTTA------------
Linepithema_humile|10139      ATCAATACATTGCAACAGCTTCAAAATATCGCGTCGTATGGGTTTCTGAAGAAGCGCTTG
Nasonia_vitripennis|9635      ATCAACACGCTGCAGCAGTTACAAAACGTCGCCTCCTACGGCTTCCTTAAGCGTCGTCTC
Caenorhabditis_elegans|32240  ATCAACGTTCTGCAACAGCTCATAAACATTTGCTCACACGAGTTTCTCAAAGAGTATCTC
Caenorhabditis_elegans|23567  ATTAATACACTTCAACAATTGGAAAATGTGGCCAGTCATGGATTTTTGAAGGAATTCCTC
                              .* .*       **.**  *    *.       :   :    :*  *             

Nematostella_vectensis|5208   TCTAAGGGGGCTCTTAACCTCTATGGCCTTTGGTTTGACATCAAAGAAGGGGAGATGTAC
Branchiostoma_floridae|48022  AAGTCAGGTGCCTTACAGCTACACGGCATGTGGCTGGACAGCAGACAACAGTTGCCTTAC
Bombyx_mori|13404             GAAAAACATGATTTACATATACATGCATTATGGTTTGATATTTATACTGGCGACATTTAT
Apis_mellifera|36898          GAAAGGCATGATTTGCATATTCATGCATTATGGTTTGATATTTANNNNNNNNNNNNNNNN
Culex_quinquefasciatus|2296   GAATCGCACGATCTGCACATCCACGCGCTGTGGTTCGACATCTACACGGGTGATATCTAC
Drosophila_melanogaster|14375 GAATCCCACGATCTTCACATTCATGCTCTTTGGTTCGATATCTACACCGGTGACATCTAT
Drosophila_sechellia|5228     GAGTCCCACGATCTTCACATTCATGCTCTTTGGTTCGATATCTACACCGGTGACATCTAT
Drosophila_simulans|358       GAATCCCACGATCTTCACATTCATGCTCTTTGGTTCGATATCTACACCGGTGACATCTAT
Tribolium_castaneum|6343      GAGAAACATCAACTGCATATTCATGCCCTTTGGTTTGATATTTACACAGGCGAGATTTAT
Pogonomyrmex_barbatus|9079    ------------------------------TGGATT------------------------
Linepithema_humile|10139      GAGAGACACGATTTGCACATTCACGCGCTGTGGTTTGATATTTACACCGGGGATATTTAT
Nasonia_vitripennis|9635      GAGAAGCACAATCTACACGTGCACGCGCTTTGGTTCGATATCTATACTGGAGACATTTAC
Caenorhabditis_elegans|32240  GAGTCTGGTCGTCTTCATATCCATGGCATGTGGTTCGATATTTACAAGGGAGAGGACTAT
Caenorhabditis_elegans|23567  GTGTCTCAAACTGTCGATCTTCATGCGATGTGGTTCGATATTTACACTGGAGAAATGCAC
                                                            *** *                         

Nematostella_vectensis|5208   ATGTTTTCAAGAAAGCAGAAGAAGTTTGTCTTGATAAATAAAGACACAGTGAACAACCTG
Branchiostoma_floridae|48022  TTGTTTAGCAAAGAACAGCAAAGATTTGTGCAAATAACAGATAACAATATAGACTCTCTA
Bombyx_mori|13404             TACTTTAGTAGGCGCGCGAAACAATTTGTAATAATTGATGAATCAACTTACGAAATGATT
Apis_mellifera|36898          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Culex_quinquefasciatus|2296   TACTTTAGCCGCAACTCGAAGCGATTCATTCCGGTCGATGAGACCACCATCGAGCGGCTG
Drosophila_melanogaster|14375 TACTTCAGCCGCGGAGCCAAACGTTTTCTGCCTGTTGATGAAGACACCGTGGATCGATTG
Drosophila_sechellia|5228     TACTTCAGCCGCGGAGCCAAACGTTTTCTGCCCGTTGATGAGGACACTGTGGATCGATTG
Drosophila_simulans|358       TACTTCAGCCGCGGAGCCAAACGTTTTCTGCCCGTTGATGAGGACACTGTGGATCGATTG
Tribolium_castaneum|6343      TATTTTAGTCGGGGGGCGAAAAAATTTGTGGTCATTGATGAAGAGAATTTCCCCAAATTG
Pogonomyrmex_barbatus|9079    ------------CCTGAAAAAGCGTTTAGAGCGACA------------------------
Linepithema_humile|10139      TATTTTAGCCGAGCCAATAAAAGGTTTGTGGAAATAAATGAGACAACGGAGCCATTTCTG
Nasonia_vitripennis|9635      TACTTCAGTCGAGCCAACAAACGCTTCGTCGAGATAAACGAGCTCACGGAGACACCTTTG
Caenorhabditis_elegans|32240  CTTTTCTCGAAGGATAAGAAGAGATTTGTGGTCATTGATGAAAAAACAGTCACCGACCTT
Caenorhabditis_elegans|23567  ATGTTCAGCAAACCCAACAAACAATTCGTTCTGGTCGATGAATCGAATGTCGAAGAATTG
                                                      ..                                  

Nematostella_vectensis|5208   TGCTCTGAGGTGGAT---------------------------------------------
Branchiostoma_floridae|48022  TTA---------------------------------------------------------
Bombyx_mori|13404             TTGTCCGAAGTCAGGAGATTTTACTCT---------------------------------
Apis_mellifera|36898          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Culex_quinquefasciatus|2296   CTGAAAGAGGTCAATCAGTTCTATTCG---------------------------------
Drosophila_melanogaster|14375 TCCGAGGAGGTCAGAAGATTCTATTCG---------------------------------
Drosophila_sechellia|5228     TCCGAGGAGGTCAGAAGATTCTATTCG---------------------------------
Drosophila_simulans|358       TCCGAGGAGGTCAGAAGATTCTATTCG---------------------------------
Tribolium_castaneum|6343      CTCCAAGAGGTGGAAAAATATTATTCG---------------------------------
Pogonomyrmex_barbatus|9079    ------------------------------------------------------------
Linepithema_humile|10139      CTTAAAGAAATAAAGAAATATTATTCG---------------------------------
Nasonia_vitripennis|9635      CTCAAGGAAATCAAGAAATATTATTCT---------------------------------
Caenorhabditis_elegans|32240  CTTGCTGAACTCAACGCTCGTTACCCA------------------------GTTCCCGAA
Caenorhabditis_elegans|23567  ATTGATGAGGTCGAAAAGCATCAGACT---------------------------------
                                                                                          

Nematostella_vectensis|5208   ------------------------------------TGA
Branchiostoma_floridae|48022  ------------------------------------TAG
Bombyx_mori|13404             ------------------------------------TAA
Apis_mellifera|36898          NNNNNTAAGACTGAATTTGATTTGTTGAATCTCTTATAA
Culex_quinquefasciatus|2296   ------------------------------------TGA
Drosophila_melanogaster|14375 ------------------------------------TAG
Drosophila_sechellia|5228     ------------------------------------TAG
Drosophila_simulans|358       ------------------------------------TAG
Tribolium_castaneum|6343      ------------------------------------TGA
Pogonomyrmex_barbatus|9079    ------------------------------------TGA
Linepithema_humile|10139      ------------------------------------TAA
Nasonia_vitripennis|9635      ---------------------------------------
Caenorhabditis_elegans|32240  GATCAAGACGGTCCGGTTGCATTTGCCAAATCTAACTAA
Caenorhabditis_elegans|23567  ------------------------------------TAA
                                                                     

multiple sequence alignment in CLUSTALW format


Nematostella_vectensis|15813  --------------------------------MEKILQGVVRFRHVLRPSLLPSLREVAE
Branchiostoma_floridae|2914   ------------------------------------------------------------
Bombyx_mori|3357              ------------------------------------------------------------
Apis_mellifera|9826           --------------------------------MDKIIKGIMKYRKCHREEMVKQFQKVKD
Culex_quinquefasciatus|4121   --------------------------------MDRILRGVMRYRNTTREQMVKEFQKVRD
Drosophila_melanogaster|13178 --------------------------------MERILRGIMRYRNTTREQMVKEFQKVRD
Drosophila_sechellia|13379    --------------------------------MERILRGIMRYRNTTREQMVKEFQKVRD
Drosophila_simulans|8422      --------------------------------MERILRGIMRYRNTTREQMVKEFQKVRD
Tribolium_castaneum|14449     MITQEVDFEHCGERESETFNNLLLYDRDVCCKMDRILKGIMRYRNVKKEKMVKQFKEVKD
Pogonomyrmex_barbatus|11176   --------------------------------MDRILKGIMKYRKCHREGMVKQFQQVRD
Linepithema_humile|3407       --------------------------------MDRILKGIMKYRKCHREGMVKQFQQVRD
Nasonia_vitripennis|3424      --------------------------------MDRILKGVMKYRKCHREGMVKQFQQVRD
Caenorhabditis_elegans|25274  --------------------------------MNKILRGVIQFRNTIRKDLVKQFEEIKN
Caenorhabditis_elegans|16878  -----------------------------MPGLERILNGVIRFRQTVRKDLVKQFERIRD
                                                                                          

Nematostella_vectensis|15813  KVAPKTVLVACVDCRIMPETYMSSEPGDMFV----------------VRTAGNLLPHAKL
Branchiostoma_floridae|2914   ---------------------------------------------------GNLIPHSKL
Bombyx_mori|3357              ------------------------------------------------------------
Apis_mellifera|9826           CPEPKAAFFTCMDSRMIPTRFTETNVGDMFV----------------VRNAGNIIPHSQH
Culex_quinquefasciatus|4121   NPQPKAVFFTCMDSRMIPTRYTDTHVGDMFV----------------VRNAGNLVPHAEH
Drosophila_melanogaster|13178 NPEPKAVFFTCMDSRMIPTRYTDTHVGDMFV----------------VRNAGNLIPHAQH
Drosophila_sechellia|13379    NPEPKAVFFTCMDSRMIPTRYTDTHVGDMFV----------------VRNAGNLIPHAQH
Drosophila_simulans|8422      NPEPKAVFFTCMDSRMIPTRYTDTHVGDMFV----------------VRNAGNLIPHAQH
Tribolium_castaneum|14449     NPMPKAVFFTCIDSRMIPTRFTQTNVGDMFV----------------VRNAGNIIPHSQH
Pogonomyrmex_barbatus|11176   HPEPKAVFFTCMDSRMIPTRFTETNVGDMFV----------------VRNPGNVVPHSQH
Linepithema_humile|3407       HPEPKAVFFTCMDSRMIPTRFTETNVGDMFVEPRARPDISLTGFIFSVRNPGNVVPHSQH
Nasonia_vitripennis|3424      HPEPQAVFFTCMDSRMIPTRFTETNVGDMFV----------------VRNAGNIVPHSQH
Caenorhabditis_elegans|25274  NPSPTAVMFTCMDSRMLPTRFTQSQVGDMFV----------------VRNAGNMIPDAPN
Caenorhabditis_elegans|16878  NPHPTAVFFTCMDSRMLPARITSSQVGDMFV----------------VRNSGNMIPHANN
                                                                                          

Nematostella_vectensis|15813  YG----DVGSCSELAALQMAIQEGKVENVVVCGHSNCKGMTFLLSH-----DSRTDNHYI
Branchiostoma_floridae|2914   YG----KEVLGSEVASMEWACSQGSLEHVIVCGHSNCQVKSILDVLGKSQIQSAPNCRSS
Bombyx_mori|3357              --------MTSCEPAALELGCIINNIRHIIVCGHSDCKAMNLLYQLRSEEASDKEQRRIS
Apis_mellifera|9826           FE----DELAMCEPAALELVCLMNEIKHIIVCGHSDCKAMNMLYSLREEELASKVNRRIS
Culex_quinquefasciatus|4121   FQ----DEYFSCEPAALELGCVVNNIKHIIVCGHSDCKAMNLLYQLRDPQFASRKNRRIS
Drosophila_melanogaster|13178 FQ----DEYFSCEPAALELGCVVNDIRHIIVCGHSDCKAMNLLYQLRDPDFASKLNRRLS
Drosophila_sechellia|13379    FQ----DEYFSCEPAALELGCVVNDIRHIIVCGHSDCKAMNLLYQLRDPDFASKLNRRLS
Drosophila_simulans|8422      FQ----DEYFSCEPAALELGCVVNDIRHIIVCGHSDCKAMNLLYQLRDPDFASKLNRRLS
Tribolium_castaneum|14449     FL----DELTTNEPAALELGCVVNDIRHIIVCGHSDCKAINLLYKLQDSEFASQDNRRIS
Pogonomyrmex_barbatus|11176   FV----DEFTMCESAALELGCVVNDIRHVIVCGHSDCKAMNLLYALRDEEFASQTNRRMS
Linepithema_humile|3407       FV----DEFTMCESAALELGCVVNDIRHVIVCGHSDCKAMNLLYALRDEEFASQMNRRIS
Nasonia_vitripennis|3424      FI----DELTMCEPAALELGCVVNDIRHVIVCGHSDCKAMNLLYALRDEEFASQVNRRIS
Caenorhabditis_elegans|25274  YGAFS-EVSVNTEPAALELAVKRGGIRHIVVCGHSDCKAINTLYGLHQ---CPKNFDVTS
Caenorhabditis_elegans|16878  YGPSGYEVSVTTEPAALELAVKRGKINHVIVCGHSDCKAINTLYNLHK---CPKSFDPES
                                          * *:::     . :.:::*****:*:  . *                 

Nematostella_vectensis|15813  P---WLKKTGASSLTRFEKVDMSQEGGVKLLFEDA-TGGEPMEVTIDEGNKLDSVDKLSQ
Branchiostoma_floridae|2914   PFLSWLTQHGNSTLTRFERYEMD-RL-QPITFQGI-SPKELWDAYVDPQCHWTDQDQFSQ
Bombyx_mori|3357              PLKSWLCTHAETSLKKFLEMN-G-DFTKPMLFTAE-TPQRRFVAYIDPDNKFCIEDKLSQ
Apis_mellifera|9826           PLKAWLCAHASNSLTRFQQLEIS-DFRDPILFQGE-TSLRKFVAYIDPEDKFGVEDKLSQ
Culex_quinquefasciatus|4121   PLRAWLCEHADTSLEKFQNLQET-GLDKPIIFSSE-TPLRKFVAYIDPENQFAIEDKLSQ
Drosophila_melanogaster|13178 PLRSWLCTHANTSLERFQEWRDA-GMKDPLIFSSE-TPLRRFVAYIDEEQKFALEDKLSQ
Drosophila_sechellia|13379    PLRSWLCTHANTSLERFQEWRDA-GMKDPLIFSSE-TPLRRFVAYIDEEQKFALEDKLSQ
Drosophila_simulans|8422      PLRSWLCTHANTSLERFQEWRDA-GMKDPLIFSSE-TPLRRFVAYIDEEQKFALEDKLSQ
Tribolium_castaneum|14449     PLRAWLCTHALTSLEKFQQLQVT-DYGKPLIFQAE-TPMRKFVAYIDPENKFTIEDKLSQ
Pogonomyrmex_barbatus|11176   PLRAWLCAHASSSLTKFQHLEVA-GFREPIIFQAE-TPLRKFVAYIDPEDKFAIEDKLSQ
Linepithema_humile|3407       PLRAWLCAHASSSLAKFQHLEVT-GFHEPIIFQAE-TPLRKFVAYIDPEDKFAIEDKLSQ
Nasonia_vitripennis|3424      PLRAWLCAHGSSSLAKFQQLEIT-GFHEPLLFQAE-TPLRKFVAYIDPEDKFAIEDKLSQ
Caenorhabditis_elegans|25274  PMDHWVRRNGFASVKRLNE-RLH-RGPSSMKFESEVAPSQSFDAIIDPMDTLAMEDKLSQ
Caenorhabditis_elegans|16878  PMDHWLRRHGFNSIRKLEKRLAD-KNAGPIEFVSD-NPLFSFSAVIDPEDKLNVEDKLSQ
                              *   *:   .  :: :: .          : *           . :*        *::**

Nematostella_vectensis|15813  VNVLQQLHNLKSFPFISNPLSKGALNLYGLWFDIKEGEMYMFSRKQKKFVLINKDTVNNL
Branchiostoma_floridae|2914   VNVLQQLQNVSSHGFLKPRLKSGALQLHGMWLDSRQQLPYLFSKEQQRFVQITDNNIDSL
Bombyx_mori|3357              VNTLQQLQNIASYGMLKKRLEKHDLHIHALWFDIYTGDIYYFSRRAKQFVIIDESTYEMI
Apis_mellifera|9826           INTLQQLQNIASYGFLKKRLERHDLHIHALWFDIXXXXXXXXXXXXXXXXXXXXXXXXXX
Culex_quinquefasciatus|4121   VNTLQQIENIASYGFLKKRLESHDLHIHALWFDIYTGDIYYFSRNSKRFIPVDETTIERL
Drosophila_melanogaster|13178 INTLQQMSNIASYGFLKARLESHDLHIHALWFDIYTGDIYYFSRGAKRFLPVDEDTVDRL
Drosophila_sechellia|13379    INTLQQMSNIASYGFLKARLESHDLHIHALWFDIYTGDIYYFSRGAKRFLPVDEDTVDRL
Drosophila_simulans|8422      INTLQQMSNIASYGFLKARLESHDLHIHALWFDIYTGDIYYFSRGAKRFLPVDEDTVDRL
Tribolium_castaneum|14449     INTLQQLQNIASYGFLKKRLEKHQLHIHALWFDIYTGEIYYFSRGAKKFVVIDEENFPKL
Pogonomyrmex_barbatus|11176   VD--QHIATTSKYRIL--------------WI------------PEKAFRAT--------
Linepithema_humile|3407       INTLQQLQNIASYGFLKKRLERHDLHIHALWFDIYTGDIYYFSRANKRFVEINETTEPFL
Nasonia_vitripennis|3424      INTLQQLQNVASYGFLKRRLEKHNLHVHALWFDIYTGDIYYFSRANKRFVEINELTETPL
Caenorhabditis_elegans|25274  INVLQQLINICSHEFLKEYLESGRLHIHGMWFDIYKGEDYLFSKDKKRFVVIDEKTVTDL
Caenorhabditis_elegans|16878  INTLQQLENVASHGFLKEFLVSQTVDLHAMWFDIYTGEMHMFSKPNKQFVLVDESNVEEL
                              ::  *:: .  .. ::              *:                            

Nematostella_vectensis|15813  CSEVD---------------------------
Branchiostoma_floridae|2914   L-------------------------------
Bombyx_mori|3357              LSEVRRFYS-----------------------
Apis_mellifera|9826           XXXXXXXXXXXXXXXXXXXXXXKTEFDLLNLL
Culex_quinquefasciatus|4121   LKEVNQFYS-----------------------
Drosophila_melanogaster|13178 SEEVRRFYS-----------------------
Drosophila_sechellia|13379    SEEVRRFYS-----------------------
Drosophila_simulans|8422      SEEVRRFYS-----------------------
Tribolium_castaneum|14449     LQEVEKYYS-----------------------
Pogonomyrmex_barbatus|11176   --------------------------------
Linepithema_humile|3407       LKEIKKYYS-----------------------
Nasonia_vitripennis|3424      LKEIKKYYS-----------------------
Caenorhabditis_elegans|25274  LAELNARYP--------VPEDQDGPVAFAKSN
Caenorhabditis_elegans|16878  IDEVEKHQT-----------------------