Orthologs Set ID: EOG4006D4


Orthology Database
OrthoDB4
Gene Symbol(s)
GH11902,MUT-2,PUP-3

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Apis mellifera 35057 130, 318, 585, 778, 1082, 1321
Bombyx mori 7 669, 831, 1082, 1321
Caenorhabditis elegans 1348 585, 700, 1008, 1126, 1261, 1517
Caenorhabditis elegans 1678 621, 902, 1124, 1223, 1315, 1637, 1826
Culex quinquefasciatus 2740
Daphnia pulex 920 318, 585, 957, 1082
Drosophila grimshawi 9288 133, 1082
Drosophila melanogaster 19581 133, 1082
Drosophila sechellia 4692
Drosophila sechellia 4696 133, 201
Drosophila willistoni 15252 1082
Drosophila yakuba 12350 133, 1082
Ixodes scapularis 18156 834, 1082, 1474
Linepithema humile 71 831, 1082, 1321
Nasonia vitripennis 5334 46, 318, 585, 831, 1082, 1321
Pediculus humanus 6351
Pogonomyrmex barbatus 611 118, 318, 585, 837, 1082, 1321
Tribolium castaneum 8312 118, 318, 585, 831, 1082

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Apis mellifera 35057 GB14042-PA apiMel3
Bombyx mori 7 BGIBMGA008573-TA v2.0
Caenorhabditis elegans 1348 F59A3.9, NM_059220 172207 WBGene00019082 pup-3 ce6
Caenorhabditis elegans 1678 K04F10.6a 187005 WBGene00003499 mut-2 ce6
Culex quinquefasciatus 2740 CPIJ002001-RA 6033034 CPIJ002001 CpipJ1
Daphnia pulex 920 gw1.99.65.1 1.1
Drosophila grimshawi 9288 FBtr0147316 6565156 FBgn0119381 GH11902 droGri2
Drosophila melanogaster 19581 FBtr0070236, NM_130548 31081 FBgn0024360 CG11418 dm3
Drosophila sechellia 4692 FBtr0201970 6615967 FBgn0173888 GM18985 droSec1
Drosophila sechellia 4696 FBtr0201968 6615969 FBgn0173886 GM18983 droSec1
Drosophila willistoni 15252 FBtr0246885 6644673 FBgn0218236 GK16234 r1.3
Drosophila yakuba 12350 FBtr0263052 6523905 FBgn0234049 GE16534 droYak2
Ixodes scapularis 18156 ISCW022229-RA ISCW022229 IscaW1
Linepithema humile 71 LH24667-RA 1.2
Nasonia vitripennis 5334 NV11829-RA 1.2
Pediculus humanus 6351 PHUM400420-RA 8237961 PHUM400420 PhumU1
Pogonomyrmex barbatus 611 PB19015-RA 1.2
Tribolium castaneum 8312 GLEAN_09322 Tcas3.0

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Apis mellifera 4040 GB14042 apiMel3
Bombyx mori 8573 BGIBMGA008573-PA v2.0
Caenorhabditis elegans 235 K04F10.6a 187005 WBGene00003499 mut-2 ce6
Caenorhabditis elegans 665 F59A3.9 172207 WBGene00019082 pup-3 ce6
Culex quinquefasciatus 7005 CPIJ002001 CpipJ1
Daphnia pulex 15262 JGI_V11_11736 1.1
Drosophila grimshawi 1857 FBpp0145808 6565156 FBgn0119381 GH11902 droGri2
Drosophila melanogaster 18088 FBpp0070227 31081 FBgn0024360 CG11418 dm3
Drosophila sechellia 8803 FBpp0200460 6615969 FBgn0173886 GM18983 droSec1
Drosophila sechellia 8805 FBpp0200462 6615967 FBgn0173888 GM18985 droSec1
Drosophila willistoni 6126 FBpp0245377 6644673 FBgn0218236 GK16234 r1.3
Drosophila yakuba 6879 FBpp0261544 6523905 FBgn0234049 GE16534 droYak2
Ixodes scapularis 18153 ISCW022229-PA ISCW022229 IscaW1
Linepithema humile 14962 LH24667-PA 1.2
Nasonia vitripennis 1803 NV11829-PA 1.2
Pediculus humanus 6221 PHUM400420-PA 8237961 PHUM400420 PhumU1
Pogonomyrmex barbatus 9015 PB19015-PA 1.2
Tribolium castaneum 9094 GLEAN_09322 Tcas3.0

multiple sequence alignment in CLUSTALW format


Caenorhabditis_elegans|1348   ------------------------------------------------------------
Caenorhabditis_elegans|1678   ------------------------------------------------------------
Pediculus_humanus|6351        ------------------------------------------------------------
Ixodes_scapularis|18156       ------------------------------------------------------------
Apis_mellifera|35057          ATGGCGCTTATACATCGAGTTAATATAAATTTTGGATTTGTATTAAATACATTTTATTGT
Nasonia_vitripennis|5334      ATGGTTGTAGTCTACAATTTAGCATTGGATGAGTGTAAAGTTCCGAGTGCTTATCATATG
Linepithema_humile|71         ------------------------------------------------------------
Pogonomyrmex_barbatus|611     ---ATGGGCACAGGTAGATTAAGATTACGTGGTCGTACATCGATGTTGTTAAACGTGCAA
Daphnia_pulex|920             ------------------------------------------------------------
Bombyx_mori|7                 ------------------------------------------------------------
Tribolium_castaneum|8312      ATGTCGGTTTTTTTGACTTGCCGTTTGAAAAATTCAATTGGGCGAAAGAAATTCTTCAAT
Culex_quinquefasciatus|2740   ------------------------------------------------------------
Drosophila_willistoni|15252   ------------------------------------------------------------
Drosophila_grimshawi|9288     ---------ATGAACACCCTTATGCGCCGA---GCACAACAGCTACGACTCTGGCGCACA
Drosophila_yakuba|12350       ---------ATGAACAGCTTAGTGCGACGCAGCGCCCAGCAGCTGAACCTCTGGCGTACG
Drosophila_sechellia|4696     ---------ATGAACAGCTTAGTGCGACGCAGCGCCCAGCAGCTGAGCCTCTGGCGTACA
Drosophila_melanogaster|19581 ---------ATGAACAGCTTAGTGCGACGCAGCGCCCAGCAGCTGAGCCTCTGGCGTACA
Drosophila_sechellia|4692     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|1348   ------------------------------------------------------------
Caenorhabditis_elegans|1678   ------------------------------------------------------------
Pediculus_humanus|6351        ---------------------------------ATGTACAAATTTGAAACAAATTCAATG
Ixodes_scapularis|18156       ------------------------------------------------------------
Apis_mellifera|35057          AAATGTATAGTAAACATAAAAAGATGTAAAACAGAATATAATATTAAAAGTCAAACAAAT
Nasonia_vitripennis|5334      ---------------------------------------------------------GAA
Linepithema_humile|71         ------------------------------------------------------------
Pogonomyrmex_barbatus|611     TAC---------------------------------------AAGAGCAGTACGAGGAGC
Daphnia_pulex|920             ------------------------------------------------------------
Bombyx_mori|7                 ------------------------------------------------------------
Tribolium_castaneum|8312      TTCAGTAGT------------GATATTGTACGC---------CAATTGTCTCAACAAGTG
Culex_quinquefasciatus|2740   ------------------------------------------------------------
Drosophila_willistoni|15252   ------------------------------------------------------------
Drosophila_grimshawi|9288     TATTGCATA------------AAACAGAGCGCT---------GTC---GCCGGCACTGAG
Drosophila_yakuba|12350       TATTGCGTA------------AAACACAATGCT---------CCGGAAGCGGCTTCTCCC
Drosophila_sechellia|4696     TATTGCGTA------------AAGCACAATGCT---------CCGGAGGCGGCTTCTCCC
Drosophila_melanogaster|19581 TATTGCATA------------AAGCACAATGCT---------TCAGAGGCGGCTTCTCCC
Drosophila_sechellia|4692     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|1348   ---------ATGGCTCCAAGAACATATGCATCAGTACTTACCACACCCAGAGGTCCAGCC
Caenorhabditis_elegans|1678   ------------------------------ATGTCTCAACCAAATAAAGATCAGCGAAGT
Pediculus_humanus|6351        AAATATGTTTTGTTAGAAATGGAAAATGGCGAACAATTATCAAATCTCATTAATCATAGC
Ixodes_scapularis|18156       ------------------------------------------------------------
Apis_mellifera|35057          GTTAAGTATGGTGAAAATATAACGTTTGGAGATATGCTTAAATTTAGACAAACTCAAGCA
Nasonia_vitripennis|5334      AGAAAGCAAAAAAAGTATATTACATACGATGAAGTCTTGGCTCAAAGAAGATTACAAGCT
Linepithema_humile|71         ------------------------------------------------------------
Pogonomyrmex_barbatus|611     AATTTTACAGGTGTGCAAACGACACTTGAGACTGAAATCATCCAGAGAAGAGATCAGGCA
Daphnia_pulex|920             ---------------------CATTTTGATGAGATGGTGAGTTTTCGGAAGAAAGAAGCC
Bombyx_mori|7                 ------------------------------------------------------------
Tribolium_castaneum|8312      AAGCAAAATGAGTCGTTTGTGCCCTTTATGGACGTTATAAAATTTCGGCGAGAGGAGGCC
Culex_quinquefasciatus|2740   ---------------------------------ATGCTGGCAGGGCGACGTGCGGAGGCG
Drosophila_willistoni|15252   ------------------------------------------------------------
Drosophila_grimshawi|9288     GTCGCCTCGAGAGGAAAGCCCAGTTATGAGGAGTTCATTGGAAGCCGGCATCAGCAGGCG
Drosophila_yakuba|12350       GGCCGGAACGCAGGCAAGCCCAACTACGAGGAGTTCATTGGCCGCCACCAGCGACGGGCG
Drosophila_sechellia|4696     GGCCGGAACGCAGGAAGGCCCAACTACGAGGAGTTCATTGCCGGTCATCAGAGACATGCC
Drosophila_melanogaster|19581 GGACGGAACGCAGGCAGGCCCAACTACGAGGAGTTCATTGGCCGTCATCAGCGACAGGCC
Drosophila_sechellia|4692     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|1348   CCCCTTGCACTA------------------------------TATTGTCCTGAAGCTCCA
Caenorhabditis_elegans|1678   CCAGAAGACATAGACTTTAAGGTCAAAGCGAATCCAAAAGCGTTT---------CACAAA
Pediculus_humanus|6351        AAATCTCATGGTGGTGGTGGTGGTGGTGGGAAAAGGGGAAAATTTTCAATTTTGAATTCG
Ixodes_scapularis|18156       ------------------------------------------------------------
Apis_mellifera|35057          AAAAAATCTGTTTTAATAGGGGTA------CCAGAAAATTATATTTATGATATGGAAAAA
Nasonia_vitripennis|5334      CATCGTTCAGTTTTAATAGAAGTT---CAATCGGACAAATCTTGCACTGATGTGTATGCA
Linepithema_humile|71         ------------------------------------------------------------
Pogonomyrmex_barbatus|611     CGTCGCAGCTTATTGATACAAGTA---TATTCACCCAAGTCACATAATGATCTCTATAAC
Daphnia_pulex|920             AGATCTTCTGTTGTTATTCAGGTGGGAAACCCTTCTAAGCCTGCTACTTTGTTAAATCAA
Bombyx_mori|7                 ------------------------------------------------ATGTCATACACT
Tribolium_castaneum|8312      AGACGCAGTATTTTAGTGCAAGTC---CAATCGGCTCAGTCCTTTAAAGAACTCCACTCG
Culex_quinquefasciatus|2740   CGGCGCAGCATTCTGGTGCAGGTC---AGCTCGGAGCGGTCCTTCCCGGAGCTGGCGACG
Drosophila_willistoni|15252   ------------------------------------------------------------
Drosophila_grimshawi|9288     CAGCGCAGCATTGTGGTACAGGTC---AGCTCGGAGAGGTCATACACGGAATTGTATAAC
Drosophila_yakuba|12350       CAGTGCAGCATTGTGGTCCAGGTG---AGCTCCGAGAAGTCGTATGCGGAGTTGTATAAC
Drosophila_sechellia|4696     CAGTGCAGCATTGTGGTCCAG------------------TCGTATGCGGAGTTGTATAAC
Drosophila_melanogaster|19581 CAGTGCAGCATTGTGGTCCAGGTG---AGCTCCGAAAAGTCGTATGAGGAGTTGTATAAC
Drosophila_sechellia|4692     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|1348   GAATGCCCAAAACTTGAAGCCATTTCAAATTTGAGCTTTCAACAGATC------------
Caenorhabditis_elegans|1678   TTTAACGGAAAGTTTCAACGCGTTTTAAGG------------------------------
Pediculus_humanus|6351        CTCGGAGGACATTTTGGATATTTCAACGATTCCATCGTATACGATCAT------------
Ixodes_scapularis|18156       ------------------------------------------------------------
Apis_mellifera|35057          TATTGTTTAAAACATGTGAATATTAAAAAAATATTATTTTATAATACA------------
Nasonia_vitripennis|5334      CACTGTTCTCAATTTGGAAAAATCAATGGATTATTTCACTATACGACT------------
Linepithema_humile|71         ------------------------------------------------------------
Pogonomyrmex_barbatus|611     TATTGTTCACGTTTTGGTGACATTTTAAGTATGCATCACTATCAAGTA---------AAT
Daphnia_pulex|920             GTGTGTTCCAGGCATGGAACTGTAAAACACGTGTTTCATTACACATAT------------
Bombyx_mori|7                 CCTGTAGCTCACATCAAAAAGATGTTGACGTTATGGCTTTACATCACC------------
Tribolium_castaneum|8312      TATTGCAATTCTGTGGGGAATGTTAGGCAAATGTTGCACTACACAGTT------------
Culex_quinquefasciatus|2740   TACTGTGGCCAGTTTGGCACGATAGCCAGCGCGCACCACTACTGCGTCGGGGGGAGCCAG
Drosophila_willistoni|15252   ------------------------------------------------------------
Drosophila_grimshawi|9288     TACTGCAGCAGATTTGGACGCATTGTTATCGCCCAGCACTATTGTGTG------------
Drosophila_yakuba|12350       TACTGCAGCAGCTTCGGCTCCATCCTGGGCGCCCACCACTACTGCGTG------------
Drosophila_sechellia|4696     TACTGCAGCAGCTTCGGCTCGATCATGGGCGCCCACCACTACTGCGTG------------
Drosophila_melanogaster|19581 TACTGCAGCAGCTTCGGCTCGATCATGGGTGCCCACCACTACTGCGTG------------
Drosophila_sechellia|4692     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|1348   ------------------------------------------------------------
Caenorhabditis_elegans|1678   ------------------------------------------------------------
Pediculus_humanus|6351        ------------------------------------------------------------
Ixodes_scapularis|18156       ------------------------------------------------------------
Apis_mellifera|35057          ------GAAACTAATAGATGTTTTGTATTAATGGAATTAATGACAGAAAAAGATGTGGAA
Nasonia_vitripennis|5334      ---CAAGGAATGGAAAGGCATTTTGTCCTTGTTGAATTTGATAGTCAAGAAAGTGTCAAT
Linepithema_humile|71         ------------------------------------------------------------
Pogonomyrmex_barbatus|611     AGGAATCACTATCAAGAAAATTATATTTTAGTTGAATTTAAAGATGTTGTATCGGTAGAT
Daphnia_pulex|920             ---------CAAAACAAGGAGTTACTACTTTTAGAGTTTGATTCTGAAGCATCAGTTAAA
Bombyx_mori|7                 ------------------------------------------------------------
Tribolium_castaneum|8312      ---GGGGTTGAACCACTGAATTTCATTGTGGTGGAATTTGCATCCGAAAAGGACGTAACC
Culex_quinquefasciatus|2740   CAGGGTGACGAGGACTGCCACTACATCGTGGTGGAGTTTGACGAGCCGGGTGCGGCGGAC
Drosophila_willistoni|15252   ------------------------------------------------------------
Drosophila_grimshawi|9288     CCGCACGAGGATGAGCTACACTATATGCTGCTAGAGTATGCCAGCGCCGGTGAGGCGGCC
Drosophila_yakuba|12350       CGGCAGGACGAGACCCTGCACTACATCCTGCTGGAGTACGCCACTCCGAGCGAGGCGGCG
Drosophila_sechellia|4696     CGGCAAGACGAGACCCTGCACTACATCCTGCTGGAGTACGCCACGTCGGACGAGGCGGCG
Drosophila_melanogaster|19581 CGGCAGGACGAGACCCTGCACTACATCCTGCTGGAGTACGCCACGTCGGACGAGGCGGCG
Drosophila_sechellia|4692     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|1348   ------------------------------------------------------------
Caenorhabditis_elegans|1678   ------------------------------------------------------------
Pediculus_humanus|6351        ------------------------------------GAGAAAATTATTCCCACCACCACA
Ixodes_scapularis|18156       ------------------------------------------------------------
Apis_mellifera|35057          ATTTTTAGAAACATGGCTTCATGTAAAATAAATTCA------------AATGCTCATTCT
Nasonia_vitripennis|5334      GCAGTTTTGTCAGCCTCAACACATGTTAATCATGAA------------CAAATAATTCCA
Linepithema_humile|71         ------------------------------------------------------------
Pogonomyrmex_barbatus|611     GAAATTATGTCGTATGCTTCATTCGTAAGATCAGAT------------TATATTGCTCCT
Daphnia_pulex|920             AATCTTCTAGCCAGCTGTTCTCACAACAATAATTAT------------AAAGTCATCCCA
Bombyx_mori|7                 ------------------------------------------------------------
Tribolium_castaneum|8312      AATGTTCTTGAGCGCAGTTCTTATCTGGAAGACAGT------------CAAGTGGTTCCA
Culex_quinquefasciatus|2740   GCAGCGATCGGGTCGGCGGTTTTCAACGAGGAAAAG------------CCGGGCGTGAGG
Drosophila_willistoni|15252   ---------------------------------------------ATGAGTGGGACACCA
Drosophila_grimshawi|9288     GCTGCCATCAACTCAAGTGCCTACAATGCGGAGCTGGGCAGCAGTGGCAGCGGTGTTCCG
Drosophila_yakuba|12350       GCGGCCATTGGAGCGGGAGTCACCAATGGCGAGCTG------------AGCGGCGTGCCC
Drosophila_sechellia|4696     ACTGCCATTGGAGCGGGCGTCACCAATGGCGAGCTA------------AGCGGCGTGCCT
Drosophila_melanogaster|19581 GCTGCCATCGGAGCGGGCGTTACCAATGGCGAGCTG------------AGCGGCGTGCCC
Drosophila_sechellia|4692     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|1348   ------------------------------------------------------------
Caenorhabditis_elegans|1678   ------------------------------------------------------------
Pediculus_humanus|6351        GTGATGGAAAATTATGATTATTATTACTCGAATGTTAATAATAAT---------------
Ixodes_scapularis|18156       ------------------------------------------------------------
Apis_mellifera|35057          GTTACACCATTATTTTTGTATAAAGTTAGAAATTCAAGTTATAATAAGCCAATGACAAAA
Nasonia_vitripennis|5334      GTTCGCTCAACCATGCTATGGTTTCGAAATCCTCCACAACGAGTAGACATAAAACCAATT
Linepithema_humile|71         ------------------------------------------------------------
Pogonomyrmex_barbatus|611     GTGAAATCATCAGTATTATGGTTCCGT---------------------------------
Daphnia_pulex|920             GTTGCCTCACCTTTCCTATGGCTAAAGGCAATGCCA------------------CCAGAG
Bombyx_mori|7                 ------------ATTTCTATGGTCAGAGCAGTCTCAGGAAAGAAA------------GAA
Tribolium_castaneum|8312      GTCCAGTCACAATTTTTGTGGTTTAGGGCTTCAAATCGTAAATTA---------CCAAAA
Culex_quinquefasciatus|2740   GCGCGGTCGATATTTCTGTGGTTTCGGGCGGGGCCGAAGGCGAAG---------------
Drosophila_willistoni|15252   GTACGCTCGCCATTCCTATGGTTCAGAGCGTCGACGGGCAAAAAGAAGGAGAGCATATCC
Drosophila_grimshawi|9288     GTACGTTCGCCCTTCCTGTGGTTTCGAGCAGCAGCGTCTGGCCGTCGAGGGCTGGCCAAA
Drosophila_yakuba|12350       GTGCGATCACCCTTTCTGTGGTTCCGCGCGGCGGGAGGAGGCAAACGGAGC---CCCAAG
Drosophila_sechellia|4696     GTGCGATCTCCCTTTCTGTGGTTCCGAGCAGCGGGAGGAGGCAGACGGGGC---CCCAAG
Drosophila_melanogaster|19581 GTGCGATCTCCCTTTCTGTGGTTCCGGGCAGCGGGAGGAGGCAGACGGAGC---CCCAAG
Drosophila_sechellia|4692     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|1348   ---------------------------------------ACGCAGCAGGCTGGAACTTCC
Caenorhabditis_elegans|1678   ---------------------------------------------------------GAT
Pediculus_humanus|6351        ---------------------------------------------GATGATAATTCAAAA
Ixodes_scapularis|18156       ------------------------------------------------------------
Apis_mellifera|35057          AAGTCAATAATGTTTAAACCT---------------------------------CCTAAT
Nasonia_vitripennis|5334      AATGATACACTTAGTGTACCA---------CTATCTAGAAATTCCTGCAAAATATTATCT
Linepithema_humile|71         ------------------------------------------------------------
Pogonomyrmex_barbatus|611     ---------------------------------------AAAGGACAAGTTGCTATCTCA
Daphnia_pulex|920             TCATATTCTGCTGTATCTTCC---AGGCTTCCTCCAATAATCAAAGAAAATATTTCAGCA
Bombyx_mori|7                 GCGTTTCAGATTCCTAAATCA---CAACTCATGACGACAAAAGGTTGTAATTCAATCGAT
Tribolium_castaneum|8312      TTAAAGCAGTCCAAAAGTGCC---ATTTTAAGCATTGAAAATGGTAATCAGTGTGTGACA
Culex_quinquefasciatus|2740   ---CTGACGGAGAAGCAGCCC---AAGTTGGGCGCGGTAGAAGGTTCCAGGGGGGTGGAC
Drosophila_willistoni|15252   TCCTCCACCATGCCTCATCCA---GGTCTATTGAGCATCGATGGATGTAGACCCATAGGA
Drosophila_grimshawi|9288     CTGGCTGCCAACCAGCATCCACTGCCGTTGGCCACAATCGACGGCACCCGACCGCCAACC
Drosophila_yakuba|12350       TTGGTGCCCAATCCAGCGCCC---ACACTGCTCTCCTTGGACGGCACCCGACTGGCGGAT
Drosophila_sechellia|4696     CTGGTTGCCAATACAGCGCCC---GCACTGCTATCCTTGGACGGCACCCGGCAGGTGGAT
Drosophila_melanogaster|19581 CTAGTTGCCAATACAGCGCCC---GCACTGCTATCCTTGGACGGCACCCGGCAGGTGGAT
Drosophila_sechellia|4692     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|1348   AATGATCAGGGATTCGAATTTGAAAATACATACGTTGAGCACAGAATAAATCAAGAAATC
Caenorhabditis_elegans|1678   CACGAGGACGATTTCAATATATTG------------------TCTATCAGTATGCAGGAT
Pediculus_humanus|6351        ACAAATTCAATTCGAAAACTGTTGAAAGAATACAAAACGTTAGATTTGGACAATCAAATA
Ixodes_scapularis|18156       ---------------------------------------------------------ATG
Apis_mellifera|35057          TTCGATCAAATCAAAGAATCATTGAAAAATAAAAAT------ACTATATCGGAACAAATG
Nasonia_vitripennis|5334      AACCCTGAACTTTTTAAAATTTTAGTGTCAGCTGAA------TCGATTTCAGATCAAATC
Linepithema_humile|71         ---------------------------------------------GTATCAGGACAAATA
Pogonomyrmex_barbatus|611     CAAAAATATCAGACA---------------------------AAGATATCTGGGCAAATA
Daphnia_pulex|920             AATGACAATTTACAAGAACACCTCTCTAATGCCAAA------TCGATTTCAGAACAAATG
Bombyx_mori|7                 GAAGATAACTTAATTGAAGAGTTAGCAAATTGTGAG------GATGTGTCAGAACAAATT
Tribolium_castaneum|8312      CCTTCTGAAATAGTGAATTTGTTGAGCAAATGTGAT------TCAGTGTCTGAGCAAATG
Culex_quinquefasciatus|2740   AGTGGCGAGTTGAGGGAGCTGTTGCTTTCGGCGGAG------GGCGTTGAAGATCAGCTG
Drosophila_willistoni|15252   CAAGAGAATTTACTTTCACTGCTTAGAAAAGCAGAG------AATATTGACCGTCAAATC
Drosophila_grimshawi|9288     CACGAACAATTGCAGCAGCTGCTGCGCGGTGCCGAG------AGTATTGAGCAACAAATT
Drosophila_yakuba|12350       CAGGGGCATCTCCTGGGTCTGCTGCGAGGTGCAGCG------GACATCGAAGAGCAGGTG
Drosophila_sechellia|4696     CAGGGCCATCTACTGGGGCTCCTGCGTGGTGCAGCT------GACATCGAAGAGCAGGTG
Drosophila_melanogaster|19581 CAGCGCCACCTACTGGGGCTCTTACGTGGTGCAGCG------GACATCGAAGAGCAGGTG
Drosophila_sechellia|4692     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|1348   GAATCCTTCGTCGACACACATCATCAAGAACCTCTTCGAAAG---------------GCA
Caenorhabditis_elegans|1678   CATTTCGATACTACGAAACAGCCAAAAGAGGAGTTCGGTAAAAAAATGGATTGG------
Pediculus_humanus|6351        CGTTTACTACACGACTCGTACAAATTGAATGATTTGGGATACAGATTGAGATACATGATG
Ixodes_scapularis|18156       GTCCGCTTCTACGAGAATGAGAGACTGAATGACTTGGAGTTGCGGCTTGGGTTCCTGGTG
Apis_mellifera|35057          ATTATTCTTCACCATTTATTGAAAATTACAGACTTAGATATAAGATTGAGATTTTTTACT
Nasonia_vitripennis|5334      AAATTACTGCACGAGTGTTCAAAACTGAATGATGTAGGTGTACGTTTGAGATTTTATACA
Linepithema_humile|71         ACTGATTTCTATGAAACACTAAAATTAAATGATTTAGAAACAAGACTTAGATTTCACACC
Pogonomyrmex_barbatus|611     ATAATTCTTTATGAGACGTTGAGATTAACTGATTTAGAAATAAGGCTAAGATTTCATACC
Daphnia_pulex|920             ACAATTTTGGATGATCAAACCCGTTTATCAGAAATCGGTCACAGGCTCAGGTGGCTAACC
Bombyx_mori|7                 CAACAGATGCACGATAGGACAGCTTTGAATGATCTAGGTGTGAGATTGAGGTATATGGTA
Tribolium_castaneum|8312      AATGTTCTTTACAATTCAACCAAATTGAACGATCTTGGGACGAGATTACGTTTTTTAACT
Culex_quinquefasciatus|2740   AAGGTTTTGCACAGGACGACCTGCTTGAACGATGTGGGGAAGCGTTTGCGGTTTTTGGCG
Drosophila_willistoni|15252   GTTGAACTCCATCAAAATTCCCAACTCAATGATTTGGGAGTGCGGATGCGGTTTCTGGCT
Drosophila_grimshawi|9288     CTTAAACTCTACGAGCACACACGCTTAAATGACTTGGGTGTACGGATGCGATTTTTGGCA
Drosophila_yakuba|12350       CTGCAGCTGCACGAGCACACGCGACTGAATGAGCTGGGAGTCCGCATGCGTTTTCTAGCA
Drosophila_sechellia|4696     CAGCAGCTGCACGAGCACACGCGCCTGAATGAGCTGGGAATCCGCATGCGCTTTCTAGCC
Drosophila_melanogaster|19581 CAGCAGCTGTACGAGCACACGCGCCTGAATGAGCTGGGAATCCGTATGCGCTTTCTAGCC
Drosophila_sechellia|4692     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|1348   GCAGCTCAATTCAGAGCGGTCATGAAACAAGAATATCCAGAT------TCGACATGCTTC
Caenorhabditis_elegans|1678   TGCTATCAGCTGAAGAATATAATTTCGAAGAACAATCCAACGTGGCTATTCAATATCGTG
Pediculus_humanus|6351        TGGAAACAAATACAAAATTTAGTCAACGTTCTCCTACCAACT------CATTCCGTGTAT
Ixodes_scapularis|18156       TGCAGGCAGATAGAAGAGTTCATATCCGGTCTCTACCCCAGG------GGCTCCGTGTTG
Apis_mellifera|35057          GCTGAACAAATTTCTTATTATTTATCTAGATTATTTATGAAT------GTATCTGTCATA
Nasonia_vitripennis|5334      GCCTATCAAATCGAGTGTTGTTTCCATGGCTTATTTCCAAAC------ATTGCTGTTTTA
Linepithema_humile|71         GCCCATCACTTGGAGCAATATTTTTCTAGATTGTTTCAAAAC------ATGAGAGTTCTA
Pogonomyrmex_barbatus|611     GCTCAGCACTTGGAGCAATACTTCTCTGGGCTATTTCATAAT------ATGAGAGTCCTA
Daphnia_pulex|920             AGCATTCAAATCGAACAAACGTTATCGCGTTTGTTTCCAAGT------CTACAAGTGCTA
Bombyx_mori|7                 GCAAGGCAGATAGAAAGGATATTTGAGAGCCTGTATGCCAAT------ATAGTTGTGAGA
Tribolium_castaneum|8312      GCAAGACAAGTCGAAAATGCTGTTAGGGGGATGTTTCCAAAG------GCTAAGGCTTAT
Culex_quinquefasciatus|2740   GTTCGTCAGGTGGAGAGTTCGCTGCAAGGGATGTTCCCGCAG------GCTGTTGCGTTC
Drosophila_willistoni|15252   GCTCTACAAATCCAGCAGTCCATTTCTGGCATGTTTCCCTCA------GCCCAGGCAGTG
Drosophila_grimshawi|9288     GCGCTACAGGTCCAGCAGGCTATCTCTGGCATGTTTCCGGAT------GCGCTGGCGCAG
Drosophila_yakuba|12350       GCCCTGCAGGTGCAGCAGGCCATCGCCGGCATGTTCCCCGCC------GCCCAGGCTCAA
Drosophila_sechellia|4696     GCCCTCCAGGTACAGCAGGCCATTGCCGGCATGTTTCCCGCC------GCCCAGGCACAG
Drosophila_melanogaster|19581 GCCCTACAGGTGCAGCAGGCCATTGCCGGCATGTTTCCCGCC------GCCCAGGCACAG
Drosophila_sechellia|4692     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|1348   ATCACTGGATCATATCCTGCCGGAGTTGACATCTTCTCCTCTGATATTGATTTTACCGTC
Caenorhabditis_elegans|1678   CCAACTGGAAGTACAGTAACCGGATTGGCCACTAAAAACAGTGATCTAGACGTTGCAATT
Pediculus_humanus|6351        CCGTTCGGTAGTGCCGTGAACGGTTTGGGTGACGTCACGAGCGATTTAGATTTGGTCGTC
Ixodes_scapularis|18156       CCTTTCGGGTCGCTCGTCAATGGATTTGGCCGGCATAATTGTGACATAGACATGGTCTAC
Apis_mellifera|35057          CCATTTGGATCTTCTGTTAATGGTTTTGGTCAAATAGGATGTGATCTTGATTTATTATAC
Nasonia_vitripennis|5334      CCATTTGGTTCTTCTGTCAATGGGTTTGGTAAACAAGGTTGTGATCTTGATTTAAGTGTT
Linepithema_humile|71         CCGTTTGGTTCCTCTGTAAATGGTTTTGGAAGGAAAAGGTGTGATCTTGATTTAGTTCTT
Pogonomyrmex_barbatus|611     CCATTTGGTTCCTCTATTAACGGTTTTGGAAGAAGAAAGTGTGACCTTGATTTAGTTCTT
Daphnia_pulex|920             CCTTTCGGATCCTTTGTCAACGGTAGTGCGCGGAATGGCTGTGATTTGGACATGGCCATC
Bombyx_mori|7                 CCATTCGGGTCATCTGTGAATGGTTTTGGAAAGATGGGCTGTGACTTAGACTTGGTGCTT
Tribolium_castaneum|8312      CCATTTGGCTCCTCGGTCAATGGGTATGGAAAAATGGGTTGTGACCTAGACCTAGTCTTA
Culex_quinquefasciatus|2740   CCGTTTGGCTCGTCGGTGAACGGATTTGGGAAGATGGGCTGTGATTTGGATATCATTTTG
Drosophila_willistoni|15252   CCATTCGGTTCATCAGTTAATGGTTTTGGCAAAATGGGCTGCGATCTGGATTTGATCCTG
Drosophila_grimshawi|9288     CCCTTCGGCTCCTCGGTGAATGGCTTTGGCAAAATGGGCTGTGACTTGGATTTGATATTG
Drosophila_yakuba|12350       CCCTTCGGTTCGTCGGTCAACGGATTCGGCCGGATGGGCTGCGACCTGGACCTTATCCTG
Drosophila_sechellia|4696     CCCTTCGGCTCGTCGGTCAACGGATTCGGTCGAATGGGCTGCGACCTGGATCTCATCCTG
Drosophila_melanogaster|19581 CCCTTTGGCTCGTCGGTCAACGGATTTGGGCGAATGGGCTGCGACCTGGACCTCATCCTG
Drosophila_sechellia|4692     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|1348   ------------------------------------------------------------
Caenorhabditis_elegans|1678   CAT------------------------------------ATCCCACAAGCGGCAAGAGTT
Pediculus_humanus|6351        CTT------------------------------------------------------CGT
Ixodes_scapularis|18156       TGC------------------------------------GTTCCAGAGAATGTGGATGCG
Apis_mellifera|35057          AGG---------------------------------------------------------
Nasonia_vitripennis|5334      ATT------TTTGAAGAAGAT------------------------AAAATGGAAAAAAAT
Linepithema_humile|71         GTT------------------------------CCCGATCACACTGCTAAACGTGATTCC
Pogonomyrmex_barbatus|611     GTT------------------------------------CCCAATTACAGTCAGGAAGGT
Daphnia_pulex|920             TCT------ATTGAAGGCAAT---------------TTTGGGTCCGAAATAATGGCTCTA
Bombyx_mori|7                 ACCAATATCCTGAATGAAGAA---------------------------ATGTGTGACTCA
Tribolium_castaneum|8312      CGA------TTATGTGACGAT---------------------------AAAGTAAAAAAT
Culex_quinquefasciatus|2740   GAT------TTGGACTCGGAA------------------GCGAACTTGAAGCAGAGTAAA
Drosophila_willistoni|15252   CGC------TTCGATAAGGAA------AGGGGAGCCAAAAATCAT---CAGCAAACTGAA
Drosophila_grimshawi|9288     CGC------TTTGATGGCGAAACAACAATAACCGATGGGCAGGAGATGAGTGCAAATGAA
Drosophila_yakuba|12350       CGC------TTCGACAACGAT------ATGGGGGCTAAGAGCTCTCTGGAAGAGGCGGTG
Drosophila_sechellia|4696     CGC------TTCGACAGTGAT------ATGGGGGCTAAGAGCCCACTGGAGGCGGCGGTG
Drosophila_melanogaster|19581 CGC------TTTGACAGCGAT------ATGGGAGCTAAGATCCCACTGGAGGCGGCGGTG
Drosophila_sechellia|4692     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|1348   ------------------------AAGGTTCCAACTTTGGAAGGTGCAAATCCATTTTTG
Caenorhabditis_elegans|1678   CTGGAACAAGAAGAACGTGGAAGAAATATCACAGATGACGAACGACAAGCATCATGGAGA
Pediculus_humanus|6351        GACGATTCCACGAGTTTCAGATGGCATAAAAATCCCGGCGTCGATATCAATTCCGTACAA
Ixodes_scapularis|18156       AAAGGACAGCTGTACTTCCAAGACAAGCACCAGATGATCAACGACAGGACACTGGTGCAG
Apis_mellifera|35057          ------------------------------------------------AATGAACAAAAA
Nasonia_vitripennis|5334      ACAAGTCGATTAGTGTTTCAAACTAAATCTATTTTAACTCACGAAAAATATCAAATGAAA
Linepithema_humile|71         AAAAGTAGATTAATATTTCACACAAAATCTATAAAACTTGACGAGAGGCACGGGACGAAG
Pogonomyrmex_barbatus|611     AACTCTAGGTTGGTATTTCACTCAAAGCCTATAAGGCATAATGATAGGACTGAAACGAAA
Daphnia_pulex|920             CAATCGCCCCTCATATTCCAAGCTAAAGCTGCGATAGACAATTACAGGCTGCAGACGCAA
Bombyx_mori|7                 TCAAAGAGATTGGTATATCAAGAGAAGAAGTGCGAAGGT---GGTCGCAGTCCTTGGCAG
Tribolium_castaneum|8312      GATGCCAGATTAATGTTTCACTGTAAGGGTTTAGTAGGGAGTGAAAGAACCGCTTCACAA
Culex_quinquefasciatus|2740   AGTTCGCGGCTGGTGTTCCACACTAAGGCGGCGAATTCGAATGAACGGACGCAGGTTCAG
Drosophila_willistoni|15252   CCCTCCCGTTTGATTTATCATCTGAAAGAGAATCTGAGTAATGGCCGTTCGCAAACACAG
Drosophila_grimshawi|9288     CCGTCTCGTCTCATCTACCACACCAAAGAGAACATGAGTAACGGACGGTCGCAGACGCAG
Drosophila_yakuba|12350       CCCTCGCGACTCGTGTACCACACCAAGGAGAACCTAAGCAACGGACGCTCGCAGACGCAA
Drosophila_sechellia|4696     CCCTCGCGACTTGTTTACCACACCAAGGAGAACCTGAGCAATGGACGCTCGCAGACACAA
Drosophila_melanogaster|19581 CCCTCGCGACTCGTGTACCACACCAAGGAGAACCTGAGCAACGGACGCTCGCAGACGCAA
Drosophila_sechellia|4692     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|1348   AAATTGATGCAG---TTGAGAAAAGAACTCAGCTGTTACTACACAATCTTCTCGAAGGCT
Caenorhabditis_elegans|1678   GAAATTCAATTGGAAATCCTACAAATTGTCCGTCTTAACTTACAAAATGATGAACAGATC
Pediculus_humanus|6351        AACGATTTGAGTTTATTGACGAACGTCATGACGAAAACATCCGTCGGTTGTGCAAAAGTC
Ixodes_scapularis|18156       AGGATATTGGAGACCTTGGGCGACCTGCTTCACTACGTGGTGCCCGGCGTCTCCGAAGTT
Apis_mellifera|35057          GAATTCTTGGATGCAATAAGCACAATAATGAAAATTTGTATTCCTGGTATTGACAATATA
Nasonia_vitripennis|5334      AGATTAATGGAAACAGTGGCTGACACAATGAATATTTTTGTACCTGGAATATCCAACGTT
Linepithema_humile|71         GAGTTCATGGGAATACTTGCCAGCACTATGGAGAACTTCATCCCTGGTGTTCGTAATGTG
Pogonomyrmex_barbatus|611     GAATTTCTAGGAGTACTTGCGAATGCTATGTACCAATTTATCCCCGGGATTTCTAATGTA
Daphnia_pulex|920             AAACATTTAGAGTTTTTCGCAGACGTGGTCCAAAATTATACAACAGGCTGTGTTCAGATC
Bombyx_mori|7                 CGACACATGGAGCTAGTTGGAGAATTGTTAGAACTAAGAGTGCCTGGTGCTACTAGAGTA
Tribolium_castaneum|8312      CGAAATATGGAAGCAATCGGTGATTTATTGCAGTTATTTTTGCCAGGGTGTTCACAAGTC
Culex_quinquefasciatus|2740   CGTCAGCTGGAATCTATTGGGGATGTGTTGCAGTTGTTCCTGCCCGGGGTCAACAGCGTT
Drosophila_willistoni|15252   CGACAAATGGAATCAATTGGCGATCTATTGCATCTGTTTCTCCCTGGTGTCTGTCATGTT
Drosophila_grimshawi|9288     CGGCAAATGGAATGCATCGGTGATTTGCTGCATTTGTTTCTGCCAGGCGTCTGCCATGTG
Drosophila_yakuba|12350       CGGCACATGGAATGCTTCGGAGATATGCTGCATTTGTTTCTGCCCGGCGTGTGCCATGTA
Drosophila_sechellia|4696     AGGCACATGGAATGCTTTGGAGATATGCTGCATCTGTTCCTGCCCGGCGTGTGCCATGTG
Drosophila_melanogaster|19581 AGGCACATGGAATGTTTTGGAGATATGCTGCATCTGTTCCTGCCCGGCGTGTGCCATGTG
Drosophila_sechellia|4692     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|1348   ------------------------------TATGTGCAAAAAGGAAACATTCCGGTTCTT
Caenorhabditis_elegans|1678   AATTCAAGAATTAATTGGGAACATGGAATCCAGCTCGTTCAAGCTCAAATTCAAATTTTG
Pediculus_humanus|6351        GTT---------------------------TTCATAAAACAAGCCAAAGTTCCCATTATT
Ixodes_scapularis|18156       CAC---------------------------CGCATCCTGCGGGCCCGCGTGCCCATCGTC
Apis_mellifera|35057          AAA---------------------------AAAATTCTTGAAGCACGAGTTCCTATAATT
Nasonia_vitripennis|5334      AGG---------------------------AAAATTTTAGAAGCAAGAGTTCCTATAATC
Linepithema_humile|71         CGA---------------------------AGGATATTGGAGGCTCGAGTGCCAATAATC
Pogonomyrmex_barbatus|611     AGA---------------------------AGGATTCTAGAGGCTCGAGTACCGATAATT
Daphnia_pulex|920             CAA---------------------------CGGATAATGCGAGCAAGAGTACCTATCATC
Bombyx_mori|7                 CAG---------------------------AGGATACTGCATGCAAGAGTCCCCATTGTA
Tribolium_castaneum|8312      CGC---------------------------CGAATATTGCAAGCCAGAGTCCCTATAATA
Culex_quinquefasciatus|2740   CGA---------------------------CGAATTTTGAAGGCACGAGTTCCCATCATC
Drosophila_willistoni|15252   CGT---------------------------CGGATTCTGCAGGCCAGAGTTCCCATTATC
Drosophila_grimshawi|9288     CGA---------------------------CGGATTCTGCAGGCACGCGTGCCCATTATC
Drosophila_yakuba|12350       AGG---------------------------CGTATTCTGCAGGCAAGGGTGCCTATCATC
Drosophila_sechellia|4696     AGG---------------------------CGTATTTTGCAGGCGAGGGTGCCTATCATC
Drosophila_melanogaster|19581 AGA---------------------------CGTATTTTGCAGGCGAGGGTGCCCATCATC
Drosophila_sechellia|4692     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|1348   CAACTGATGCATGCGGAAACAAAAGTATCAATTGATGTTACAATCGACAAT---------
Caenorhabditis_elegans|1678   AAAGTGATG---ACGGTAGACGGAATCGATTGTGATATCAGTGTAGTTATGGATCGATTT
Pediculus_humanus|6351        AAATACAAACATAGTTTTACGGGAGTCGAATGCGACGTGTCGATGCATCAA---------
Ixodes_scapularis|18156       AAGTTCCAGCACGACATAGTCGGCAGGGAGTGCGACCTGACGCTCAACAAT---------
Apis_mellifera|35057          AAATTTTTTAATCAAACTACAAATATGCATTGTGATCTCAGTAGTACAAAT---------
Nasonia_vitripennis|5334      AAATTTGATCACAGTCTGACTAGAGTAGAATGTGATCTTGCTATGACAAAT---------
Linepithema_humile|71         AAATTCAATTGCGAGTACACACATATTGAATGTGACTTGAGCACAACCAAC---------
Pogonomyrmex_barbatus|611     AAATTCCATTATGACTATACTCAAATTGAATGTGATTTAAGTGCGACAAAT---------
Daphnia_pulex|920             AAATTTCACCACGAGTTTACCGGAGTTGATTGTGACATATCAATGTCA------------
Bombyx_mori|7                 AAATATGCCCATGAATTCACTGATGTTGATTGCGATCTTTGTTATAATAAT---------
Tribolium_castaneum|8312      AAATATTACCAGCAACTGACTGACGTTGAGTGTGATCTTTCAATGGCAAAC---------
Culex_quinquefasciatus|2740   AAGTACCACCACGAGCATCTGGATCTGGAAATTGATCTTACGATGAACAAC---------
Drosophila_willistoni|15252   AAATACCATCATGAGCATTTGAATCTGGAGGTTGACTTATCAATGAGTAAT---------
Drosophila_grimshawi|9288     AAGTACCATCACGAGCATCTAAACCTGGAAGTGGATCTGTCCATGAGCAAC---------
Drosophila_yakuba|12350       AAGTACCACCATGAGCATCTGGACCTGGAGGTGGACCTCTCCATGAGCAAC---------
Drosophila_sechellia|4696     AAGTACCACCATGAGCATCTGGACCTGGAGGTGGACCTCTCCATGAGCAAC---------
Drosophila_melanogaster|19581 AAGTACCACCATGAGCATCTGGACCTGGAGGTGGACCTCTCCATGAGTAAC---------
Drosophila_sechellia|4692     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|1348   GATACCTCAAAACGGAACACTCAGCTTTTGGCATTTTATAGTCAATTAGACACAAGGTTT
Caenorhabditis_elegans|1678   CTGTCATCGATGCACAATTCTTTTTTGATTCGACATTTGGCACATATCGACGGCCGATTT
Pediculus_humanus|6351        ACGGAAGCGCTCAAAATGTCGCAAATTTTATTCGCTCTCTCAAATTTCGATCCCAGAATA
Ixodes_scapularis|18156       ATGTCCGGGGTGGACATGTCTCGTGTGCTGCACTTCTGCAGCCAGCTGGCACCCAGCCTG
Apis_mellifera|35057          GTGATTGCATTACATATGTCTGAATTGTTATATACATATGGAGAATTGGATTGGCGTGTT
Nasonia_vitripennis|5334      ATGTCCGCATATTATATGTCTGAATTGTTGTATATGTACGGTGAAATGGACAGGAGAGTT
Linepithema_humile|71         TTGATTGCTATATATATGTCCGAATTATTAAACTTTTATGGAGAGATAGATTACAGGGTA
Pogonomyrmex_barbatus|611     ATGACTGCCGTATATATGTCCGAATTATTAAATTTGTATGGAGAAATGGATTGGCGGGTG
Daphnia_pulex|920             TTATCTGGTGTTTTCATGTCTGAGTTGTTGTATCTTTACGACAAAATAGATTGGAGATTT
Bombyx_mori|7                 ATGTCTGGAGTATACATGTCAGAATTGCTTTGGCTCTACGGTTCTCTGGACCCCAGGGTT
Tribolium_castaneum|8312      ATGTCTGGAGTCCACATGTCCGACTTCCTGTACATCATGGGGTCCCTCGACGCGCGCATT
Culex_quinquefasciatus|2740   ATGACCGGAGTTCACATGTCGGAGCTGCTCTACCTGTTTGGGCAAATCGACCCACGTGTT
Drosophila_willistoni|15252   CTCTCTGGTTTCTATATGTCGGAGTTGCTTTATATGTTCGGTGAACTGGATACACGTGTG
Drosophila_grimshawi|9288     CTCACTGGCTTCTACATGTCCGAGCTGCTGTATATGTTTGGCGAGTTGGATCCACGCGTG
Drosophila_yakuba|12350       CTCACTGGCTTTTACATGTCGGAACTGCTCTACATGTTCGGCGAAATGGATCCGCGGGTG
Drosophila_sechellia|4696     CTG---------------------------------------------------------
Drosophila_melanogaster|19581 CTCACTGGCTTTTATATGTCGGAACTGCTTTACATGTTCGGTGAAATGGATCCGCGCGTA
Drosophila_sechellia|4692     ---------------ATGTCGGAACTGCTTTACATGTTCGGTGAAATGGATCCGCGCGTA
                                                                                          

Caenorhabditis_elegans|1348   CCACTATTGTGCAAAGCGATGAAAGCATGGGCGGCAAGTTGTGGAGTC---GAAGGAGCC
Caenorhabditis_elegans|1678   GCACCATTATGTGCAATCGTAAAACAATGGGCAGCCAGTACAAAAGTT---AAAGATCCA
Pediculus_humanus|6351        AAACCGTTAATATTTTTCATTAAAATATGGGCTCGAGAATTACGTTTG---ACGAGAGAA
Ixodes_scapularis|18156       GGGCCCCTGGTGTTCACCCTTCGTGGCTGGGCTAGTGCACAGGGCCTC---ACCAACAAG
Apis_mellifera|35057          AAACCACTTATTTGCACTATTCGTAAATGGGCAAGAAATACGAATATA---ACAAAGGAT
Nasonia_vitripennis|5334      AGACCTCTTATTTTTACTGTACGAAAGTGGGCCCAGTGTTTGAAATTAACAACTAAAAAT
Linepithema_humile|71         AGACCGCTTGTTATAGTAATACGAAAATGGGCGAAAAACCAGGAGATA---ACGTCAGAT
Pogonomyrmex_barbatus|611     AGGCCGCTTGTTACAGCGATACGGGTATGGGCGAAGCGTCAGGAGATA---ACAACTGAT
Daphnia_pulex|920             TGTCCTTTAGTGACGGCCGTAAGACAATGGGCCGCATGGGCGAAGCTT---ACTTCTCCT
Bombyx_mori|7                 CGACCGCTCACATTTGTAGTCCGTCGATGGGCCCAAACAGTGGGCCTC---ACCAACCAA
Tribolium_castaneum|8312      CGCCCCCTTGTTTTCACAATTCGCAAATGGGCCTCCGAGATCGGCTTA---ACAAACTCA
Culex_quinquefasciatus|2740   CAGCCGTTGACCTGTTGCGTACGGCGATGGGCTCAAGCCGTTGGGTTG---ACCAACCAC
Drosophila_willistoni|15252   CGACCTCTAACCTTTACCATACGTCGCTGGGCCCAGAGTTGTGGCTTA---ACGAATCCC
Drosophila_grimshawi|9288     CGACCCTTGACCTTTAGTATACGCCGCTGGGCGCAATCCTGCGGCTTA---ACAAATCCC
Drosophila_yakuba|12350       CGGCCGTTGACCTTCACCATCCGGCGCTGGGCGCAGACCTGCGGCCTA---ACGAATCCC
Drosophila_sechellia|4696     ------------------------------------------------------------
Drosophila_melanogaster|19581 CGGCCGTTGACCTTTACCATTCGGCGCTGGGCGCAGACCTGCGGCCTC---ACGAATCCC
Drosophila_sechellia|4692     CGGCCGTTGACCTTCACCATTCGGCGCTGGGCGCAGACCTGCGGTCTC---ACGAATCCC
                                                                                          

Caenorhabditis_elegans|1348   AGCAGAGGACGG---CTCAACAGTTTTTCCCTCTGTTTGATGCTCATCCATTATCTTCAG
Caenorhabditis_elegans|1678   AAAGATGGAGGATTC---AACAGTTATGCACTTGTTCTACTGGTGATTCACTTCCTCCAA
Pediculus_humanus|6351        CAACCCGGACCGACGATAACGAATTTTTCCCTAATATTATTAACGATATTTTTCCTACAG
Ixodes_scapularis|18156       GTCCCCGGCACGTGGATCACCAACTTCCAGCTCACCCTGCTGGTCATCTTCCACCTGCAG
Apis_mellifera|35057          ATTTCAGGACAATGGATCACGAATTTTTCTCTTACTTTGTTAATTTTATTTTATTTACAA
Nasonia_vitripennis|5334      ATTCCTGGACCATGGATTACAAACTTTTCATTATCTCTTATGGTATTATTCTTTCTGCAA
Linepithema_humile|71         TCGCCAGGGCCGTGGATAACAAACTTTTCTCTTTCGTTATTAGTGTTGTTCTATTTACAG
Pogonomyrmex_barbatus|611     GTGCCAGGACAGTGGATAACAAACTTCCCTCTTACGTTATTGGTATTGTTTTACTTACAA
Daphnia_pulex|920             ACACCCGGCAACCAAATAACCAATTTCACGCTAACTATTATGGTGGTGTTTTTCCTACAA
Bombyx_mori|7                 CACCCTGGGCGGTGGATCACAAACTTCCCACTCACTTTGATGGTACTGTTCTTTCTCCAA
Tribolium_castaneum|8312      AGCCCCGGTCGTTGGATCACAAACTTCTCCCTAACTCTGCTAGTCCTCGCATTTTTGCAA
Culex_quinquefasciatus|2740   GCGCCAGGTTACTGGATCACCAACTTCTCCCTCACGATGCTGGTGATGTACTTCCTGCAG
Drosophila_willistoni|15252   TCGCCAGGTCGTTGGATCAGTAATTTTTCTCTATCCTGTCTAGTGATATTCTTTCTACAG
Drosophila_grimshawi|9288     TCGCCTGGACGCTGGATCAGCAACTTCTCGCTGACTTGCCTGGTCATGTACTTCCTGCAG
Drosophila_yakuba|12350       TCGCCTGGTCGCTGGATCAGCAACTTCTCGCTCACCTGCCTGGTCATGTTCTTCCTGCAG
Drosophila_sechellia|4696     ------------------------------------------------------------
Drosophila_melanogaster|19581 TCGCCTGGTCGCTGGATCAGCAACTTCTCGCTCACCTGCCTGGTCATGTTCTTCCTGCAG
Drosophila_sechellia|4692     TCGCCTGGTCGCTGGATCAGCAACTTCTCGCTCACCTGCCTGGTCATGTTCTTCCTGCAG
                                                                                          

Caenorhabditis_elegans|1348   ACGGTT---------------CAAGTTCTTCTAAACATTCAAGAAATATTTCCCGAGTTG
Caenorhabditis_elegans|1678   TGCGGT------ACATTTCCACCAATACTGCCAAATTTGCAAGAAATCTTTAAAAAGGAT
Pediculus_humanus|6351        CAAAAAGGTTCCTCTCACACGGAAATATTACCACCCTTCGATTTATTTCCGCTACGCGAT
Ixodes_scapularis|18156       AGGAGG---------------GGCCTCTTGCCTCCCCTCAAGGCTCTCGAA---------
Apis_mellifera|35057          ATAAAA---------------AATATATTACCTTCTTTAAAAGTAATAAAATATCACATA
Nasonia_vitripennis|5334      GAAAAG---------------AAGATTTTACCATCTTTAAATTTACTTAAATCTTGTGCA
Linepithema_humile|71         CAGAAA---------------AATATATTGCCATCTTTGACAACGTTAATATCGTGTGCA
Pogonomyrmex_barbatus|611     CAGAAA---------------GAGATATTGCCATCTTTGAAAATATTAAAATTGCATGCA
Daphnia_pulex|920             CGGCGC------ACTCCG---CCTATTCTACCTACACTCGGAGAAATGATTAAACTGGCA
Bombyx_mori|7                 CAGAAAGGCAAGGATGGA---TGTGTTCTACCATCATTGAAAACTCTTGTTCAATATGCT
Tribolium_castaneum|8312      AAACCGATCAATTCCAAA---CCAATTCTTCCATCACTGAACACTTTAGTCAAACTGGCC
Culex_quinquefasciatus|2740   CAACTT------CCCGAA---CCGATTCTTCCCCCGGTCAACCGACTCTTCGCCAACGCC
Drosophila_willistoni|15252   CAATTG------AGACAA---CCGATATTACCCTCAATTGGTTCTCTTGTCAAAGCTGCC
Drosophila_grimshawi|9288     CAGCTG------CGGCAA---CCCATACTGCCGGCAATTGGTGCGCTGGTGAAGGCAGCG
Drosophila_yakuba|12350       CAGCTG------CGCCAG---CCCATCCTTCCCACGATTGGAGCGCTGACAAAGGCGGCG
Drosophila_sechellia|4696     ------------------------------------------------------------
Drosophila_melanogaster|19581 CAGCTG------CGCCAG---CCCATCCTTCCCACAATTGGAGCGCTGGCCAAGGCGGCG
Drosophila_sechellia|4692     CAGCTG------CGCCAG---CCCATTCTTCCCACGATTGCAGCGCTGGCCAAGGCGGCG
                                                                                          

Caenorhabditis_elegans|1348   AATGGTGAT------ATAGTCGTG------------GAGGATGACAACTATATGAAAAGA
Caenorhabditis_elegans|1678   AAT---------TTCATTGCTTGG------------GATGACAAAGTCTATCCATCAATT
Pediculus_humanus|6351        ACCGATGCGAACGATGACGTCATGACGATGGAAAACACTGATGAAAAATTAGAATGCATT
Ixodes_scapularis|18156       ------------------------------------------------------------
Apis_mellifera|35057          AAAAATTCA---AGAAGAAGTTGG------------AGTAATGATTGGAAAAATTCTATA
Nasonia_vitripennis|5334      ACACGTGAA---GATATTCGAATA------------GCTGACATTTATGTTGACTGTACC
Linepithema_humile|71         ACAGACAAC---GATGCTCGTTGT------------ACAGAGAACGGCATTAACTGTATT
Pogonomyrmex_barbatus|611     GCACGCGGC---GATGTTCGTTGC------------ACAGAGAATGGTATTGATTGCACC
Daphnia_pulex|920             AGACCTCACGTGGACACACGGCAG------------ACCGAAGAC---ATTAACTGCACA
Bombyx_mori|7                 GGAAAAGAA---GATATTAGATTA------------GCAGAAGAGAATCTAAACTGTACA
Tribolium_castaneum|8312      GAACCCAAA---GACTCTTACATG------------ACTGAAGATGGAATAAATTGCACT
Culex_quinquefasciatus|2740   ACCCGATCA---GACCTCCGAATA------------TCGGAAGACCAAATCAGCTGCTCG
Drosophila_willistoni|15252   GATGCCGAT---GATTTTCGTGTC------------ACCGAAGATGGTATTAATTGCACA
Drosophila_grimshawi|9288     AACGCCAGC---GATGTGCGGATC------------ACCGAGGATGGCATCAATTGCACC
Drosophila_yakuba|12350       GAGTCTGGG---GATTCGCGGGTC------------ACCGAGGACGGGATAAACTGCACC
Drosophila_sechellia|4696     ------------------------------------------------------------
Drosophila_melanogaster|19581 GAGCCAGGG---GACTCGCGGGTC------------ACCGAGGACGGGATCAACTGCACC
Drosophila_sechellia|4692     GAGTCAGGG---GACTCGCGGGTC------------ACCGAGGACGGGATCAACTGCACC
                                                                                          

Caenorhabditis_elegans|1348   GAC---TTGAAAATT------------------------GAAATTCTGGAAAAAGGAGCA
Caenorhabditis_elegans|1678   TTGAATTTTGGTGCA------------------------CCACTTCCCAAGCCTCTTCCT
Pediculus_humanus|6351        TTAAATAATTTCAAATGTCACGTGACGTCGTCGTCGTCGTCGTCGACGTCATCGCCGACG
Ixodes_scapularis|18156       ------------------------------------------------------------
Apis_mellifera|35057          ------------------------------------------------------------
Nasonia_vitripennis|5334      ------TTCCAACGC------------------------GATATAACGAAGATCCCGAAA
Linepithema_humile|71         ------TTCTTGCGG------------------------AATGTTGAGAAATTGCCAGTC
Pogonomyrmex_barbatus|611     ------TTTCTGCGG------------------------GATATTAACAAATTGCCGGCC
Daphnia_pulex|920             ------TTTCTGCGC------------------------GATCCTTCTGTGTTCCAAGAA
Bombyx_mori|7                 ------TTCCTGAGA------------------------GATATGAATAAATTGCCAACG
Tribolium_castaneum|8312      ------TTCCTTCGA------------------------GACATTACAAAGCTCAAAACC
Culex_quinquefasciatus|2740   ------TTCCTGCGT------------------------GACCTGTCCAAACTAGACTTC
Drosophila_willistoni|15252   ------TTTGTTCGA------------------------GATTTGGAACGTTTGAATTTC
Drosophila_grimshawi|9288     ------TTCGCTCGA------------------------GACACGGACCGCTTGGGCTTT
Drosophila_yakuba|12350       ------TTCACCCGG------------------------AATGTGGATCGACTGGGCTTC
Drosophila_sechellia|4696     ------------------------------------------------------------
Drosophila_melanogaster|19581 ------TTCACCCGG------------------------AATGTGGATCGTCTGGGCTTC
Drosophila_sechellia|4692     ------TTCACCCGG------------------------AATGTGGATCGTCTGGGCTTC
                                                                                          

Caenorhabditis_elegans|1348   TTCGATTTC---AATCAGAACACAAGCAGTCTAGCTGTGCTTTTCATTGGATTCATGAAG
Caenorhabditis_elegans|1678   AGAATT------GCCCCAAATAATGCTCCACTGGCAAGATTGTTCATCGAATTTCTATAT
Pediculus_humanus|6351        TCATCGCCGTCGGCTCCGAACGGAAAATCAACCGTCGAATTATTATTATTATTTTATAAA
Ixodes_scapularis|18156       ---------------------------------GAGGAACTGCTGGTCAGCTTCTTCGAG
Apis_mellifera|35057          ------------AATTATAATAATGATTCTTTACATAATCTTTTATATGGATTTTTCGAA
Nasonia_vitripennis|5334      AATAACAAA---ATTCCTAATACAGAGTCTCTTGAGGCTCTTTTACTGGAATTTTTCACT
Linepithema_humile|71         GAGTATAGACACAAATCGAATAATGACTCTCTGGAGACGCTTCTATACGGCTTCTTTGAG
Pogonomyrmex_barbatus|611     GATTTCAAGTATAAATTGAATCAAGACAGTCTAGAGACACTTCTGCATGATTTCTTCGAA
Daphnia_pulex|920             CGCAAG------GAATTGAATTCTGAGTCACTTGAAGATCTATTTATGGGCTTTCTGCGA
Bombyx_mori|7                 GACACGTAC---GGACAAAATAAAGCTAATCTAGAAACGTTACTGCTACAGTTTTTCGAG
Tribolium_castaneum|8312      CCGACC---------GAAAATAAGGAAAGTTTGGAAACACTTCTTGTTGAGTTTTTCGAA
Culex_quinquefasciatus|2740   AAAACG---------ACCAACGCGACCCCACTCGACGACCTGCTACTGCAGTTCTTCGAA
Drosophila_willistoni|15252   CAGAGT---------CGAAACACAAGTAAATTAAGTGAACTGCTGTTGCAGTTCTTTGAG
Drosophila_grimshawi|9288     CGCAGT---------CGGAATACGAGCAACCTGAGCGAACTACTGTTGCAATTCTTTGAA
Drosophila_yakuba|12350       AGAAGT---------CGAAACCAAAGCTCACTGAGCGAATTGTTGCTGCAGTTCTTTGAG
Drosophila_sechellia|4696     ------------------------------------------------------------
Drosophila_melanogaster|19581 AGGAGT---------CGAAACCAAAGCTCGCTGAGCGAGTTGTTGCTGCAGTTCTTCGAG
Drosophila_sechellia|4692     AGGAGT---------CGAAACCAAAGCTCGCTGAGCGAGTTGTTGCTGCAGTTCTTCGAG
                                                                                          

Caenorhabditis_elegans|1348   TATTACTCAGAGTTCAATTTCAAATGGAATTGGATCTCGATTAAACATGGAAACGTGTTG
Caenorhabditis_elegans|1678   TACTACTCGATGTTCAACTTCAAAGAAAACTACATTGGTGCCAGG---------------
Pediculus_humanus|6351        TTTTATTCAGTTTTTAATTTCAATTCGTACGGTTGTTGTTTGAACACGGGACAAATAATA
Ixodes_scapularis|18156       TACTACTCCTCGGTGGACTTCAAGTCCAAGTCCATCTCCCCGTACACGGGCCAGCTGTTG
Apis_mellifera|35057          TATTACAGTATTTTTGATTTTAAAATGCAAGCAATTTGTATAAAGGAAGGAAAACCTCGA
Nasonia_vitripennis|5334      TATTTTGGCAATTTTGATTTCGAAACTAAGGCTCTTTCCTTGCGAGAAGGAAAACCTATA
Linepithema_humile|71         TACTACTCGAAGTTCGATTTTCATACGAAAGGCATATGCATTCGCAGAGGCATACCAATT
Pogonomyrmex_barbatus|611     TATTATTCAACGTTCAATTTTGACATATACGGTATATGTATTCGCGAAGGTAGGCAGATA
Daphnia_pulex|920             TTTTTTGGAAGTTTTGATTTCAACGAACGATCTATTTCTGTCATAACGGGAGATTCACAC
Bombyx_mori|7                 TTTTACGCTCAATTCGACTTTCATGACAAAGCTATATCGATTAACGAGGGGGTGGCTATA
Tribolium_castaneum|8312      TTTTATTCGCAGTTTGATTTCGCGTCGAAAGCTTTGTGTTTGAATGAATCGGTCGCGATA
Culex_quinquefasciatus|2740   TTTTACTCCCACTTTGACTTCAACCAGCGCGCCATCAGCCTCAACATCGGCGCCTCCATC
Drosophila_willistoni|15252   TTTTATTCCCAATTCGATTTCCACAATCGTGCCATATCGCTCAATGAGGCGAGATCTTTG
Drosophila_grimshawi|9288     TTCTATTCACAGTTCGATTTTCACAATCGCGCCATTTCGTTAAATGAGGGTCGAGCACTG
Drosophila_yakuba|12350       TTCTACTCGCAGTTCGACTTCCACAACCGCGCGATATCTCTGAACGAGGGAAAGCCTCTG
Drosophila_sechellia|4696     ------------------------------------------------------------
Drosophila_melanogaster|19581 TTCTACTCGCAGTTCGACTTCCACAACCGTGCGATATCTTTGAACGAGGGAAAGCCGCTG
Drosophila_sechellia|4692     TTCTACTCGCAGTTCGACTTCCACAACCGTGCGATATCTTTGAACGAGGGAAAGCCGCTG
                                                                                          

Caenorhabditis_elegans|1348   AAAAAGAAATGGTCAAAGACAAGAGTTCCAAAAAATGGAATGCCAAAGGATTGCCGTTTT
Caenorhabditis_elegans|1678   ---------------------------------------------------------CCT
Pediculus_humanus|6351        CGGAAA------------------------------AATAATTTTAAAAATTAC---GGA
Ixodes_scapularis|18156       GAGAAA------------------------------------CCGGACTACTCC---GCC
Apis_mellifera|35057          GTGAAA------------------------------------AAAGATTCATCA---CCG
Nasonia_vitripennis|5334      TCAAAG------------------------------------CCAGAGTACACT---GCC
Linepithema_humile|71         CAGAAA------------------------------------CCATCGCATTCG---GCG
Pogonomyrmex_barbatus|611     CAAAAA------------------------------------CCGTCGCACACG---GCG
Daphnia_pulex|920             AGGAAA------------------------------------TTTGATTCCAAG---CCT
Bombyx_mori|7                 CGAAAG------------------------------------CCAAACACTCTA---CCA
Tribolium_castaneum|8312      ACAAAA------------------------------------CCCGAACATTGC---GCT
Culex_quinquefasciatus|2740   CTCAAG------------------------------------CCCGACCACAGC---CCG
Drosophila_willistoni|15252   GCCAAA------------------------------------CCCGATCATTCG---GCC
Drosophila_grimshawi|9288     ACCAAG------------------------------------CCCGATCATTCG---GCC
Drosophila_yakuba|12350       TCCAAG------------------------------------CCGGACCACTCG---GCC
Drosophila_sechellia|4696     ------------------------------------------------------------
Drosophila_melanogaster|19581 TCCAAG------------------------------------CCGGATCACTCG---GCC
Drosophila_sechellia|4692     TCCAAG------------------------------------CCCGATCACTCG---GCC
                                                                                          

Caenorhabditis_elegans|1348   ATTGTCGTCGCGGATCCATTGTTGGAAATTCCGAGAAACTGTGCTGGAACCGTCCGTCAG
Caenorhabditis_elegans|1678   GTAATGGTCATGGATCGA---AGAACATCACAAAACAATATGGTTCGTAGTTCAACAAAC
Pediculus_humanus|6351        ATGTATATAAAAAATCCA---TTTTGTTCGATTTACAACGTGAGTAAAAACGTTAGCCTG
Ixodes_scapularis|18156       ATCCACATCCAGAACCCC---CTCGACCGGCAGCTGAACGCCAGCCGCAACGTCGGTGCC
Apis_mellifera|35057          CTGTATATTTATAATCCA---TTTGATGAATCATTAAATGTTAGTAAAAATATCACTATA
Nasonia_vitripennis|5334      TTATACATCTGTAATCCC---TTAGAAACCAATTTAAATGTAAGCAAAAATGTTAGGTTT
Linepithema_humile|71         CTTCACATCACCAATCCC---TTTGAAACGATGTTGAACGTTAGCAAGAACGTGAATATC
Pogonomyrmex_barbatus|611     CTCCATATTACTAATCCT---CTAGAAACAACGTTGAATGTTGGTAAAAATGTGAGCTTC
Daphnia_pulex|920             CTTTACGTGATAAACCCG---TTGGAACGAGAGCTCAACGTTAGTAGAAATGTCACGTTG
Bombyx_mori|7                 TTGTACATAGTGAATCCT---TTAGAACAAGCCTTGAATGTTAGCCGGAATGTGAGTTAC
Tribolium_castaneum|8312      CTGTATATTGTGAATCCG---TTAGAAAGGGGGCTCAATGTTAGTAAAAATGTCAGTATG
Culex_quinquefasciatus|2740   CTCTACATCGTGAACCCG---CTCGAGACCGTGCTCAACGTGGCCAAAAACGTCAACCTC
Drosophila_willistoni|15252   ATCTATATAGTAAATCCG---CTGGAACAATTACTAAATGTTAGCAAGAATGTAAGTCTA
Drosophila_grimshawi|9288     ATGTACATTGCGAATCCG---CTCGAGCAGCTGCTGAATGTTAGCAAGAACGTCAGCCTG
Drosophila_yakuba|12350       ATGTACATAGTAAACCCA---CTGGAGCAGCTGCTAAATGTGAGCAAGAATGTGAGCCTG
Drosophila_sechellia|4696     ------------------------------------------------------------
Drosophila_melanogaster|19581 ATGTACATCGTAAACCCA---CTGGAGCAGTTGCTAAATGTGAGCAAAAATGTTAGCCTG
Drosophila_sechellia|4692     ATGTACATCGTAAACCCA---CTGGAGCAGGTGCTAAATGTGAGCAAGAATGTCAGCCTG
                                                                                          

Caenorhabditis_elegans|1348   CAGAACTACATGGAAAGAATTCAACTCGAGTTTAGAGAGGAGTACGAGCGAATTCTGAAG
Caenorhabditis_elegans|1678   AAAGAGGTGTGTATTCAAGATCCATTCGATGAGCACAACCCGGGAAGAACTGTAAGAACA
Pediculus_humanus|6351        AGCGAA---GTTAATAAATTTCAATTTTATTGTCAAATTGCTGCCACGTTATTGGAAGAA
Ixodes_scapularis|18156       CCGGAC---CTCCGCAAGCTGCAGAGCCACATGGGCGGCGCGCTCGCGGCGCTCGAAGAG
Apis_mellifera|35057          TTTGAA---TTAACGCGTTTGATAGATCACTTTCGAAAAGCATTGCAAATATTAATAGAA
Nasonia_vitripennis|5334      GAAGAA---TTAGAACGCATCAGAGTAGCTATGCGCAGTGCATCGTGGCAGTTGGAAGCT
Linepithema_humile|71         CACGAG---GTGAATCGTATACTTCAAAAGCTACACGACGCTCTCTACACATTAGAGACT
Pogonomyrmex_barbatus|611     TACGAA---TTGAATCGCATAATTTCGAAAGCACAAGATGCGGTCCACACTCTAGAAACT
Daphnia_pulex|920             ACAGAA---CTTACTCGTGCAGTTATGGAAGCCAGAAATGCTCTTTACATTTTGGAGACG
Bombyx_mori|7                 GAGGAG---TGCGAGAGGTTGAAACTAGAGGTCCGCAACGCAGCGTGGCTGTTAGATGCA
Tribolium_castaneum|8312      GAAGAA---CTGGACCGGTTTCGAGTTGAGGCGAGAAACGCTGCTTGGATTTTAGAATCA
Culex_quinquefasciatus|2740   GAAGAA---ACGGAACTGTTCCGCATCCAGGTGCGGAACGCGCTCTGGCTGCTGGACACG
Drosophila_willistoni|15252   GAGGAA---TGTGAACGCTTGCGCATTGAGGTGAGGAATGCTGCCTGGCTTCTGGAATCC
Drosophila_grimshawi|9288     GAGGAG---TGCGAACGGTTGCGTATCGAGGTGCGCAATGCCGCCTGGATGCTTGAGTCC
Drosophila_yakuba|12350       GAAGAG---TGTGAGCGACTGCGCATCGAGGTCCGGAACGCGGCTTGGGTTCTGGAGTCG
Drosophila_sechellia|4696     ------------------------------------------------------------
Drosophila_melanogaster|19581 GAGGAG---TGTGAACGACTGCGCATCGAGGTGCGGAACGCGGCTTGGGTTCTGGAGTCG
Drosophila_sechellia|4692     GAGGAG---TGTGAACGACTGCGCATCGAGGTGCGGAACGCGGCTTGGGTTCTGGAGTCG
                                                                                          

Caenorhabditis_elegans|1348   AGAAAGACAATTTTCAATCTTTACCAA---------------------TGCAATTGGAGT
Caenorhabditis_elegans|1678   TTGAATAGAATTAAAGATGTT---------------------------------------
Pediculus_humanus|6351        TCCGAAACAACGATATCTCGA---------------------------------------
Ixodes_scapularis|18156       GCCAGCCGCGGGATCACGCAA------------------------GAGGTGCCCTGGGGC
Apis_mellifera|35057          ACAAGTGAAAAGGATGCTATT---------------------------------------
Nasonia_vitripennis|5334      ACGGACAATGAAAAACGATTT---------------------------GAAAATTGGGGA
Linepithema_humile|71         GCTGACACATCCAGGAGT------------------------------AACAATTGGGGC
Pogonomyrmex_barbatus|611     GCCGACAAAACCAACGAG------------------------------GATAACTGGGGT
Daphnia_pulex|920             CAAGATCATCAAAGTCCAGGA---------------------------GAAAACTGGGGA
Bombyx_mori|7                 GGTTTGGATGGTAAGAAAACT---------------------------GACGGGTGGGGC
Tribolium_castaneum|8312      CAGGAGAACAAGAAT---------------------------------GAAAATTGGGGC
Culex_quinquefasciatus|2740   CACGACCGCGCAACCACGGCCACCGGT---------------------GACGAGTGGGGC
Drosophila_willistoni|15252   GAGGTGGAGAATTCATCATCAGTTAAGGAAGGAAATGAGCATCCGGAAACAATTTGGGGC
Drosophila_grimshawi|9288     GAGGTGGAGAACTCAACGCTGCCAGAG------AGCGAGCGACAGGATCAGTCCTGGGGT
Drosophila_yakuba|12350       GAGGTGGAGAATGCCTCCGTTCCGGAA------GCCGACGGCCAGGAGCTTTCCTGGGGC
Drosophila_sechellia|4696     ------------------------------------------------------------
Drosophila_melanogaster|19581 GAGGTGGAGAATGCCTCCGTTCCGGAG------GGCGACGGCCAGGAGCTCTCCTGCGGC
Drosophila_sechellia|4692     GAGGTGGAGAATGCCTCCGTTCCGGAG------GGCGACGGCCAGGAGCTCTCTTGGGGC
                                                                                          

Caenorhabditis_elegans|1348   AGAAAATTGAGAAAAGAGGGAATGGAACGAGATCTTCAAATTATGATTCTTCAAGATGAG
Caenorhabditis_elegans|1678   ---------------------ATGAGAAGCACATATCAGAAGTTTCTCCCTGTCGAAGGC
Pediculus_humanus|6351        ---------------------AATTCTACGACTCGAACCGCCGTCGTCGATGAATCGAAA
Ixodes_scapularis|18156       ATCGCGGCACTCCTGGGCGACGGCAAGCCGCACGGAAACAGGAGGGTCGAACAGGCGCAC
Apis_mellifera|35057          ---ATAAAATTAATTAAAATTAATTCGATATCGTCAAACTCGATAGAGATGGACGATTGT
Nasonia_vitripennis|5334      TTGCTCAAATTGCTT------ACAAATACAAATTTCGATTCCCTAGCGCGAAATAATTCA
Linepithema_humile|71         CTCATGACTTTGATG------------ACGAAATTGAACCTTTATGTGAGGCATACACTT
Pogonomyrmex_barbatus|611     ATCATGACATTATTGAAAATAAATAATGTTAACACGAAAAATCTAAAGAAATTGAACAAT
Daphnia_pulex|920             CTACTGACTCTT------------------------------------------------
Bombyx_mori|7                 ATATTGGGCCTTATTGAGAGAAAAAGCACCAGGGGCCTAAAAAATCTGCTGAAAGTAGGA
Tribolium_castaneum|8312      ATTTTATCAATTTTCGAAAATAAACGCAAGGCTAGCAGTGTTGTGAATTTCGCATTTGCA
Culex_quinquefasciatus|2740   CTCGTAAGCCTCCTCTGGAACAAATCCACCGTAAAAGAGCGCATCACGCCGCAAATGTTC
Drosophila_willistoni|15252   TTACTGAATCTATTT------AAGCATCCCGAAAAGACCATTGTACGACCGAATATGTTT
Drosophila_grimshawi|9288     CTGCTCAATCTATTC------AAGCATCCCGAGAAGTCTGTCATACGTCCCAACATGTTC
Drosophila_yakuba|12350       CTGTTGAACCTGTTC------AAGCATCCCGAAAAGGCCGTCATTCGGCCGAACATGTTC
Drosophila_sechellia|4696     ------------------------------------------------------------
Drosophila_melanogaster|19581 CTGTTGAACCTGTTT------AAGCATCCCGAAAAGGCCGTCATCCGGCCGAACATGTTC
Drosophila_sechellia|4692     CTCTTGAACTTGTTT------AAGCATCCCGAAAAGGCCGTCATCCGGCCGAACATGTTC
                                                                                          

Caenorhabditis_elegans|1348   CTTCGCAAATTAAGAATTGCTAATTTGCCGACTGAAGAAGAAGTTCCATGGGGTACAGTC
Caenorhabditis_elegans|1678   TCCGAATTC---ACGTTTCCTACACTAGATGATATTATCAATATGTCACCAGAAGTGCCT
Pediculus_humanus|6351        TTTCTTTTA---AATTTTCTCAATTATAATTCGTATGCTAACGAGTTGATGGCGAAAAAA
Ixodes_scapularis|18156       ------------CGCAGGTTTCAGGTTCAGGAACTCTTTCAGGAGGGAAAAGGGGCACCC
Apis_mellifera|35057          AAAGATATCGAAAAATCAACTGAAATTGATAATATTGAAAAAGATAGTGATACATTTAAT
Nasonia_vitripennis|5334      GCC---------AAGTCGATTAACATTGAGGCACTTTTTGAAAACGACGGTGCGAAGCTT
Linepithema_humile|71         AAATCGAAGAGGACAAAAGAGAATATCGAAGATAGCACGGAAGATTTTTCCCCTGAAATT
Pogonomyrmex_barbatus|611     ACGAAA------GAATCAGAAACTATCAAAAATTATTTGGAAAATCGTTCTTATGAAATT
Daphnia_pulex|920             ------------------------------------------------------------
Bombyx_mori|7                 AATTCACAT---CGGCTTGTCTCCGTGAAGGATTTATTCAACAACGATGATGACAAAATT
Tribolium_castaneum|8312      AATAAACACGGAAGGTTGGTGGAAGTGAGCACTTTATTTGAGGAAAATACCGACAAA---
Culex_quinquefasciatus|2740   TTCACGAAG---CGACTGCTCAACGTGCGCGATATCTTCGACGAAACGGACGCGAAGGCA
Drosophila_willistoni|15252   TTCAAGCCT---CGCATGGTCGAGGTCAGTGATCTATTTGAGAATGGCATGTCGCCGACT
Drosophila_grimshawi|9288     TTCAAGCCG---CGCATGGTCGAGGTCAGCGATCTGTTTGACAAATCCCAGGCGGCCACG
Drosophila_yakuba|12350       TTCAAGCCG---CGCATGGTCGAGGTGAGCGATCTCTTCGAGCAGAAGGAGGCAGGAGCA
Drosophila_sechellia|4696     ------------------------------------------------------------
Drosophila_melanogaster|19581 TTCAAGCCG---CGCATGGTCGAAGTGAGCGATCTCTTCGAACAGAAGGAGGCGGGAGCA
Drosophila_sechellia|4692     TTCAAGCCG---CGCATGGTCGAGGTGAGTGATCTCTTCGAGCAGAAGGAGGCCGGAGCA
                                                                                          

Caenorhabditis_elegans|1348   GTT---------------------GATTTCACAAGTCCTCGAACCTTTTCACCTACAAAT
Caenorhabditis_elegans|1678   AAA---------CCATCGCGTGCAGAAGTTCGAAACTTCCGAGCTGAAGCCACAGAAGTG
Pediculus_humanus|6351        CTA------------------------------------------AGTAATAATAATAAT
Ixodes_scapularis|18156       AAA------------------------------------ACGAGCTACGTCGTAGAGGCT
Apis_mellifera|35057          CAA---------------------------AAAGAATCTTTAAACGAATCTATAAACAAA
Nasonia_vitripennis|5334      AGT---------------------------------------------------AGAAAA
Linepithema_humile|71         TCT------------------------------------------GATAAATATGGAGAT
Pogonomyrmex_barbatus|611     TCT------------------------------------GATAAATTTGATGTTAGCGAA
Daphnia_pulex|920             ------------------------------------------------------------
Bombyx_mori|7                 GAG---------------------AAAGTGAAGGCGAAAAGAGATAGTGAAATGAAACAG
Tribolium_castaneum|8312      ---------------------------CCTGTTGAGTATAAAAACGCCTCTGTGAAGAAA
Culex_quinquefasciatus|2740   AACGCGACGACGACGGCACCACCAGCGACCACGGAGTACAAAAACCGAACCGTGCAGAAC
Drosophila_willistoni|15252   GGC------------ACGCCACCAGCCGGAGTGACATATAAAAACCCTTCAATACGCCAG
Drosophila_grimshawi|9288     ACG---------------GCATCACCGCCCGTCAGCTACAAGAGCGCCACAGTGCGGCAG
Drosophila_yakuba|12350       ACGTCCAGCTCCACTGCTCCCACACCAGCCGTCACCTACAAAAATGCCTCTGTGCGGCAG
Drosophila_sechellia|4696     ------------------------------------------------------------
Drosophila_melanogaster|19581 ACGTCCAGCTCAACTCCTCCCACACCAGCCATAACCTACAAGAGTGCCTCTGTGCGGCAG
Drosophila_sechellia|4692     ACG---TCCTCCACTCCTCCCACACCAGCCATCACCTACAAGAGTGCCTCTATGCGGCAG
                                                                                          

Caenorhabditis_elegans|1348   CAACACCCAAAGGTCTTCTGGTGTTCAGAACAAACGACTGAAAATCAAAGAAGAGATAAT
Caenorhabditis_elegans|1678   AATCGAGTCGGCTTAGGTGTCTACTGTCGGAACTCATTTGTA------------------
Pediculus_humanus|6351        ATTAATTCAAATGTTAAATTTGCCGATTTGAAAAGTATTTTT------------------
Ixodes_scapularis|18156       ACCGCCTCGGGGGTGAAAGGAGCGAGC---------------------------------
Apis_mellifera|35057          ATCAACGTTAATGTTTTAGAAACAATGGAAAAAAATATAATAAAG---------------
Nasonia_vitripennis|5334      AGAACGAACGAGAAGAAAAAGCAAAAGAAAAGCAAGTCAAAGTCA---------------
Linepithema_humile|71         AGTGAAGTTGACGTAAATCAATCGAAGAGAAAAGAAACTGTA------------------
Pogonomyrmex_barbatus|611     GAAAATACTAATGAGCCAAAAGCCAAAAAGGAAGAAATAGTA------------------
Daphnia_pulex|920             ------------------------------------------------------------
Bombyx_mori|7                 GTGCTCGCTCAAGTTGATAATAAACCAAAGGAGAAAATTAAG------------------
Tribolium_castaneum|8312      CAAGTGGAGAACATAAAAAACGACACGAAAAATAAACTGAAAGAA---------------
Culex_quinquefasciatus|2740   CAGGTGGTGGGAATCCAGCGGGCGACCCGCGAGCAGATTGGCAAAATGGCCAAGCACACG
Drosophila_willistoni|15252   CAAGTCCAGAACATAAAAGCATCGACAAGAAATGAACTGAAACAA---------------
Drosophila_grimshawi|9288     CAGGTGCAGAACATCAAGGCGGCTGCGCGTATCGAAATGAAGGAA---------------
Drosophila_yakuba|12350       CAGGTGCAGAGCATCAAGGCTGCCACGCGCTCCGAACTAAAGCAG---------------
Drosophila_sechellia|4696     ------------------------------------------------------------
Drosophila_melanogaster|19581 CAGGTGCAGAGCATCAAGGCTGCTACGCGCTCCGAACTAAAGCAG---------------
Drosophila_sechellia|4692     CAGGTGCAGAGCATCAAGGCTGCTACGCGCTCCCAACTAAAGCAG---------------
                                                                                          

Caenorhabditis_elegans|1348   TTATGGCCTGAGCTACTTCGTACAAATCCATATGCGATATTTGAAAATTTGATT------
Caenorhabditis_elegans|1678   ------------------------------------------------------------
Pediculus_humanus|6351        ------------------------------------------------------------
Ixodes_scapularis|18156       ------------------------------------------------------------
Apis_mellifera|35057          ------------------------------------------------------------
Nasonia_vitripennis|5334      ------------------------------------------------------------
Linepithema_humile|71         ------------------------------------------------------------
Pogonomyrmex_barbatus|611     ------------------------------------------------------------
Daphnia_pulex|920             ------------------------------------------------------------
Bombyx_mori|7                 TTCAAGAACACGCAAGTTGCTAGTGAAGTTTATAGG------------------------
Tribolium_castaneum|8312      ------------------------------------------------------------
Culex_quinquefasciatus|2740   CTTAGTGGCGGGGAGAGCGGGACGACGACGACGAATGGCGGTGGGGTAAAG---------
Drosophila_willistoni|15252   ATGCGAGGCTCTTCATCTTCCGCAACTTCAGCATCAGCGGCAGCTGCATCATCATCCTCA
Drosophila_grimshawi|9288     CTGCGTGAGTCCAGTACAACGACGACCACAGCGAAG------------------------
Drosophila_yakuba|12350       CTGCGCGGATCGGGCAGCGCAGTTCCGACGAACAGT------------------------
Drosophila_sechellia|4696     ------------------------------------------------------------
Drosophila_melanogaster|19581 CTGCGCGGATCAGGCAGCTCAGTTCCGACGAGCAGT------------------------
Drosophila_sechellia|4692     TTACGCGGATCAGGCAGCTCGGTTCCGGCGAGCAGT------------------------
                                                                                          

Caenorhabditis_elegans|1348   ------------------------------------TGA
Caenorhabditis_elegans|1678   ------------------------------------TAG
Pediculus_humanus|6351        ------------------------------------TAA
Ixodes_scapularis|18156       ------------------------------------TGA
Apis_mellifera|35057          ------------------------------------TAA
Nasonia_vitripennis|5334      ---------------------------------------
Linepithema_humile|71         ------------------------------------TGA
Pogonomyrmex_barbatus|611     ------------------------------------TGA
Daphnia_pulex|920             ---------------------------------------
Bombyx_mori|7                 ------------ATACGTAGGGATAAAATTATA---TGA
Tribolium_castaneum|8312      ------------CTACAAAAAACAAACAGG------TGA
Culex_quinquefasciatus|2740   ------------TTGAAGAGGAATGCCAAGCGGAGGTGA
Drosophila_willistoni|15252   TCAGCGCCCACAAGCAGCAAAAACAAGCGCTCTAGATGA
Drosophila_grimshawi|9288     ------------ACCAAACGCAGCAGA---------TGA
Drosophila_yakuba|12350       ------------CCGAAGAATCGGCGGAGCAGCAGGTGA
Drosophila_sechellia|4696     ------------------------------------TAA
Drosophila_melanogaster|19581 ------------CCCAATAATCGACGGCGAAGCAGGTGA
Drosophila_sechellia|4692     ------------CCCAAGAACCGACGGAGCAGCAGGTGA
                                                                     

multiple sequence alignment in CLUSTALW format


Caenorhabditis_elegans|665    -------------------------------------------MAPRTYASVLTTPRGPA
Caenorhabditis_elegans|235    --------------------------------------------------MSQPNKDQRS
Pediculus_humanus|6221        -------------------------------MYKFETNSMKYVLLEMENGEQLSNLINHS
Ixodes_scapularis|18153       ------------------------------------------------------------
Apis_mellifera|4040           MALIHRVNINFGFVLNTFYCKCIVNIKRCKTEYNIKSQTNVKYGENITFGDMLKFRQTQA
Nasonia_vitripennis|1803      MVVVYNLALDECKVPSAYHM-------------------ERKQKKYITYDEVLAQRRLQA
Linepithema_humile|14962      ------------------------------------------------------------
Pogonomyrmex_barbatus|9015    -MGTGRLRLRGRTSMLLNVQY-------------KSSTRSNFTGVQTTLETEIIQRRDQA
Daphnia_pulex|15262           -----------------------------------------------HFDEMVSFRKKEA
Bombyx_mori|8573              ------------------------------------------------------------
Tribolium_castaneum|9094      MSVFLTCRLKNSIGRKKFFNFSS----DIVR---QLSQQVKQNESFVPFMDVIKFRREEA
Culex_quinquefasciatus|7005   ---------------------------------------------------MLAGRRAEA
Drosophila_willistoni|6126    ------------------------------------------------------------
Drosophila_grimshawi|1857     ---MNTLMRR-AQQLRLWRTYCI----KQSA---V-AGTEVASRGKPSYEEFIGSRHQQA
Drosophila_yakuba|6879        ---MNSLVRRSAQQLNLWRTYCV----KHNA---PEAASPGRNAGKPNYEEFIGRHQRRA
Drosophila_sechellia|8803     ---MNSLVRRSAQQLSLWRTYCV----KHNA---PEAASPGRNAGRPNYEEFIAGHQRHA
Drosophila_melanogaster|18088 ---MNSLVRRSAQQLSLWRTYCI----KHNA---SEAASPGRNAGRPNYEEFIGRHQRQA
Drosophila_sechellia|8805     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|665    PLAL----------YCPEAPECPKLEAISNLSFQQI------------------------
Caenorhabditis_elegans|235    PEDIDFKVKANPKAF---HKFNGKFQRVLR------------------------------
Pediculus_humanus|6221        KSHGGGGGGGKRGKFSILNSLGGHFGYFNDSIVYDH------------------------
Ixodes_scapularis|18153       ------------------------------------------------------------
Apis_mellifera|4040           KKSVLIGV--PENYIYDMEKYCLKHVNIKKILFYNT------ETNRCFVLMELMTEKDVE
Nasonia_vitripennis|1803      HRSVLIEV-QSDKSCTDVYAHCSQFGKINGLFHYTT-----QGMERHFVLVEFDSQESVN
Linepithema_humile|14962      ------------------------------------------------------------
Pogonomyrmex_barbatus|9015    RRSLLIQV-YSPKSHNDLYNYCSRFGDILSMHHYQV---NRNHYQENYILVEFKDVVSVD
Daphnia_pulex|15262           RSSVVIQVGNPSKPATLLNQVCSRHGTVKHVFHYTY-------QNKELLLLEFDSEASVK
Bombyx_mori|8573              ----------------MSYTPVAHIKKMLTLWLYIT------------------------
Tribolium_castaneum|9094      RRSILVQV-QSAQSFKELHSYCNSVGNVRQMLHYTV-----GVEPLNFIVVEFASEKDVT
Culex_quinquefasciatus|7005   RRSILVQV-SSERSFPELATYCGQFGTIASAHHYCVGGSQQGDEDCHYIVVEFDEPGAAD
Drosophila_willistoni|6126    ------------------------------------------------------------
Drosophila_grimshawi|1857     QRSIVVQV-SSERSYTELYNYCSRFGRIVIAQHYCV----PHEDELHYMLLEYASAGEAA
Drosophila_yakuba|6879        QCSIVVQV-SSEKSYAELYNYCSSFGSILGAHHYCV----RQDETLHYILLEYATPSEAA
Drosophila_sechellia|8803     QCSIVVQ------SYAELYNYCSSFGSIMGAHHYCV----RQDETLHYILLEYATSDEAA
Drosophila_melanogaster|18088 QCSIVVQV-SSEKSYEELYNYCSSFGSIMGAHHYCV----RQDETLHYILLEYATSDEAA
Drosophila_sechellia|8805     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|665    -----------------------------------------------------TQQAGTS
Caenorhabditis_elegans|235    -----------------------------------------------------------D
Pediculus_humanus|6221        ------------EKIIPTTTVMENYDYYYSNVNNN--------------------DDNSK
Ixodes_scapularis|18153       ------------------------------------------------------------
Apis_mellifera|4040           IFRNMASCKINS----NAHSVTPLFLYKVRNSSYNKPMTKKSIMFKP-----------PN
Nasonia_vitripennis|1803      AVLSASTHVNHE----QIIPVRSTMLWFRNPPQRVDIKPINDTLSVP---LSRNSCKILS
Linepithema_humile|14962      ------------------------------------------------------------
Pogonomyrmex_barbatus|9015    EIMSYASFVRSD----YIAPVKSSVLWFR------------------------KGQVAIS
Daphnia_pulex|15262           NLLASCSHNNNY----KVIPVASPFLWLKAMP------PESYSAVSS-RLPPIIKENISA
Bombyx_mori|8573              ------------------------ISMVRAVSGKK----EAFQIPKS-QLMTTKGCNSID
Tribolium_castaneum|9094      NVLERSSYLEDS----QVVPVQSQFLWFRASNRKL---PKLKQSKSA-ILSIENGNQCVT
Culex_quinquefasciatus|7005   AAIGSAVFNEEK----PGVRARSIFLWFRAGPKAK------LTEKQP-KLGAVEGSRGVD
Drosophila_willistoni|6126    ---------------MSGTPVRSPFLWFRASTGKKKESISSSTMPHP-GLLSIDGCRPIG
Drosophila_grimshawi|1857     AAINSSAYNAELGSSGSGVPVRSPFLWFRAAASGRRGLAKLAANQHPLPLATIDGTRPPT
Drosophila_yakuba|6879        AAIGAGVTNGEL----SGVPVRSPFLWFRAAGGGKRS-PKLVPNPAP-TLLSLDGTRLAD
Drosophila_sechellia|8803     TAIGAGVTNGEL----SGVPVRSPFLWFRAAGGGRRG-PKLVANTAP-ALLSLDGTRQVD
Drosophila_melanogaster|18088 AAIGAGVTNGEL----SGVPVRSPFLWFRAAGGGRRS-PKLVANTAP-ALLSLDGTRQVD
Drosophila_sechellia|8805     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|665    NDQGFEFENTYVEHRINQEIESFVDTHHQEPLRK-----AAAQFRAVMKQEYPD--STCF
Caenorhabditis_elegans|235    HEDDFNIL------SISMQDHFDTTKQPKEEFGKKMDW--CYQLKNIISKNNPTWLFNIV
Pediculus_humanus|6221        TNSIRKLLKEYKTLDLDNQIRLLHDSYKLNDLGYRLRYMMWKQIQNLVNVLLPT--HSVY
Ixodes_scapularis|18153       -------------------MVRFYENERLNDLELRLGFLVCRQIEEFISGLYPR--GSVL
Apis_mellifera|4040           FDQIKESLKNKN--TISEQMIILHHLLKITDLDIRLRFFTAEQISYYLSRLFMN--VSVI
Nasonia_vitripennis|1803      NPELFKILVSAE--SISDQIKLLHECSKLNDVGVRLRFYTAYQIECCFHGLFPN--IAVL
Linepithema_humile|14962      ---------------VSGQITDFYETLKLNDLETRLRFHTAHHLEQYFSRLFQN--MRVL
Pogonomyrmex_barbatus|9015    QKYQT---------KISGQIIILYETLRLTDLEIRLRFHTAQHLEQYFSGLFHN--MRVL
Daphnia_pulex|15262           NDNLQEHLSNAK--SISEQMTILDDQTRLSEIGHRLRWLTSIQIEQTLSRLFPS--LQVL
Bombyx_mori|8573              EDNLIEELANCE--DVSEQIQQMHDRTALNDLGVRLRYMVARQIERIFESLYAN--IVVR
Tribolium_castaneum|9094      PSEIVNLLSKCD--SVSEQMNVLYNSTKLNDLGTRLRFLTARQVENAVRGMFPK--AKAY
Culex_quinquefasciatus|7005   SGELRELLLSAE--GVEDQLKVLHRTTCLNDVGKRLRFLAVRQVESSLQGMFPQ--AVAF
Drosophila_willistoni|6126    QENLLSLLRKAE--NIDRQIVELHQNSQLNDLGVRMRFLAALQIQQSISGMFPS--AQAV
Drosophila_grimshawi|1857     HEQLQQLLRGAE--SIEQQILKLYEHTRLNDLGVRMRFLAALQVQQAISGMFPD--ALAQ
Drosophila_yakuba|6879        QGHLLGLLRGAA--DIEEQVLQLHEHTRLNELGVRMRFLAALQVQQAIAGMFPA--AQAQ
Drosophila_sechellia|8803     QGHLLGLLRGAA--DIEEQVQQLHEHTRLNELGIRMRFLAALQVQQAIAGMFPA--AQAQ
Drosophila_melanogaster|18088 QRHLLGLLRGAA--DIEEQVQQLYEHTRLNELGIRMRFLAALQVQQAIAGMFPA--AQAQ
Drosophila_sechellia|8805     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|665    ITGSYPAGVDIFSSDIDFTV----------------------------KVPTLEGANPFL
Caenorhabditis_elegans|235    PTGSTVTGLATKNSDLDVAIH------------IPQAARVLEQEERGRNITDDERQASWR
Pediculus_humanus|6221        PFGSAVNGLGDVTSDLDLVVL------------------RDDSTSFRWHKNPGVDINSVQ
Ixodes_scapularis|18153       PFGSLVNGFGRHNCDIDMVYC------------VPENVDAKGQLYFQDKHQMINDRTLVQ
Apis_mellifera|4040           PFGSSVNGFGQIGCDLDLLYR-----------------------------------NEQK
Nasonia_vitripennis|1803      PFGSSVNGFGKQGCDLDLSVI--FEED--------KMEKNTSRLVFQTKSILTHEKYQMK
Linepithema_humile|14962      PFGSSVNGFGRKRCDLDLVLV----------PDHTAKRDSKSRLIFHTKSIKLDERHGTK
Pogonomyrmex_barbatus|9015    PFGSSINGFGRRKCDLDLVLV------------PNYSQEGNSRLVFHSKPIRHNDRTETK
Daphnia_pulex|15262           PFGSFVNGSARNGCDLDMAIS--IEGN-----FGSEIMALQSPLIFQAKAAIDNYRLQTQ
Bombyx_mori|8573              PFGSSVNGFGKMGCDLDLVLTNILNEE---------MCDSSKRLVYQEKKCEG-GRSPWQ
Tribolium_castaneum|9094      PFGSSVNGYGKMGCDLDLVLR--LCDD---------KVKNDARLMFHCKGLVGSERTASQ
Culex_quinquefasciatus|7005   PFGSSVNGFGKMGCDLDIILD--LDSE------ANLKQSKSSRLVFHTKAANSNERTQVQ
Drosophila_willistoni|6126    PFGSSVNGFGKMGCDLDLILR--FDKE--RGAKNH-QQTEPSRLIYHLKENLSNGRSQTQ
Drosophila_grimshawi|1857     PFGSSVNGFGKMGCDLDLILR--FDGETTITDGQEMSANEPSRLIYHTKENMSNGRSQTQ
Drosophila_yakuba|6879        PFGSSVNGFGRMGCDLDLILR--FDND--MGAKSSLEEAVPSRLVYHTKENLSNGRSQTQ
Drosophila_sechellia|8803     PFGSSVNGFGRMGCDLDLILR--FDSD--MGAKSPLEAAVPSRLVYHTKENLSNGRSQTQ
Drosophila_melanogaster|18088 PFGSSVNGFGRMGCDLDLILR--FDSD--MGAKIPLEAAVPSRLVYHTKENLSNGRSQTQ
Drosophila_sechellia|8805     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|665    KLMQ-LRKELSCYYTIFSKA----------YVQKGNIPVLQLMHAETKVSIDVTIDN---
Caenorhabditis_elegans|235    EIQLEILQIVRLNLQNDEQINSRINWEHGIQLVQAQIQILKVM-TVDGIDCDISVVMDRF
Pediculus_humanus|6221        NDLSLLTNVMTKTSVGCAKVV---------FIKQAKVPIIKYKHSFTGVECDVSMHQ---
Ixodes_scapularis|18153       RILETLGDLLHYVVPGVSEVH---------RILRARVPIVKFQHDIVGRECDLTLNN---
Apis_mellifera|4040           EFLDAISTIMKICIPGIDNIK---------KILEARVPIIKFFNQTTNMHCDLSSTN---
Nasonia_vitripennis|1803      RLMETVADTMNIFVPGISNVR---------KILEARVPIIKFDHSLTRVECDLAMTN---
Linepithema_humile|14962      EFMGILASTMENFIPGVRNVR---------RILEARVPIIKFNCEYTHIECDLSTTN---
Pogonomyrmex_barbatus|9015    EFLGVLANAMYQFIPGISNVR---------RILEARVPIIKFHYDYTQIECDLSATN---
Daphnia_pulex|15262           KHLEFFADVVQNYTTGCVQIQ---------RIMRARVPIIKFHHEFTGVDCDISMS----
Bombyx_mori|8573              RHMELVGELLELRVPGATRVQ---------RILHARVPIVKYAHEFTDVDCDLCYNN---
Tribolium_castaneum|9094      RNMEAIGDLLQLFLPGCSQVR---------RILQARVPIIKYYQQLTDVECDLSMAN---
Culex_quinquefasciatus|7005   RQLESIGDVLQLFLPGVNSVR---------RILKARVPIIKYHHEHLDLEIDLTMNN---
Drosophila_willistoni|6126    RQMESIGDLLHLFLPGVCHVR---------RILQARVPIIKYHHEHLNLEVDLSMSN---
Drosophila_grimshawi|1857     RQMECIGDLLHLFLPGVCHVR---------RILQARVPIIKYHHEHLNLEVDLSMSN---
Drosophila_yakuba|6879        RHMECFGDMLHLFLPGVCHVR---------RILQARVPIIKYHHEHLDLEVDLSMSN---
Drosophila_sechellia|8803     RHMECFGDMLHLFLPGVCHVR---------RILQARVPIIKYHHEHLDLEVDLSMSN---
Drosophila_melanogaster|18088 RHMECFGDMLHLFLPGVCHVR---------RILQARVPIIKYHHEHLDLEVDLSMSN---
Drosophila_sechellia|8805     ------------------------------------------------------------
                                                                                          

Caenorhabditis_elegans|665    DTSKRNTQLLAFYSQLDTRFPLLCKAMKAWAASCGV-EGASRGR-LNSFSLCLMLIHYLQ
Caenorhabditis_elegans|235    LSSMHNSFLIRHLAHIDGRFAPLCAIVKQWAASTKV-KDPKDGGF-NSYALVLLVIHFLQ
Pediculus_humanus|6221        TEALKMSQILFALSNFDPRIKPLIFFIKIWARELRL-TREQPGPTITNFSLILLTIFFLQ
Ixodes_scapularis|18153       MSGVDMSRVLHFCSQLAPSLGPLVFTLRGWASAQGL-TNKVPGTWITNFQLTLLVIFHLQ
Apis_mellifera|4040           VIALHMSELLYTYGELDWRVKPLICTIRKWARNTNI-TKDISGQWITNFSLTLLILFYLQ
Nasonia_vitripennis|1803      MSAYYMSELLYMYGEMDRRVRPLIFTVRKWAQCLKLTTKNIPGPWITNFSLSLMVLFFLQ
Linepithema_humile|14962      LIAIYMSELLNFYGEIDYRVRPLVIVIRKWAKNQEI-TSDSPGPWITNFSLSLLVLFYLQ
Pogonomyrmex_barbatus|9015    MTAVYMSELLNLYGEMDWRVRPLVTAIRVWAKRQEI-TTDVPGQWITNFPLTLLVLFYLQ
Daphnia_pulex|15262           LSGVFMSELLYLYDKIDWRFCPLVTAVRQWAAWAKL-TSPTPGNQITNFTLTIMVVFFLQ
Bombyx_mori|8573              MSGVYMSELLWLYGSLDPRVRPLTFVVRRWAQTVGL-TNQHPGRWITNFPLTLMVLFFLQ
Tribolium_castaneum|9094      MSGVHMSDFLYIMGSLDARIRPLVFTIRKWASEIGL-TNSSPGRWITNFSLTLLVLAFLQ
Culex_quinquefasciatus|7005   MTGVHMSELLYLFGQIDPRVQPLTCCVRRWAQAVGL-TNHAPGYWITNFSLTMLVMYFLQ
Drosophila_willistoni|6126    LSGFYMSELLYMFGELDTRVRPLTFTIRRWAQSCGL-TNPSPGRWISNFSLSCLVIFFLQ
Drosophila_grimshawi|1857     LTGFYMSELLYMFGELDPRVRPLTFSIRRWAQSCGL-TNPSPGRWISNFSLTCLVMYFLQ
Drosophila_yakuba|6879        LTGFYMSELLYMFGEMDPRVRPLTFTIRRWAQTCGL-TNPSPGRWISNFSLTCLVMFFLQ
Drosophila_sechellia|8803     L-----------------------------------------------------------
Drosophila_melanogaster|18088 LTGFYMSELLYMFGEMDPRVRPLTFTIRRWAQTCGL-TNPSPGRWISNFSLTCLVMFFLQ
Drosophila_sechellia|8805     -----MSELLYMFGEMDPRVRPLTFTIRRWAQTCGL-TNPSPGRWISNFSLTCLVMFFLQ
                                                                                          

Caenorhabditis_elegans|665    TV-----QVLLNIQEIFPELNGD--IVV----EDDNYMKRD-LKI--------EILEKGA
Caenorhabditis_elegans|235    CG--TFPPILPNLQEIFKKDN---FIAW----DDKVYPSILNFGA--------PLPKPLP
Pediculus_humanus|6221        QKGSSHTEILPPFDLFPLRDTDANDDVMTMENTDEKLECILNNFKCHVTSSSSSSTSSPT
Ixodes_scapularis|18153       RR-----GLLPPLKALE-------------------------------------------
Apis_mellifera|4040           IK-----NILPSLKVIKYHIKNS-RRSW----SNDWKNSI--------------------
Nasonia_vitripennis|1803      EK-----KILPSLNLLKSCATRE-DIRI----ADIYVDCT--FQR--------DITKIPK
Linepithema_humile|14962      QK-----NILPSLTTLISCATDN-DARC----TENGINCI--FLR--------NVEKLPV
Pogonomyrmex_barbatus|9015    QK-----EILPSLKILKLHAARG-DVRC----TENGIDCT--FLR--------DINKLPA
Daphnia_pulex|15262           RR--TP-PILPTLGEMIKLARPHVDTRQ----TED-INCT--FLR--------DPSVFQE
Bombyx_mori|8573              QKGKDG-CVLPSLKTLVQYAGKE-DIRL----AEENLNCT--FLR--------DMNKLPT
Tribolium_castaneum|9094      KPINSK-PILPSLNTLVKLAEPK-DSYM----TEDGINCT--FLR--------DITKLKT
Culex_quinquefasciatus|7005   QL--PE-PILPPVNRLFANATRS-DLRI----SEDQISCS--FLR--------DLSKLDF
Drosophila_willistoni|6126    QL--RQ-PILPSIGSLVKAADAD-DFRV----TEDGINCT--FVR--------DLERLNF
Drosophila_grimshawi|1857     QL--RQ-PILPAIGALVKAANAS-DVRI----TEDGINCT--FAR--------DTDRLGF
Drosophila_yakuba|6879        QL--RQ-PILPTIGALTKAAESG-DSRV----TEDGINCT--FTR--------NVDRLGF
Drosophila_sechellia|8803     ------------------------------------------------------------
Drosophila_melanogaster|18088 QL--RQ-PILPTIGALAKAAEPG-DSRV----TEDGINCT--FTR--------NVDRLGF
Drosophila_sechellia|8805     QL--RQ-PILPTIAALAKAAESG-DSRV----TEDGINCT--FTR--------NVDRLGF
                                                                                          

Caenorhabditis_elegans|665    FDF-NQNTSSLAVLFIGFMKYYSEFNFKWNWISIKHGNVLKKKWSKTRVPKNGMPKDCRF
Caenorhabditis_elegans|235    RI--APNNAPLARLFIEFLYYYSMFNFKENYIGAR------------------------P
Pediculus_humanus|6221        SSPSAPNGKSTVELLLLFYKFYSVFNFNSYGCCLNTGQIIRK----------NNFKNY-G
Ixodes_scapularis|18153       -----------EELLVSFFEYYSSVDFKSKSISPYTGQLLEK------------PDYS-A
Apis_mellifera|4040           ----NYNNDSLHNLLYGFFEYYSIFDFKMQAICIKEGKPRVK------------KDSS-P
Nasonia_vitripennis|1803      NNK-IPNTESLEALLLEFFTYFGNFDFETKALSLREGKPISK------------PEYT-A
Linepithema_humile|14962      EYRHKSNNDSLETLLYGFFEYYSKFDFHTKGICIRRGIPIQK------------PSHS-A
Pogonomyrmex_barbatus|9015    DFKYKLNQDSLETLLHDFFEYYSTFNFDIYGICIREGRQIQK------------PSHT-A
Daphnia_pulex|15262           RK--ELNSESLEDLFMGFLRFFGSFDFNERSISVITGDSHRK------------FDSK-P
Bombyx_mori|8573              DTY-GQNKANLETLLLQFFEFYAQFDFHDKAISINEGVAIRK------------PNTL-P
Tribolium_castaneum|9094      PT---ENKESLETLLVEFFEFYSQFDFASKALCLNESVAITK------------PEHC-A
Culex_quinquefasciatus|7005   KT---TNATPLDDLLLQFFEFYSHFDFNQRAISLNIGASILK------------PDHS-P
Drosophila_willistoni|6126    QS---RNTSKLSELLLQFFEFYSQFDFHNRAISLNEARSLAK------------PDHS-A
Drosophila_grimshawi|1857     RS---RNTSNLSELLLQFFEFYSQFDFHNRAISLNEGRALTK------------PDHS-A
Drosophila_yakuba|6879        RS---RNQSSLSELLLQFFEFYSQFDFHNRAISLNEGKPLSK------------PDHS-A
Drosophila_sechellia|8803     ------------------------------------------------------------
Drosophila_melanogaster|18088 RS---RNQSSLSELLLQFFEFYSQFDFHNRAISLNEGKPLSK------------PDHS-A
Drosophila_sechellia|8805     RS---RNQSSLSELLLQFFEFYSQFDFHNRAISLNEGKPLSK------------PDHS-A
                                                                                          

Caenorhabditis_elegans|665    IVVADPLLEIPRNCAGTVRQQNYMERIQLEFREEYERILKRKTIFNLYQ-------CNWS
Caenorhabditis_elegans|235    VMVMDR-RTSQNNMVRSSTNKEVCIQDPFDEHNPGRTVRTLNRIKDV-------------
Pediculus_humanus|6221        MYIKNP-FCSIYNVSKNVSLSE-VNKFQFYCQIAATLLEESETTISR-------------
Ixodes_scapularis|18153       IHIQNP-LDRQLNASRNVGAPD-LRKLQSHMGGALAALEEASRGITQ--------EVPWG
Apis_mellifera|4040           LYIYNP-FDESLNVSKNITIFE-LTRLIDHFRKALQILIETSEKDAI-------------
Nasonia_vitripennis|1803      LYICNP-LETNLNVSKNVRFEE-LERIRVAMRSASWQLEATDNEKRF---------ENWG
Linepithema_humile|14962      LHITNP-FETMLNVSKNVNIHE-VNRILQKLHDALYTLETADTSRS----------NNWG
Pogonomyrmex_barbatus|9015    LHITNP-LETTLNVGKNVSFYE-LNRIISKAQDAVHTLETADKTNE----------DNWG
Daphnia_pulex|15262           LYVINP-LERELNVSRNVTLTE-LTRAVMEARNALYILETQDHQSPG---------ENWG
Bombyx_mori|8573              LYIVNP-LEQALNVSRNVSYEE-CERLKLEVRNAAWLLDAGLDGKKT---------DGWG
Tribolium_castaneum|9094      LYIVNP-LERGLNVSKNVSMEE-LDRFRVEARNAAWILESQENKN-----------ENWG
Culex_quinquefasciatus|7005   LYIVNP-LETVLNVAKNVNLEE-TELFRIQVRNALWLLDTHDRATTATG-------DEWG
Drosophila_willistoni|6126    IYIVNP-LEQLLNVSKNVSLEE-CERLRIEVRNAAWLLESEVENSSSVKEGNEHPETIWG
Drosophila_grimshawi|1857     MYIANP-LEQLLNVSKNVSLEE-CERLRIEVRNAAWMLESEVENSTLPE--SERQDQSWG
Drosophila_yakuba|6879        MYIVNP-LEQLLNVSKNVSLEE-CERLRIEVRNAAWVLESEVENASVPE--ADGQELSWG
Drosophila_sechellia|8803     ------------------------------------------------------------
Drosophila_melanogaster|18088 MYIVNP-LEQLLNVSKNVSLEE-CERLRIEVRNAAWVLESEVENASVPE--GDGQELSCG
Drosophila_sechellia|8805     MYIVNP-LEQVLNVSKNVSLEE-CERLRIEVRNAAWVLESEVENASVPE--GDGQELSWG
                                                                                          

Caenorhabditis_elegans|665    RKLRKEGMERDLQIMILQDELRKLRIANLPTEEEVPWGTVV-------DFTSPRTFSPTN
Caenorhabditis_elegans|235    -------MRSTYQKFLPVEGSEF-TFPTLDDIINMSPEVPK---PSRAEVRNFRAEATEV
Pediculus_humanus|6221        -------NSTTRTAVVDESKFLL-NFLNYNSYANELMAKKL--------------SNNNN
Ixodes_scapularis|18153       IAALLGDGKPHGNRRVEQAH----RRFQVQELFQEGKGAPK------------TSYVVEA
Apis_mellifera|4040           -IKLIKINSISSNSIEMDDCKDIEKSTEIDNIEKDSDTFNQ---------KESLNESINK
Nasonia_vitripennis|1803      LLKLL--TNTNFDSLARNNSA---KSINIEALFENDGAKLS-----------------RK
Linepithema_humile|14962      LMTLM----TKLNLYVRHTLKSKRTKENIEDSTEDFSPEIS--------------DKYGD
Pogonomyrmex_barbatus|9015    IMTLLKINNVNTKNLKKLNNTK--ESETIKNYLENRSYEIS------------DKFDVSE
Daphnia_pulex|15262           LLTL--------------------------------------------------------
Bombyx_mori|8573              ILGLIERKSTRGLKNLLKVGNSH-RLVSVKDLFNNDDDKIE-------KVKAKRDSEMKQ
Tribolium_castaneum|9094      ILSIFENKRKASSVVNFAFANKHGRLVEVSTLFEENTDK----------PVEYKNASVKK
Culex_quinquefasciatus|7005   LVSLLWNKSTVKERITPQMFFTK-RLLNVRDIFDETDAKANATTTAPPATTEYKNRTVQN
Drosophila_willistoni|6126    LLNLF--KHPEKTIVRPNMFFKP-RMVEVSDLFENGMSPTG----TPPAGVTYKNPSIRQ
Drosophila_grimshawi|1857     LLNLF--KHPEKSVIRPNMFFKP-RMVEVSDLFDKSQAATT-----ASPPVSYKSATVRQ
Drosophila_yakuba|6879        LLNLF--KHPEKAVIRPNMFFKP-RMVEVSDLFEQKEAGATSSSTAPTPAVTYKNASVRQ
Drosophila_sechellia|8803     ------------------------------------------------------------
Drosophila_melanogaster|18088 LLNLF--KHPEKAVIRPNMFFKP-RMVEVSDLFEQKEAGATSSSTPPTPAITYKSASVRQ
Drosophila_sechellia|8805     LLNLF--KHPEKAVIRPNMFFKP-RMVEVSDLFEQKEAGAT-SSTPPTPAITYKSASMRQ
                                                                                          

Caenorhabditis_elegans|665    QHPKVFWCSEQTTENQRRDNLWPELLRTNPYAIFENLI--------------
Caenorhabditis_elegans|235    NRVGLGVYCRNSFV--------------------------------------
Pediculus_humanus|6221        INSNVKFADLKSIF--------------------------------------
Ixodes_scapularis|18153       TASGVKGAS-------------------------------------------
Apis_mellifera|4040           INVNVLETMEKNIIK-------------------------------------
Nasonia_vitripennis|1803      RTNEKKKQKKSKSKS-------------------------------------
Linepithema_humile|14962      SEVDVNQSKRKETV--------------------------------------
Pogonomyrmex_barbatus|9015    ENTNEPKAKKEEIV--------------------------------------
Daphnia_pulex|15262           ----------------------------------------------------
Bombyx_mori|8573              VLAQVDNKPKEKIK------FKNTQVASEVYR------------IRRDKII-
Tribolium_castaneum|9094      QVENIKNDTKNKLKE-----------------------------LQKTNR--
Culex_quinquefasciatus|7005   QVVGIQRATREQIGKMAKHTLSGGESGTTTTNGGGVK-------LKRNAKRR
Drosophila_willistoni|6126    QVQNIKASTRNELKQ-----MRGSSSSATSASAAAASSSSSAPTSSKNKRSR
Drosophila_grimshawi|1857     QVQNIKAAARIEMKE-----LRESSTTTTTAK------------TKRSR---
Drosophila_yakuba|6879        QVQSIKAATRSELKQ-----LRGSGSAVPTNS------------PKNRRSSR
Drosophila_sechellia|8803     ----------------------------------------------------
Drosophila_melanogaster|18088 QVQSIKAATRSELKQ-----LRGSGSSVPTSS------------PNNRRRSR
Drosophila_sechellia|8805     QVQSIKAATRSQLKQ-----LRGSGSSVPASS------------PKNRRSSR