Orthologs Set ID: EOG4006D5


Orthology Database
OrthoDB4
Gene Symbol(s)
SNF8

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Anolis carolinensis 3064 57, 111, 250, 358, 440, 606, 681
Anopheles gambiae 23803 354, 649
Apis mellifera 35646
Bombyx mori 8215 283, 488, 650
Bos taurus 10546 57, 111, 250, 358, 440, 606, 681
Branchiostoma floridae 704 57, 111, 250, 363, 440, 606, 681
Caenorhabditis elegans 10738 66, 143, 250, 327, 440, 650
Callithrix jacchus 51399 57, 111, 250, 297, 300, 358, 410, 440, 606, 681
Canis familiaris 27608 57, 111, 250, 358, 440, 606, 681
Cavia porcellus 18394 57, 111, 250, 352, 358, 440, 606, 681
Choloepus hoffmanni 13800 57, 111, 250, 358, 440, 606, 681
Culex quinquefasciatus 14628 650
Danio rerio 16283 57, 111, 250, 358, 440, 606, 681
Danio rerio 1670 57, 111, 250, 358, 440, 606, 681
Daphnia pulex 28609 440, 638
Dasypus novemcinctus 961 57, 111, 231, 240, 250, 358, 440, 606, 681
Dipodomys ordii 7049 57, 111, 250, 358, 440, 456, 459, 504, 547, 565, 606, 681, 696, 708, 804
Drosophila grimshawi 2974 488, 650
Drosophila melanogaster 16877 488, 650
Echinops telfairi 779 57, 111, 250, 358, 440, 606, 681
Equus caballus 4328 57, 111, 250, 358, 440, 606, 681
Erinaceus europaeus 6673 57, 111, 201, 247, 250, 358, 440, 606, 681
Felis catus 45384 57, 111, 250, 358, 440, 606, 681
Fugu rubripes 27430 57, 111, 250, 358, 440, 606, 681
Gallus gallus 12392 57, 111, 250, 358, 440, 606, 681
Gasterosteus aculeatus 11457 57, 111, 250, 358, 402, 606, 681
Gorilla gorilla 26825 99, 250, 358, 440, 606, 681
Ixodes scapularis 4074
Linepithema humile 7568
Loxodonta africana 14985 57, 111, 241, 250, 358, 440, 606, 681
Macropus eugenii 16688 57, 111, 250, 358, 440, 606, 681
Microcebus murinus 14305 57, 111, 250, 358, 440, 606, 681
Monodelphis domestica 9676 57, 111, 250, 358, 440, 606, 681
Mus musculus 7291 57, 111, 250, 358, 440, 606, 681
Myotis lucifugus 11929 39, 111, 250, 345, 351, 358, 440, 606, 681
Nasonia vitripennis 13712
Nematostella vectensis 17566 57, 111, 250, 306, 358, 440, 606, 681
Ochotona princeps 17626 57, 111, 250, 358, 440, 606, 681
Oryctolagus cuniculus 11511 57, 111, 250, 358, 440, 606, 681
Oryzias latipes 10226 57, 111, 250, 358, 440, 606, 681
Otolemur garnettii 1318 57, 111, 250, 358, 440, 606, 681, 726, 738, 750, 768
Pan troglodytes 15463 57, 111, 358, 440, 606, 681
Pediculus humanus 5472 769
Pogonomyrmex barbatus 11378
Pongo abelii 12679 57, 111, 250, 358, 440, 606, 681
Procavia capensis 1120 57, 111, 250, 358, 440, 606, 681
Pteropus vampyrus 11706 57, 111, 250, 358, 440, 606, 681
Rattus norvegicus 6806 57, 111, 250, 358, 440, 606, 681
Rhesus macaque 16823 57, 111, 250, 364, 395, 421, 606, 681
Sorex araneus 4958 111, 250, 358, 440, 606, 681
Spermophilus tridecemlineatus 4014 57, 111, 250, 358, 440, 606, 681
Tarsius syrichta 10851 250, 358, 440, 606, 681
Tetraodon nigroviridis 9655 61, 111, 250, 358, 399, 440, 606, 681
Tribolium castaneum 4505
Tupaia belangeri 3892 57, 111, 250, 358, 440, 606, 681
Tursiops truncatus 9958 57, 111, 250, 358, 440, 606, 681
Vicugna pacos 3506 57, 111, 250, 358, 440, 444, 681
Xenopus tropicalis 14336 358, 440, 606, 681

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 3064 ENSACAT00000006293 100563349 ENSACAG00000006297 SNF8 anoCar1
Anopheles gambiae 23803 AGAP000771-RA anoGam1
Apis mellifera 35646 GB14733-PA apiMel3
Bombyx mori 8215 BGIBMGA009397-TA v2.0
Bos taurus 10546 ENSBTAT00000025031 505628 ENSBTAG00000018803 SNF8 bosTau4
Branchiostoma floridae 704 fgenesh2_pg.scaffold_86000079 braFlo1
Caenorhabditis elegans 10738 C27F2.5.1, NM_065651 175672 C27F2.5 vps-22 ce6
Callithrix jacchus 51399 ENSCJAT00000014359 ENSCJAG00000007322 SNF8 calJac3
Canis familiaris 27608 ENSCAFT00000026744 491063 ENSCAFG00000016893 SNF8 canFam2
Cavia porcellus 18394 ENSCPOT00000025401 100714288 ENSCPOG00000020610 SNF8 cavPor3
Choloepus hoffmanni 13800 ENSCHOT00000013802 ENSCHOG00000013760 SNF8 choHof1
Culex quinquefasciatus 14628 CPIJ010671-RA 6043098 CPIJ010671 CpipJ1
Danio rerio 16283 ENSDART00000036243 danRer6
Danio rerio 1670 ENSDART00000080888, NM_001007412 492771 ENSDARG00000058076 snf8 danRer6
Daphnia pulex 28609 estExt_fgenesh1_pm.C_970018 1.1
Dasypus novemcinctus 961 ENSDNOT00000002745 101417673 ENSDNOG00000002745 SNF8 dasNov2
Dipodomys ordii 7049 ENSDORT00000009264 ENSDORG00000009262 Snf8 dipOrd1
Drosophila grimshawi 2974 FBtr0151704 6568635 FBgn0123761 GH16290 droGri2
Drosophila melanogaster 16877 FBtr0084135, NM_142730 42572 FBgn0260940 lsn dm3
Echinops telfairi 779 ENSETET00000000757 101653673 ENSETEG00000000758 SNF8 TENREC
Equus caballus 4328 ENSECAT00000023678 100055830 ENSECAG00000022092 SNF8 equCab2
Erinaceus europaeus 6673 ENSEEUT00000006015 ENSEEUG00000006031 SNF8 eriEur1
Felis catus 45384 ENSFCAT00000008946 101096857 ENSFCAG00000008944 SNF8 felCat3
Fugu rubripes 27430 ENSTRUT00000029980 101079416 ENSTRUG00000011822 EAP30 fr2
Gallus gallus 12392 ENSGALT00000001993 419990 ENSGALG00000001309 SNF8 galGal3
Gasterosteus aculeatus 11457 ENSGACT00000005229 ENSGACG00000003963 snf8 gasAcu1
Gorilla gorilla 26825 ENSGGOT00000033090 101132652 ENSGGOG00000025290 SNF8 gorGor3
Ixodes scapularis 4074 ISCW004924-RA ISCW004924 IscaW1
Linepithema humile 7568 LH14504-RA 1.2
Loxodonta africana 14985 ENSLAFT00000031850 100675675 ENSLAFG00000006599 SNF8 loxAfr3
Macropus eugenii 16688 ENSMEUT00000016682 ENSMEUG00000016638 SNF8 Meug_1.0
Microcebus murinus 14305 ENSMICT00000013301 ENSMICG00000013305 SNF8 micMur1
Monodelphis domestica 9676 ENSMODT00000015655 100018637 ENSMODG00000012276 SNF8 monDom5
Mus musculus 7291 ENSMUST00000006217 27681 ENSMUSG00000006058 Snf8 mm9
Myotis lucifugus 11929 ENSMLUT00000011772 102434639 ENSMLUG00000011769 SNF8 myoLuc1
Nasonia vitripennis 13712 NV13711-RA 1.2
Nematostella vectensis 17566 estExt_GenewiseH_1.C_50287 Nemve1
Ochotona princeps 17626 ENSOPRT00000010190 ENSOPRG00000010197 SNF8 OchPri2.0
Oryctolagus cuniculus 11511 ENSOCUT00000009153 100345109 ENSOCUG00000009156 SNF8 oryCun2.0
Oryzias latipes 10226 ENSORLT00000015574 101156924 ENSORLG00000012436 snf8 oryLat2
Otolemur garnettii 1318 ENSOGAT00000001269 100945439 ENSOGAG00000001269 SNF8 otoGar1
Pan troglodytes 15463 ENSPTRT00000017192 ENSPTRG00000009366 SNF8 panTro2
Pediculus humanus 5472 PHUM354250-RA 8232019 PHUM354250 PhumU1
Pogonomyrmex barbatus 11378 PB13826-RA 1.2
Pongo abelii 12679 ENSPPYT00000010400 100451367 ENSPPYG00000008911 SNF8 ponAbe2
Procavia capensis 1120 ENSPCAT00000016507 ENSPCAG00000016528 SNF8 proCap1
Pteropus vampyrus 11706 ENSPVAT00000004943 ENSPVAG00000004943 SNF8 pteVam1
Rattus norvegicus 6806 ENSRNOT00000008964 287645 ENSRNOG00000006500 Snf8 rn4
Rhesus macaque 16823 ENSMMUT00000029659 700029 ENSMMUG00000021087 SNF8 rheMac2
Sorex araneus 4958 ENSSART00000004858 101552718 ENSSARG00000004870 SNF8 sorAra1
Spermophilus tridecemlineatus 4014 ENSSTOT00000004014 101970723 ENSSTOG00000004023 Snf8 speTri1
Tarsius syrichta 10851 ENSTSYT00000004572 ENSTSYG00000004576 SNF8 tarSyr1
Tetraodon nigroviridis 9655 ENSTNIT00000013179 ENSTNIG00000010091 snf8 tetNig2
Tribolium castaneum 4505 GLEAN_07472 Tcas3.0
Tupaia belangeri 3892 ENSTBET00000003893 ENSTBEG00000003897 SNF8 tupBel1
Tursiops truncatus 9958 ENSTTRT00000006010 ENSTTRG00000006021 SNF8 turTru1
Vicugna pacos 3506 ENSVPAT00000007656 ENSVPAG00000007656 SNF8 vicPac1
Xenopus tropicalis 14336 ENSXETT00000049363 ENSXETG00000022819 snf8 xenTro2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 6090 ENSACAP00000006156 100563349 ENSACAG00000006297 SNF8 anoCar1
Anopheles gambiae 615 AGAP000771-PA anoGam1
Apis mellifera 4731 GB14733 apiMel3
Bombyx mori 9397 BGIBMGA009397-PA v2.0
Bos taurus 23176 ENSBTAP00000025031 505628 ENSBTAG00000018803 SNF8 bosTau4
Branchiostoma floridae 6107 fgenesh2_pg.scaffold_86000079 braFlo1
Caenorhabditis elegans 9688 C27F2.5.1 175672 C27F2.5 vps-22 ce6
Callithrix jacchus 42398 ENSCJAP00000013632 ENSCJAG00000007322 SNF8 calJac3
Canis familiaris 17902 ENSCAFP00000024849 491063 ENSCAFG00000016893 SNF8 canFam2
Cavia porcellus 14457 ENSCPOP00000017699 100714288 ENSCPOG00000020610 SNF8 cavPor3
Choloepus hoffmanni 12179 ENSCHOP00000012181 ENSCHOG00000013760 SNF8 choHof1
Culex quinquefasciatus 8330 CPIJ010671 CpipJ1
Danio rerio 2657 ENSDARP00000037351 danRer6
Danio rerio 25263 ENSDARP00000075332 492771 ENSDARG00000058076 snf8 danRer6
Daphnia pulex 11772 JGI_V11_189231 1.1
Dasypus novemcinctus 839 ENSDNOP00000002129 101417673 ENSDNOG00000002745 SNF8 dasNov2
Dipodomys ordii 6612 ENSDORP00000008705 ENSDORG00000009262 Snf8 dipOrd1
Drosophila grimshawi 6162 FBpp0150196 6568635 FBgn0123761 GH16290 droGri2
Drosophila melanogaster 15505 FBpp0083533 42572 FBgn0260940 lsn dm3
Echinops telfairi 614 ENSETEP00000000613 101653673 ENSETEG00000000758 SNF8 TENREC
Equus caballus 19548 ENSECAP00000019624 100055830 ENSECAG00000022092 SNF8 equCab2
Erinaceus europaeus 5504 ENSEEUP00000005485 ENSEEUG00000006031 SNF8 eriEur1
Felis catus 11449 ENSFCAP00000008290 101096857 ENSFCAG00000008944 SNF8 felCat3
Fugu rubripes 29863 ENSTRUP00000029863 101079416 ENSTRUG00000011822 EAP30 fr2
Gallus gallus 3847 ENSGALP00000001991 419990 ENSGALG00000001309 SNF8 galGal3
Gasterosteus aculeatus 5016 ENSGACP00000005214 ENSGACG00000003963 snf8 gasAcu1
Gorilla gorilla 20878 ENSGGOP00000017652 101132652 ENSGGOG00000025290 SNF8 gorGor3
Ixodes scapularis 4093 ISCW004924-PA ISCW004924 IscaW1
Linepithema humile 7653 LH14504-PA 1.2
Loxodonta africana 13695 ENSLAFP00000023261 100675675 ENSLAFG00000006599 SNF8 loxAfr3
Macropus eugenii 15207 ENSMEUP00000015201 ENSMEUG00000016638 SNF8 Meug_1.0
Microcebus murinus 12130 ENSMICP00000012128 ENSMICG00000013305 SNF8 micMur1
Monodelphis domestica 17790 ENSMODP00000015369 100018637 ENSMODG00000012276 SNF8 monDom5
Mus musculus 3529 ENSMUSP00000006217 27681 ENSMUSG00000006058 Snf8 mm9
Myotis lucifugus 10723 ENSMLUP00000010725 102434639 ENSMLUG00000011769 SNF8 myoLuc1
Nasonia vitripennis 3656 NV13711-PA 1.2
Nematostella vectensis 15411 estExt_GenewiseH_1.C_50287 Nemve1
Ochotona princeps 15363 ENSOPRP00000009311 ENSOPRG00000010197 SNF8 OchPri2.0
Oryctolagus cuniculus 20782 ENSOCUP00000007900 100345109 ENSOCUG00000009156 SNF8 oryCun2.0
Oryzias latipes 14698 ENSORLP00000015573 101156924 ENSORLG00000012436 snf8 oryLat2
Otolemur garnettii 1133 ENSOGAP00000001133 100945439 ENSOGAG00000001269 SNF8 otoGar1
Pan troglodytes 9675 ENSPTRP00000015917 ENSPTRG00000009366 SNF8 panTro2
Pediculus humanus 5361 PHUM354250-PA 8232019 PHUM354250 PhumU1
Pogonomyrmex barbatus 3826 PB13826-PA 1.2
Pongo abelii 6700 ENSPPYP00000010000 100451367 ENSPPYG00000008911 SNF8 ponAbe2
Procavia capensis 1047 ENSPCAP00000015449 ENSPCAG00000016528 SNF8 proCap1
Pteropus vampyrus 11032 ENSPVAP00000004676 ENSPVAG00000004943 SNF8 pteVam1
Rattus norvegicus 18789 ENSRNOP00000008964 287645 ENSRNOG00000006500 Snf8 rn4
Rhesus macaque 23500 ENSMMUP00000027758 700029 ENSMMUG00000021087 SNF8 rheMac2
Sorex araneus 4418 ENSSARP00000004411 101552718 ENSSARG00000004870 SNF8 sorAra1
Spermophilus tridecemlineatus 3609 ENSSTOP00000003598 101970723 ENSSTOG00000004023 Snf8 speTri1
Tarsius syrichta 9946 ENSTSYP00000004193 ENSTSYG00000004576 SNF8 tarSyr1
Tetraodon nigroviridis 7654 ENSTNIP00000012987 ENSTNIG00000010091 snf8 tetNig2
Tribolium castaneum 7305 GLEAN_07472 Tcas3.0
Tupaia belangeri 3386 ENSTBEP00000003381 ENSTBEG00000003897 SNF8 tupBel1
Tursiops truncatus 9412 ENSTTRP00000005682 ENSTTRG00000006021 SNF8 turTru1
Vicugna pacos 3268 ENSVPAP00000007120 ENSVPAG00000007656 SNF8 vicPac1
Xenopus tropicalis 5428 ENSXETP00000049363 ENSXETG00000022819 snf8 xenTro2

multiple sequence alignment in CLUSTALW format


Caenorhabditis_elegans|10738       ATGGCGACACGACGAAGAATTGGAGTGGCTGCAATTCAGAAAAAGCAGGAAACTGCCAAT
Daphnia_pulex|28609                ------ATGAGGAAACGCCCAGGAATCGGTGCAATTCATAAACAAAGGGTCGAGCAAGAA
Ixodes_scapularis|4074             ---ATGCGGCGACGGGTGGGCGGCGTCGGAGCCATCCAGAAACAACAGCTGACGCAGGCG
Pediculus_humanus|5472             ------ATGAGAAGAAGAGCGGGTATAGCAGCGATTCAAAAAAAAAATTTAGAACAGGAA
Bombyx_mori|8215                   ------ATGCGACGCCGCGCAGGTGTAGGTGCAATCCAAAAACACAGATTGGAACAAGAG
Tribolium_castaneum|4505           ------ATGCGTCGCAGGGCCGGACTGGGGGCCATCCAAAAACACAAATTGGAGCAAGAA
Nasonia_vitripennis|13712          ------ATGAGGAGAAAACCAGGAGTTGGAGCAATTCATAAACAGAAATATGAACAAGAA
Apis_mellifera|35646               ------ATGAGGCGAAAGGCAGGCGTTGGTGCTATCCAAAAACAAAAGCTGGAGCAAGAA
Linepithema_humile|7568            ------ATGCGACGAAAGGCCGGAGTGGGTGCAATACACAAGCAGAAATTGGAGCAGGAG
Pogonomyrmex_barbatus|11378        ------ATGAGACGAAAGGCGGGGGTGGGCGCGATACAAAAGCAGAAGTTGGAGCAGGAG
Drosophila_grimshawi|2974          ------ATGCGCCGCCGTGTTGGCCTGGGTGCCATACAGCAACAAAAGTTGGCTGCTGAA
Drosophila_melanogaster|16877      ------ATGCGACGACGTGTAGGCCTGGGAGCCATACAGCAGCAGAAGCTGGCTGCGGAG
Anopheles_gambiae|23803            ------ATGCGACGACGGGCCGGAGTTGGTGCGATCCAGAAGCAGCGCCTCGAGGCGGAG
Culex_quinquefasciatus|14628       ------ATGCGTCGTCGCGCGGGCGTCGGTGCCATCCAGAAGCAGAAGCTCGACGCGGAA
Nematostella_vectensis|17566       ---ATGCGTCGTGGACCGGGAGGAGTTGGTGCTATTAACAAGCATCGCCTTGCCAAGGCT
Tupaia_belangeri|3892              ---ATGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Branchiostoma_floridae|704         ---ATGAGGAGACGTGGGGTGGGAGCTGGCGCCATCGCCAAGAAGAAATTGGCTGAGGCA
Xenopus_tropicalis|14336           ------------------------------------------------------------
Gasterosteus_aculeatus|11457       ---------------ACACCAGGGGGCGGTATGACAAAGTATTTCCCTCTGCAACCAGCC
Danio_rerio|16283                  ---ATGCACAGAAGAGGAGTGGGAGCTGGGGCGATAGCCAAAAAGAAACTCGCTGAGGCA
Danio_rerio|1670                   ---ATGCACAGAAGAGGAGTGGGAGCTGGGGCGATAGCCAAAAAGAAACTCGCTGAGGCA
Oryzias_latipes|10226              ---AAAATGCGAAGAGGTGTTGGTGCGGGAGCCATTGCCAAAAAGAAGCTGGCAGAGGCT
Tetraodon_nigroviridis|9655        ---ATGCACAGGAGAGGTGTAGGTGCGGGGGCTATTGCCAAAAAGAAGCTCGCAGAGGCC
Fugu_rubripes|27430                ---ATGCACAGGAGAGGCGTCGGCGCGGGGGCTATTGCCAAGAAGAAGCTCGCCGAGGCC
Pteropus_vampyrus|11706            ---ATGCACCGCCGCGGGGTGGGAGCCGGCGCCATCGCCAAGAAGAAGCTTGCCGAGGCC
Myotis_lucifugus|11929             ---ATGCACCGCCGCGGGGTGGGAGCCGGCGCCATCGCC------------------GCC
Tarsius_syrichta|10851             ------------------------------------------------------------
Tursiops_truncatus|9958            ---ATGCACCGCCGCGGAGTAGGAGCCGGCGCCATCGCCAAGAAGAAGCTTGCGGAGGCC
Felis_catus|45384                  ---ATGCATCGCCGCGGGGTGGGAGCCGGCGCCATCGCCNNNNNNNNNNNNNNNNNNNNN
Vicugna_pacos|3506                 ---ATGCTCCGCCGCGGGGTGGGAGCCGGCGCTATCGCCAAGAAGAAGCTTGCCGAGGCA
Callithrix_jacchus|51399           ---ATGCACCGCCGCGGGGTGGGAGCTGGCGCCATCGCCAAGAAAAAACTTGCAGAGGCC
Anolis_carolinensis|3064           ---ATGCACCACCGGGGAGTGGGCGCCGGCGCCATCGCCAAAAAGAAGCTGGCAGAGGCG
Gallus_gallus|12392                ---ATGCACCGGCGAGGGGTGGGCGCGGGCGCTATCGCCAAGAAGAAGCTGGCGGAGGCC
Rhesus_macaque|16823               ---ATGCACCGCCGTGGGGTGGGAGCTGGCGCCATCGCCAAGAAGAAACTTGCAGAGGCC
Gorilla_gorilla|26825              ---ATGCACCGCCGCGGGGTGGGAGCTGGCGCCATCGCCAAGAAGAAACTTGCAGAGGTG
Dipodomys_ordii|7049               ---ATGCACCGCCGCGGGGTGGGAGCCGGCGCCATCGCCAAGAAGAAGCTCGCCGAGGCC
Echinops_telfairi|779              ---ATGCATCGCCGCGGGGTGGGAGCCGGCGCCATCGCCAAGAAGAAGCTTGCCGAAGCC
Cavia_porcellus|18394              ---ATGCACCGTCGCGGGGTGGGAGCTGGCGCCATCGCCAAGAAGAAGCTTGCGGAGGCC
Erinaceus_europaeus|6673           ---ATGCATCGCCGCGGGGTGGGAGCTGGCGCCATCGCCAAGAAGAAGCTTGCCGAGGCC
Sorex_araneus|4958                 ---------------------------------------------------------GCC
Mus_musculus|7291                  ---ATGCACCGGCGCGGGGTGGGAGCTGGCGCCATTGCCAAGAAGAAACTCGCAGAGGCC
Rattus_norvegicus|6806             ---ATGCACCGGCGCGGGGTGGGAGCTGGCGCCATTGCCAAGAAGAAACTCGCCGAGGCC
Pongo_abelii|12679                 ---ATGCACCGCCGCGGGGTGGGAGCTGGCGCCATCGCCAAGAAGAAACTTGCAGAGGCC
Dasypus_novemcinctus|961           ---ATGCACCGCCGCGGGGTGGGAGCCGGCGCCATCGCCAAAAAGAAGCTTGCCGAGGCC
Monodelphis_domestica|9676         ---ATGCACCGCCGCGGGGTGGGCGCCGGCGCAATTGCCAAGAAGAAGCTGGCCGAGGCC
Macropus_eugenii|16688             ---ATGCACCGGCGCGGGGTGGGCGCCGGCGCCATCGCCAAGAAGAAGCTGGCTGAGGCC
Loxodonta_africana|14985           ---ATGCATCGCCGCGGGGTGGGAGCCGGTGCCATCGCCAAGAAGAAGCTTGCCGAAGCC
Bos_taurus|10546                   ---ATGCACCGTCGTGGGGTGGGAGCTGGCGCCATCGCCAAGAAGAAGCTTGCCGAGGCC
Choloepus_hoffmanni|13800          ---ATGCACCGCCGCGGGGTGGGAGCCGGCGCCATAGCCAAGAAGAAGCTTGCCGAGGCC
Canis_familiaris|27608             ---ATGCATCGCCGCGGGGTGGGAGCTGGCGCCATCGCCAAGAAGAAGCTTGCCGAGGCC
Equus_caballus|4328                ---ATGCACCGCCGCGGGGTGGGAGCCGGCGCCATCGCCAAGAAGAAGCTTGCCGAGGCC
Otolemur_garnettii|1318            ---ATGCACCGCCGAGGGGTGGGAGCCGGCGCCATCGCCAAGAAGAAGCTTGCCGAGGCC
Oryctolagus_cuniculus|11511        ---ATGCACCGCCGCGGGGTGGGAGCCGGCGCCATCGCCAAGAAGAAGCTGGCTGAGGCC
Ochotona_princeps|17626            ---ATGCATCGCCGCGGGGTGGGAGCTGGCGCCATCGCCAAGAAGAAGCTGGCGGAGGCC
Procavia_capensis|1120             ---ATGCATCGCCGCGGGGTGGGAGCCGGTGCTATCGCCAAGAAGAAGCTTGCAGAGGCC
Spermophilus_tridecemlineatus|4014 ---ATGCACCGCCGAGGCGTGGGAGCTGGCGCCATCGCCAAGAAGAAGCTTGCGGAGGCC
Microcebus_murinus|14305           ---ATGCACCGCCGCGGGGTGGGAGCCGGTGCCATCGCGAAGAAGAAGCTTGCCGAGGCC
Pan_troglodytes|15463              ---ATGCACCGCCGCGGGGTGGGAGCTGGCGCCATCGCCAAGAAGAAACTTGCAGAGGCC
                                                                                               

Caenorhabditis_elegans|10738       ---AAGTTTGCCGCAAAGGGAGATCAAATGGCTGGAGAGCAACTGGTACAATTCTCGCAA
Daphnia_pulex|28609                ---CGATTTAGAGGTAAAGCCACAGAACTGCAAGATAATGTTTTTGAACAAATGACAAAT
Ixodes_scapularis|4074             ---AGGTTCAAAGACAAGGGCTCTGAACTGGCCGAAGAACAGCTGCAGCAGATGACACGG
Pediculus_humanus|5472             ---AAATACAGGGACAAAGGAACCGAAATCCAAGAAAATCAATTAGAACAAATGACTAAA
Bombyx_mori|8215                   ---AAATATAAAGAAAAGGGCACAGAAATACAAGAAAACCAATTCCAGCAGATGTCGAAA
Tribolium_castaneum|4505           ---AAATACAAAGATAAAGGAAGCGAAATTCAGGAGAATTTGTTCGAGCAAATGACCAAA
Nasonia_vitripennis|13712          ---AGATACAGGGATAAGGGAACAGAACTCCAAGAGAATCAGTTTGAGCAGATGACTAAG
Apis_mellifera|35646               ---AAATATAAAGATAAGGGAACTGAGATTCAAGAAAATCAATTTGAGCAAATGACAAAA
Linepithema_humile|7568            ---AAGTACCGGGACAAGGGCACAGAGATCCAGGAGAACCAATTTGAGCAGATGACGAAA
Pogonomyrmex_barbatus|11378        ---AAGTATCGCGACAAGGGCACGGAGATCCAGGAGAACCAGTTCGAGCAGATGACGAAA
Drosophila_grimshawi|2974          ---AAATACAAGGATAAGGGCGCTGACATTCAGGAATCCCAGTTGGAGCAAATGACCAAG
Drosophila_melanogaster|16877      ---AAGTACAAGGACAAGGGCACCGATCTGCAGGAAAACCAACTCGAACAGATGACCAAG
Anopheles_gambiae|23803            ---AAGTACAAGGACAAGGGTACCGAGCTGCAGGAATCCCAGTTCGAGCAGATGGTGAAG
Culex_quinquefasciatus|14628       ---CGGTACCGGGACAAGGGCACCGAGCTGCAGGACTCGCAGTTCGAGCAGATGGTGCGC
Nematostella_vectensis|17566       ---AAGTATGCCGAGAAAGGAACCGAAATTGCTGACATACAGCTTTCTCAGATGGGTAAA
Tupaia_belangeri|3892              ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGTCAAAG
Branchiostoma_floridae|704         ---AGATACAAAGACAGGGGAACTGAGATTGCAGCTGATCAGTTGGCACAGATGTCAAAA
Xenopus_tropicalis|14336           ------------------------------------------------------------
Gasterosteus_aculeatus|11457       ---AAATACAAAGAAAGAGGAAATGTTCTTGCAGAGGACCAAATTGTTCAAATGTCGAAG
Danio_rerio|16283                  ---AAGTATAAAGAGAGAGGAAGTGTCCTGGCTGAGGATCAGATCGCACAGATGTCGAAA
Danio_rerio|1670                   ---AAGTATAAAGAGAGAGGAAGTGTCCTGGCTGAGGATCAGATCGCACAGATGTCGAAA
Oryzias_latipes|10226              ---AAGTATAAAGAAAGAGGTACTGTTCTTGCAGAAGATCAGATTGTCCAGATGTCCAAA
Tetraodon_nigroviridis|9655        ACAAAGTACAAAGAAAGAGGAACTGTTATCGCAGAGGACCAGATCGCCCAGATGTCGAAG
Fugu_rubripes|27430                ---AAGTACAAAGAAAGAGGAACGGTGATTGCGGAGGATCAGATCGCCCAGATGTCGAAG
Pteropus_vampyrus|11706            ---AAGTATAAGGAGCGAGGGACTGTCTTGGCAGAGGACCAGCTGGCCCAGATGTCGAAG
Myotis_lucifugus|11929             ---AAGTACAAGGAGCGAGGGACTGTCCTGGCCGAGGACCAGCTGGCCCAGATGTCGAAG
Tarsius_syrichta|10851             ---------------------------------------------------ATGTCGAAA
Tursiops_truncatus|9958            ---AAGTATAAGGAGCGAGGGACTGTCTTGGCTGAGGACCAGCTGGCCCAGNNNNNNNNN
Felis_catus|45384                  ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Vicugna_pacos|3506                 ---AAGTATAAGGAGCGAGGGACTGTCTTGGCTGAGGACCAGCTGGCCCAGATGTCGAAG
Callithrix_jacchus|51399           ---AAGTATAAGGAGCGAGGGACGGTCTTGGCCGAGGACCAACTAGCCCAGATGTCAAAG
Anolis_carolinensis|3064           ---AAATACAAGGAACGTGGGACGGTTTTGGCTGAGGACCAGTTAGCCCAGATGTCCAAG
Gallus_gallus|12392                ---AAGTACAAGGAGAGAGGGACAGTCCTGGCTGAAGACCAGTTGGCCCAGATGTCTAAG
Rhesus_macaque|16823               ---AAGTATAAGGAGCGAGGGACGGTCTTGGCTGAGGACCAGCTAGCCCAGATGTCAAAG
Gorilla_gorilla|26825              ---AGCAGGAAGAAGGCCGACCCACAACCTGCCCCTGACTCCATCCAACAGATGTCAAAG
Dipodomys_ordii|7049               ---AAGTACAAGGAACGAGGGACTGTCCTGGCTGAGGACCAGCTGGCCCAGATGTCAAAG
Echinops_telfairi|779              ---AAGTACAAGGAGCGAGGGACTGTCTTGGCTGAGGACCAGCTGGCCCAGATGTCGAAG
Cavia_porcellus|18394              ---AAGTATAAGGAGCGGGGGACCGTCCTGGCCGAGGACCAGCTGAACCAGATGTCGAAG
Erinaceus_europaeus|6673           ---AAGTATAAAGAGCGAGGGACTGTCTTGGCTGAGGACCAGCTGGCACAGNNNNNNNNN
Sorex_araneus|4958                 ---AAGTATAAGGAGCGAGGGACTGTGTTGGCCGAGGATCAGCTGGCGCAGATGTCCAAG
Mus_musculus|7291                  ---AAGTATAAGGAGCGAGGGACTGTCCTGGCTGAGGACCAGCTGGCCCAGATGTCAAAA
Rattus_norvegicus|6806             ---AAGTATAAGGAGCGAGGGACTGTCTTGGCTGAGGACCAGCTGGCTCAGATGTCAAAA
Pongo_abelii|12679                 ---AAGTATAAGGAGCGAGGGACGGTCTTGGCTGAGGACCAGCTAGCCCAGATGTCAAAG
Dasypus_novemcinctus|961           ---AAGTATAAGGAGCGAGGGACTGTCTTGGCAGAGGACCAGCTGGCCCAGATGTCA---
Monodelphis_domestica|9676         ---AAATATAAGGAACGGGGCACTGTTCTGGCCGAGGACCAGCTGGCCCAGATGTCAAAA
Macropus_eugenii|16688             ---AAATATAAAGAACGGGGCACTGTCCTGGCCGAGGACCAGCTGGCCCAGATGTCAAAG
Loxodonta_africana|14985           ---AAGTATAAGGAGCGAGGAACTGTCTTGGCTGAGGACCAGCTGGCCCAGATGTCAAAG
Bos_taurus|10546                   ---AAGTACAAGGAGCGAGGGACTGTCTTGGCTGAGGACCAGCTGGCCCAGATGTCAAAG
Choloepus_hoffmanni|13800          ---AAGTATAAGGAGAGAGGGACTGTCTTGGCTGAGGACCAGCTGGCCCAGATGTCAAAG
Canis_familiaris|27608             ---AAGTATAAGGAGCGAGGAACTGTCTTGGCTGAGGACCAGCTGGCCCAGATGTCGAAG
Equus_caballus|4328                ---AAATATAAGGAGCGAGGGACTGTCTTGGCTGAGGACCAGCTGGCCCAGATGTCAAAG
Otolemur_garnettii|1318            ---AAATATAAGGAGAGAGGGACTGTCTTGGCAGAGGACCAGCTGGCCCAGATGTCGAAG
Oryctolagus_cuniculus|11511        ---AAGTATAAGGAGCGAGGGACTGTCTTGGCGGAGGACCAGCTGGCGCAGATGTCAAAG
Ochotona_princeps|17626            ---AAGTATAAGGAGCGAGGGACCGTCCTGGCCGAGGACCAGCTCGCCCAGATGTCGAAG
Procavia_capensis|1120             ---AAGTACAAGGAGCGAGGGACTGTCTTGGCGGAAGACCAGCTGGCCCAGATGTCGAAG
Spermophilus_tridecemlineatus|4014 ---AAGTATAAGGAGCGAGGGACTGTCTTGGCAGAGGACCAGCTGGCCCAGATGTCAAAA
Microcebus_murinus|14305           ---AAGTATAAGGAGCGGGGGACTGTCTTGGCGGAGGACCAGCTGGCCCAGATGTCGAAG
Pan_troglodytes|15463              ---AAGTATAAGGAGCGAGGGACGGTCTTGGCTGAGGACCAGCTAGCTCAG---------
                                                                                               

Caenorhabditis_elegans|10738       CAGTTAGAGCAACTTTCGGCTGGACTGGAAATGTTTGCGCAACGACATCGAGATGAAATC
Daphnia_pulex|28609                CAAATGGAAAAATTTCGAACTAACTTGGAAACATTTGCAAGCAAGCATAGAAATGAAATT
Ixodes_scapularis|4074             CAGATGGACGCCTTCCGGACCAAGTTGCAGGCCTTCGCGTCCAAGCACAAGAACGAGATC
Pediculus_humanus|5472             CAAATGGAAGTTTTCAGGGTTAACCTAGAAGAATTTGCAAGGAAACATAAAAATGATATC
Bombyx_mori|8215                   CAACTGGAAGTGTTTAGGGAAAATTTGGAAGATTTTGCATCAAAACACAAGAGTGAAATA
Tribolium_castaneum|4505           CAGTTGGGCGTATTGGAGGAAAATCTCGAGGAGTTTGCGACCAAACATAAAAATAAAATT
Nasonia_vitripennis|13712          CAATTGGAAACTTTTCGAATAAATTTGGAAGAGTTCGCTTCAAAGCACAAGAATGAAATA
Apis_mellifera|35646               CAGATGGAAACTTTTCGTGTGAATCTAGAGGAATTCGCAACAAAGTATAAAAATGAAATT
Linepithema_humile|7568            CACATGGAGACGTTTCGCGTAAATTTGGAGGAATTCGCATCCAAGCACAAGAACGAAATT
Pogonomyrmex_barbatus|11378        CACATGGAGACGTTCCGCGTAAATCTCGAGGAATTTGCGTCGAAGCACAAGAACGAGATA
Drosophila_grimshawi|2974          CAAATGGATGTCTTCCGGATCAAGCTAGAGGAGTTTGCAATGAAACACAAGGATGACATA
Drosophila_melanogaster|16877      CAAATGGAGGTATTCCGGGTGAAACTCGAGGAATTTGCGATGAAACACAAGGAGGACATA
Anopheles_gambiae|23803            CAGATGGAAGCGCTGAAGGAGAACCTGGAAGAGTTCGCGTCCAAGCACCGGAGCGAGATC
Culex_quinquefasciatus|14628       CAGATGGAGGTGCTGAAGGAGGGCCTGGAAGAGTTTGCCGCGAAGCACAAGGCGGAAATC
Nematostella_vectensis|17566       CAATTAGACTCGTTTAAAAACTATCTAGAGGACTTTGCAAGCAAGCATAAATCAGATATT
Tupaia_belangeri|3892              CAGTTGGACATGTTCAAGACCAACCTGGAAGAATTTGCCAGCAAGCACAAGCAGGAGATT
Branchiostoma_floridae|704         CAGCTGGAGACATTTCAAAAGCACCTTGAAGAATTTGCCACCAAGCACAAGGATGACATC
Xenopus_tropicalis|14336           ------------------------------------------------------------
Gasterosteus_aculeatus|11457       CAGTTGGAGACCTTCAAGTCCAACCTGGAGGAGTTCGCCAGCAAACACAAGCAAGAAATC
Danio_rerio|16283                  CAACTGGACACGTTTAAGACCCATTTGGAGGAGTTTGCCAGCAAACATAAACAAGAAATC
Danio_rerio|1670                   CAACTGGACACGTTTAAGACCCATTTGGAGGAGTTTGCCAGCAAACATAAACAAGAAATC
Oryzias_latipes|10226              CAGTTAGAAACCTTCAAGTCCAACCTGGAAGAGTTTGCCAGCAAACACAAACAAGAGATT
Tetraodon_nigroviridis|9655        CAACTGGAGACGTTCAAGTCCAACTTGGAGGAGTTTGCCAGCAAACACAAGCAAGAAATC
Fugu_rubripes|27430                CAGCTGGAGACATTCAAGAGCAACCTGGAGGAGTTTGCCAGCAAACACAAGCAAGAAATC
Pteropus_vampyrus|11706            CAGTTGGACATGTTCAAGACCAACCTGGAGGAATTTGCCAGCAAGCACAAGCAAGAGATC
Myotis_lucifugus|11929             CAATTGGACATGTTCAAGACCAACCTGGAGGAATTTGCCAGCAAACACAAGCAAGAAATC
Tarsius_syrichta|10851             CAGTTGGACATGTTTAAGACCAACCTGGAAGAGTTTGCCAGCAAGCACAAGCAGGAGATC
Tursiops_truncatus|9958            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Felis_catus|45384                  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Vicugna_pacos|3506                 CAGTTGGACATGTTCAAGACCAACCTGGAGGAATTCGCCAGCAAGCATAAGCAGGAGATC
Callithrix_jacchus|51399           CAGTTGGACATGTTCAAGACAAACCTGGAAGAATTTGCTAGCAAGCACAAGCAGGAGATC
Anolis_carolinensis|3064           CAGCTGGACATGTTTAAAACGAACCTGGAAGAGTTTGCTAGTAAACACAAACAAGAGATC
Gallus_gallus|12392                CAGCTGGACATGTTTAAGACCAACTTGGAGGAGTTTGCCAGCAAACACAAGCAAGAGATC
Rhesus_macaque|16823               CAGTTGGACATGTTCAAGACCAACCTGGAGGAATTTGCCAGCAAGCACAAGCAGGAGATC
Gorilla_gorilla|26825              CAGTTGGACATGTTCAAGACCAACCTGGAGGAATTTGCCAGCAAACACAAGCAGGAGATC
Dipodomys_ordii|7049               CAGTTGGACATGTTCAAGACCAACCTGGAGGAATTTGCCAGCAAGCACAAGCAGGAGATC
Echinops_telfairi|779              CAGCTGGACATGTTCAAGACCAACCTGGAGGAATTTGCCAGCAAACACAAGCAGGAGATC
Cavia_porcellus|18394              CAGCTGGACATGTTCAAGACCAACCTGGAGGAGTTCGCCAGCAAGCACAAGCAGGAGATC
Erinaceus_europaeus|6673           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Sorex_araneus|4958                 CAGCTGGACATGTTCAAAACCAACCTGGAGGAATTTGCCAGCAAGCACAAGCAGGAGATC
Mus_musculus|7291                  CAGCTGGACATGTTCAAGACCAACCTAGAAGAATTTGCCAGCAAGCACAAGCAAGAGATC
Rattus_norvegicus|6806             CAGTTGGACATGTTCAAGACCAACCTAGAAGAATTTGCCAGCAAGCACAAGCAAGAGATC
Pongo_abelii|12679                 CAGTTGGACATGTTCAAGACCAACCTGGAGGAATTTGCCAGCAAACACAAGCAGGAGATC
Dasypus_novemcinctus|961           CAGTTGGATATGTTCAAGACCAACCTAGAGGAATTTCACAGCAAATACAAACAGTTGCTC
Monodelphis_domestica|9676         CAGCTGGATATGTTCAAGACCAACTTGGAAGAATTTGCCAGCAAACACAAACAAGAAATC
Macropus_eugenii|16688             CAGCTGGACATGTTCAAGACCAACTTGGAAGAATTTGCCAGTAAACACAAGCAAGAAATC
Loxodonta_africana|14985           CAGTTGGATATGTTCAAGACCAACCTGGAGGAATTTGCCAGCAAACACAAGCAGGAGATC
Bos_taurus|10546                   CAGTTGGACATGTTCAAGACCAACCTGGAAGAATTTGCCAGCAAACACAAGCAGGAGATC
Choloepus_hoffmanni|13800          CAGTTGGATATGTTCAAGACCAACCTGGAGGAATTTGCCAGCAAGCACAAACAGGAGATC
Canis_familiaris|27608             CAGTTGGACATGTTCAAGACCAACCTGGAGGAATTTGCCAGCAAGCACAAGCAGGAGATC
Equus_caballus|4328                CAGTTGGACATGTTCAAAACCAACCTGGAGGAATTTGCCAGCAAGCACAAGCAGGAAATC
Otolemur_garnettii|1318            CAGTTGGACATGTTCAAGACCAACCTGGAGGAATTTGCCAGCAAGCACAAGCAGGAGATC
Oryctolagus_cuniculus|11511        CAGCTGGACATGTTCAAGACCAACCTGGAGGAATTCGCCAGCAAGCACAAGCAGGAGATC
Ochotona_princeps|17626            CAGCTGGATATGTTCAAGACCAACCTGGAGGAATTTGCCAGCAAGCACAAACAGGAGATC
Procavia_capensis|1120             CAATTGGACATGTTCAAGACGAACTTAGAGGAATTTGCCAGCAAACACAAGCAGGAGATC
Spermophilus_tridecemlineatus|4014 CAGTTGGACATGTTCAAGACCAACCTGGAGGAATTTGCCAGCAAGCACAAGCAGGAGATA
Microcebus_murinus|14305           CAGTTGGACATGTTCAAGACCAACCTGGAGGAGTTTGCCAGCAAGCACAAGCAGGAGATC
Pan_troglodytes|15463              ------------------------------------------------------------
                                                                                               

Caenorhabditis_elegans|10738       AAGAAGAACTCTCAATTTCGTCGTCATTTTCAAGAAATGTGTGCTAGTGTTGGAGTTGAT
Daphnia_pulex|28609                AAGAAAAATCCTGCCTTCAGGAAGCAATTCCAAGATATGTGTGCATCAATAGGTGTAGAC
Ixodes_scapularis|4074             CGCAAGAACCCGCACTTCCGACGCCAGTTCCAGGAGATGTGCGCCACAGCGGGCGTCGAC
Pediculus_humanus|5472             AAATCTAATCCTCAATTTAGAAAACAATTTCAAGATATGTGTGCTGCGATAGGTGTAGAT
Bombyx_mori|8215                   AAGAAGAATGCTCAGTTCAGAAGGCAATTTCAGGAAATGTGTGCTGCCATCGGTGTGGAT
Tribolium_castaneum|4505           CGGAAGAATCCCGAATTTCGGCGCCAGTTTCAAGAAATGTGTGCTAGTATTGGGGTAGAT
Nasonia_vitripennis|13712          AAAAAGAATGCACAATTTAGGCGACAGTTTACAGAGATGTGTGCATCAATTGGAGTTGAT
Apis_mellifera|35646               AAAAAAAATGCACGTTTTCGGCGGCAATTTACCGAAATGTGTGCATCAATAGGTGTAGAT
Linepithema_humile|7568            AAGAAGAACGCGCGTTTCCGTCGTCAGTTTACAGAGATGTGCGCCTCAATAGGCGTGGAT
Pogonomyrmex_barbatus|11378        AAAAAGAACGCGCACTTTCGCCGTCAATTTACGGAGATGTGCGCCTCGATAGGTGTGGAC
Drosophila_grimshawi|2974          CGCAAAAATTCGCAATTTCGTAAACAATTTCAGGAAATGTGCGCTGCAATTGGCGTTGAT
Drosophila_melanogaster|16877      CGCAAGAATTCGCAGTTCCGCAAACAGTTTCAGGAAATGTGCGCCGCCATCGGCGTGGAT
Anopheles_gambiae|23803            AAGAAGAACCCCCAGTTCCGGCGCCAGTTCCAGGAGATGTGTGCCGCAATCGGGGTGGAT
Culex_quinquefasciatus|14628       CGGAAGAATGCCCAGTTCCGGCGGCAGTTCCAGGAGATGTGTGCCGCGATTGGGGTGGAT
Nematostella_vectensis|17566       AAGAAGAATCCTGAGTTTAGAGGTCATTTCCAGAAGATGTGTGCAAGAATTGGAGTGGAT
Tupaia_belangeri|3892              CGGAAGAATCCTGAGTTCCGAGTGCAGTTCCAGGACATGTGTGCAACCATTGGGGTGGAT
Branchiostoma_floridae|704         CGACGGAATGCAGAGTTCCGTCGACAGTTCCAAGAGATGTGTGCTGCTGTGGGTGTAGAT
Xenopus_tropicalis|14336           ------------------------------------------------------------
Gasterosteus_aculeatus|11457       AGAAAGAACTCCCAGTTCAGGGTTCAGTTTCAGGAGATGTGCTCCACTATTGGTGTTGAC
Danio_rerio|16283                  CGTAAAAGCTCACAGTTCAGAGTGCAGTTCCAGGAGATGTGCGCCACTATAGGGGTTGAT
Danio_rerio|1670                   CGTAAAAGCTCACAGTTCAGAGTGCAGTTCCAGGAGATGTGCGCCACTATAGGGGTTGAT
Oryzias_latipes|10226              CGCAAGAACTCCCAGTTCAGGGTCCAGTTTCAGGAAATGTGTGCCACTATTGGAGTTGAC
Tetraodon_nigroviridis|9655        CGAAAGAACCCCCAATTCAGGGTCCAGTTTCAGGAGATGTGTGCCACCATCGGAGTAGAC
Fugu_rubripes|27430                CGAAAGAACTCCCAGTTCAGGGTTCAGTTTCAGGAGATGTGCGCCACAATTGGAGTTGAC
Pteropus_vampyrus|11706            CGAAAGAATCCTGAGTTCCGAGTGCAGTTCCAGGACATGTGTGCCACCATTGGGGTGGAT
Myotis_lucifugus|11929             CGGAAGAATCCTGAGTTTCGGGTTCAGTTCCAGGATATGTGTGCCACCATTGGGGTGGAT
Tarsius_syrichta|10851             CGGAAGAATCCTGAGTTCCGTGTACAGTTCCAGGACATGTGTGCAACCATTGGGGTGGAT
Tursiops_truncatus|9958            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Felis_catus|45384                  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Vicugna_pacos|3506                 CGGAAGAATCCCGAGTTTCGAGTGCAGTTCCAGGACATGTGTGCCACCATTGGGGTGGAT
Callithrix_jacchus|51399           CGGAAGAATCCTGAGTTCCGCGTGCAGTTCCAGGACATGTGTGCAACCATTGGCGTGGAT
Anolis_carolinensis|3064           CGTAAAAATCCCCAGTTCAGAGTCCAGTTCCAAGACATGTGTGCAACGATTGGCGTTGAT
Gallus_gallus|12392                CGTAAAAACCCCGAGTTCCGGGTCCAGTTCCAGGATATGTGTGCAACAATTGGAGTGGAT
Rhesus_macaque|16823               CGGAAGAATCCTGAGTTCCGTGTGCAGTTCCAGGACATGTGTGCAACCATTGGCGTGGAT
Gorilla_gorilla|26825              CGGAAGAATCCTGAGTTCCGTGTGCAGTTCCAGGACATGTGTGCAACCATTGGCGTGGAT
Dipodomys_ordii|7049               CGGAAGAATCCTGAGTTTCGGGTGCAGTTCCAGGACATGTGTGCAACCATTGGGGTGGAT
Echinops_telfairi|779              CGCAAGAATCCCGAGTTCCGGGTGCAGTTCCAGGACATGTGTGCCACCATTGGGGTGGAC
Cavia_porcellus|18394              CGGAAGAACCCCGAGTTCCGTGTGCAGTTCCAGGACATGTGCGCCACCATCGGGGTGGAC
Erinaceus_europaeus|6673           NNNNNNNNNNNNNNNNNNNNNGTGCAGTTCCAGGACATGTGTGCCACCATTGGGGTGGAT
Sorex_araneus|4958                 AGGAAGAATCCGGAGTTTCGGGTGCAGTTCCAGGACATGTGTGCCACCATTGGGGTGGAT
Mus_musculus|7291                  CGGAAGAATCCTGAGTTCCGAGTCCAGTTCCAAGACATGTGTGCAACCATTGGGGTGGAT
Rattus_norvegicus|6806             CGGAAGAATCCTGAGTTCCGAGTTCAGTTCCAGGACATGTGTGCTACCATTGGGGTGGAT
Pongo_abelii|12679                 CGGAAGAATCCTGAGTTCCGTGTGCAGTTCCAGGACATGTGTGCAACCATTGGTGTGGAT
Dasypus_novemcinctus|961           CAGAAGAATCTCAAGTTCCAAGTCCAGTTCCAGGACATGTATGCCACCATT---GTGGAT
Monodelphis_domestica|9676         CGGAAGAATCCTCAGTTCCGGTTGCAGTTCCAGGATATGTGTGCCACCATTGGGGTTGAC
Macropus_eugenii|16688             CGGAAGAATCCTCAGTTCCGGTTGCAGTTTCAAGACATGTGTGCCACCATTGGGGTTGAC
Loxodonta_africana|14985           CGGAAGAATCCTGAGTTCCGGGTGCAGTTCCAGGACATGTGTGCCACCATTGGAGTGGAT
Bos_taurus|10546                   CGGAAGAATCCTGAGTTCCGGGTGCAGTTTCAAGACATGTGTGCCACCATTGGCGTGGAT
Choloepus_hoffmanni|13800          CGGAAGAATCCTGAGTTCCGAGTACAGTTCCAGGACATGTGTGCCACCATTGGGGTGGAT
Canis_familiaris|27608             CGGAAGAATCCGGAGTTCCGAGTGCAGTTCCAGGACATGTGTGCCACCATTGGGGTGGAT
Equus_caballus|4328                CGGAAGAACCCTGAGTTCCGGGTGCAGTTCCAGGACATGTGTGCCACCATCGGGGTGGAT
Otolemur_garnettii|1318            CGGAAGAATCCTGAGTTCCGTGTGCAGTTCCAGGACATGTGTGCGACCATTGGGGTGGAT
Oryctolagus_cuniculus|11511        CGGAAGAATCCCGAGTTCCGGGTGCAGTTCCAGGACATGTGCGCGACCATTGGGGTGGAT
Ochotona_princeps|17626            CGGAAGAATCCCGAGTTCCGAGTGCAGTTCCAGGACATGTGTGCGACCATCGGGGTGGAT
Procavia_capensis|1120             CGGAAGAATCCTGAGTTCCGGGTGCAGTTCCAGGACATGTGTGCCACCATTGGGGTGGAT
Spermophilus_tridecemlineatus|4014 AGGAAGAATCCTGAGTTCCGGGTACAGTTCCAGGACATGTGTGCCAACATTGGAGTGGAT
Microcebus_murinus|14305           CGGAAGAATCCTGAGTTCCGTGTGCAGTTCCAGGACATGTGTGCCACCATTGGGGTAGAT
Pan_troglodytes|15463              ------------------------------------------------------------
                                                                                               

Caenorhabditis_elegans|10738       CCGTTAGCATCGAGTAAA---GGATTCTGGGCGAAAGCGCTTGGTTTCGGAGACTTTTAT
Daphnia_pulex|28609                CCACTCGCTTCAAGCAAG---GGATTTTGGTCTGAGTTGCTAGGGGTTGGAGACTTTTAT
Ixodes_scapularis|4074             CCGCTCGCGTCCAGCAAG---GGCTTCTGGGCAGACATGCTGGGCGTGGGAGACTTCTAC
Pediculus_humanus|5472             CCATTAACGAGCGTCAAA---GGATTTTGGTCT---GTTCTCGGAATAGGAGATTTTTAC
Bombyx_mori|8215                   CCACTGGCTTCGGGGAAA---GGATTCTGGTCT---GTTCTTGGTATTGGTGATTTTTAC
Tribolium_castaneum|4505           CCGTTATCCTCTGGTAAACAGGGGTTCTGGTCG---GTGTTAGGCATCGGTGATTTCTAC
Nasonia_vitripennis|13712          CCTTTGGCATCAGGGAAA---GGATTTTGGTCA---GTTTTAGGAATTGGTGACTTCTAT
Apis_mellifera|35646               CCTTTAGCTTCAGGTAAA---GGATTTTGGTCA---GTTCTTGGCATAGGAGACTTTTAT
Linepithema_humile|7568            CCACTGGCGTCTGGCAAA---GGATTCTGGTCG---GTACTGGGTATCGGTGACTTTTAT
Pogonomyrmex_barbatus|11378        CCGCTGGCGTCCGGTAAA---GGATTTTGGTCA---GTTTTGGGCATTGGCGATTTTTAC
Drosophila_grimshawi|2974          CCTTTGGCTACGGGCAAA---GGTTTCTGGAGT---GTGCTCGGCATGGGTGATTTCTAC
Drosophila_melanogaster|16877      CCGCTGGCCACCGGTAAA---GGATTCTGGAGC---GTTCTGGGAATGGGCGATTTCTAC
Anopheles_gambiae|23803            CCGCTCGCGTCGGCCAAA---GGCTTCTGGAGC---GTGCTCGGGATGGGCGATTTCTTC
Culex_quinquefasciatus|14628       CCGTTGGCCTCGGGGAAG---GGCTTTTGGAGT---GTGCTGGGGATGGGAGATTTTTAC
Nematostella_vectensis|17566       CCATTGGCATCAAGCAAA---GGATTTTGGGCTGAACTGCTAGGAGTGGGGGACTTTTAT
Tupaia_belangeri|3892              CCTCTGGCCTCTGGAAAA---GGATTTTGGTCTGAGATGCTGGGCGTTGGGGACTTCTAT
Branchiostoma_floridae|704         CCACTGGCATCTGGGAAA---GGTTTCTGGTCAGAAATGCTGGGGATTGGAGATTTCTAC
Xenopus_tropicalis|14336           ---------GCTGGAAAA---GGATTCTGGTCAGAAATGCTGGGCGTTGGAGACTTTTAT
Gasterosteus_aculeatus|11457       CCACTCGCCTCTGGCAAA---GGGTTCTGGTCCGAGATGCTCGGTGTCGGTGACTTCTAT
Danio_rerio|16283                  CCTCTTGCATCTGGGAAG---GGATTTTGGTCTGAAATGCTTGGAGTTGGTGATTTCTAC
Danio_rerio|1670                   CCTCTTGCATCTGGGAAG---GGATTTTGGTCTGAAATGCTTGGAGTTGGTGATTTCTAC
Oryzias_latipes|10226              CCTCTTGCATCTGGAAAA---GGATTCTGGTCTGAGATGCTTGGTGTTGGTGATTTTTAT
Tetraodon_nigroviridis|9655        CCATTAGCCTCTGGCAAA---GGATTTTGGTCAGAGATGCTTGGTGTAGGAGACTTCTAT
Fugu_rubripes|27430                CCACTAGCCTCTGGCAAA---GGATTTTGGTCGGAGATGCTTGGCGTGGGGGACTTCTAC
Pteropus_vampyrus|11706            CCTCTGGCCTNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTAT
Myotis_lucifugus|11929             CCTCTGGCCTCTGGAAAA---GGATTTTGGTCTGAGATGCTAGGTGTGGGAGACTTCTAT
Tarsius_syrichta|10851             CCTCTGGCCTCTGGAAAA---GGATTTTGGTCTGAGATGCTCGGCGTGGGGGACTTCTAT
Tursiops_truncatus|9958            NNNNNNNNNNCTGGAAAA---GGATTTTGGTCTGAGATGCTAGGCGTGGGAGACTTCTAT
Felis_catus|45384                  NNNNNNNNNNCTGGAAAA---GGATTTTGGTCTGAGATGCTGGGCGTGGGAGATTTCTAT
Vicugna_pacos|3506                 CCTCTGGCCTCTGGGAAA---GGATTTTGGTCTGAGATGCTAGGCGTGGGAGACTTCTAT
Callithrix_jacchus|51399           CCTCTGGCCTCATTTTCT---CTCTTTTTTAAAAAAATGTTT---------AATTTTTAC
Anolis_carolinensis|3064           CCGCTGGCCTCTGGGAAA---GGATTCTGGTCTGAAATGTTGGGGGTTGGAGATTTCTAT
Gallus_gallus|12392                CCTTTAGCATCTGGGAAA---GGATTCTGGTCAGAAATGCTGGGAGTTGGAGACTTCTAC
Rhesus_macaque|16823               CCGCTGGCCTCTGGAAAA---GGATTTTGGTCTGAGATGCTGGGCGTGGGGGACTTCTAT
Gorilla_gorilla|26825              CCGCTGGCCTCTGGAAAA---GGATTTTGGTCTGAGATGCTGGGCGTGGGGGACTTCTAT
Dipodomys_ordii|7049               CCTCTGGCCTCTGGAAAA---GGATTTTGGTCTGAGATGCTGGGCGTTGGGGACTTCTAT
Echinops_telfairi|779              CCCCTGGCCTCTGGAAAA---GGATTTTGGTCTGAAATGCTGGGCGTGGGAGACTTCTAT
Cavia_porcellus|18394              CCCCTGGCCTCTGGGAAA---GGCTTCTGGTCAGAGATGCTGGGCGTGGGCGACTTCTAC
Erinaceus_europaeus|6673           CCTCTGGCCTCTGGAAAA---GGATTTTGGTCTGAGATGCTAGGTGTGGGAGACTTCTAC
Sorex_araneus|4958                 CCGCTGGCCTCTGGAAAA---GGATTCTGGTCTGAGATGCTAGGCGTAGGAGACTTCTAT
Mus_musculus|7291                  CCCCTGGCCTCTGGAAAA---GGCTTTTGGTCTGAGATGCTGGGCGTTGGGGACTTCTAT
Rattus_norvegicus|6806             CCTCTGGCCTCTGGAAAA---GGATTTTGGTCTGAGATGCTGGGTGTTGGGGACTTCTAT
Pongo_abelii|12679                 CCACTGGCCTCTGGAAAA---GGATTTTGGTCTGAGATGCTGGGCGTGGGGGACTTCTAT
Dasypus_novemcinctus|961           ---CTGGCCTCTGGAAAA---GGATTTTGGTCTGAGATGCTGGGCGTAGGGGATTTCTAT
Monodelphis_domestica|9676         CCCTTGGCCTCTGGAAAA---GGATTTTGGTCTGAGATGTTGGGCGTTGGAGACTTTTAT
Macropus_eugenii|16688             CCTTTGGCCTCTGGAAAA---GGATTTTGGTCTGAGATGCTGGGAGTTGGAGATTTTTAT
Loxodonta_africana|14985           CCTTTGAAAGCTGGAAAA---GGATTTTGGTCTGAAATGCTGGGCGTGGGGGACTTCTAT
Bos_taurus|10546                   CCTCTGGCCTCTGGAAAA---GGATTTTGGTCTGAGATGCTAGGCGTGGGAGACTTCTAT
Choloepus_hoffmanni|13800          CCCCTGGCCTCTGGAAAA---GGATTTTGGTCTGAGATGCTGGGCGTAGGGGATTTCTAT
Canis_familiaris|27608             CCTCTGGCCTCTGGAAAA---GGATTTTGGTCTGAGATGCTAGGCGTGGGAGATTTCTAT
Equus_caballus|4328                CCTCTGGCCTCGGGAAAG---GGATTTTGGTCTGAGATGCTCGGCGTGGGAGACTTCTAT
Otolemur_garnettii|1318            CCTCTGGCCTCTGGAAAA---GGATTTTGGTCTGAGATGCTAGGTGTGGGGGACTTCTAT
Oryctolagus_cuniculus|11511        CCTCTGGCCTCTGGAAAA---GGATTCTGGTCACAGATGCTGGGAGTGGGGGACTTCTAT
Ochotona_princeps|17626            CCCTTGGCCTCTGGAAAA---GGGTTTTGGTCAGAAATGCTGGGTGTTGGGGACTTCTAT
Procavia_capensis|1120             CCGCTGGCCTCTGGAAAA---GGATTTTGGTCTGAAATGCTGGGCGTAGGGGACTTCTAT
Spermophilus_tridecemlineatus|4014 CTTCTAGCCTCTGGAAAA---GGATTTTGGTCCGAGATGCTGGGCGTGGGGGACTTCTAT
Microcebus_murinus|14305           CCTCTGGCCTCTGGAAAA---GGATTTTGGTCTGAGATGCTGGGTGTGGGGGACTTCTAT
Pan_troglodytes|15463              ------------GGAAAA---GGATTTTGGTCTGAGATGCTGGGCGTGGGGGACTTCTAT
                                                           .. .            .             .. *: 

Caenorhabditis_elegans|10738       TACGAGCTGGGAATTCAAATTGTTGAGATTTGTCTTTCTACAACACACATAAATGGAGGC
Daphnia_pulex|28609                TATGAAATTGCAGTTCAAGTTATTGAAGTGTGCCTAGCTACTTCACCAAGAAATGGGGGT
Ixodes_scapularis|4074             TACGAGCTCGGCGTCCAGGTGGTCGAGGTGTGCCTGGCCACGAGTCACCGCAACGGCGGC
Pediculus_humanus|5472             TACGAACTCGCCGTTCAAATAATAGAAGTTTGTTTAGCCACCAGTTCTAGAAATGGAGGA
Bombyx_mori|8215                   TATGAGCTAGGAGTGCAAATAGTAGAGGTGTGCTTGGCTACCAACTACAAGAATGGAGGT
Tribolium_castaneum|4505           TACGAACTGGCGGTTCAAATTGTCGAAGTTTGTTTGGCCACGAATTACAAAACAGGGGGT
Nasonia_vitripennis|13712          TATGAACTTGCAGTTCAGATTGTGGAAGTCTGTCTTGCAACAAACTACAAAAATGGAGGC
Apis_mellifera|35646               TACGAACTTGCTGTTCAAATTGTTGAAGTTTGTATGGCTACAAATTATAAAAATGGTGGA
Linepithema_humile|7568            TACGAGCTCGCCGTTCAGATCGTGGAGGTCTGTATGGCAACCAATTACAAGAATGGTGGC
Pogonomyrmex_barbatus|11378        TACGAGCTCGCTGTGCAGATAGTCGAAGTTTGTATGGCAACCAATTACAAAAACGGTGGC
Drosophila_grimshawi|2974          TACGAATTAAGTGTACAGGTTGTGGACGTCTGCCTGGCGGCGAATCACAAAACTGGCGGC
Drosophila_melanogaster|16877      TACGAACTGGGCGTCCAGGTGGTGGAGGTTTGTCTAGCTGCCAATCACAAAACCGGTGGA
Anopheles_gambiae|23803            TACGAGCTGAGCGTGCAGGTGGTGGAGGTTTGTTTGGCCCACAACCACATAACAGGTGGT
Culex_quinquefasciatus|14628       TACGAGCTGGGAGTGCAAGTGGTGGAGGTTTGTTTGGCCGCGAATCACAGCACCGGGGGT
Nematostella_vectensis|17566       TATGAGCTGGGGGTTCAGATTGTAGAAATCTGCATGGCCATGAGACCTAAGAATGGAGGG
Tupaia_belangeri|3892              TATGAGTTGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Branchiostoma_floridae|704         TATGAGCTGGGAGTTCAGATTGTGGAAGTCTGTTTAGCCACAAAACCCAGGAATGGAGGT
Xenopus_tropicalis|14336           TACGAACTCGGGGTTCAGATAATTGAAGTGTGTCTGGCTCTGAAACACCACAACGGAGGT
Gasterosteus_aculeatus|11457       TACGAGCTCGGTGTTCAAATTATTGAAGTGTGTCTAGCCCTGAAACACAGAAATGGAGGG
Danio_rerio|16283                  TATGAGCTCGGCGTACAGATCATTGAAGTCTGTTTAGCTCTAAAACACAGGAATGGTGGT
Danio_rerio|1670                   TATGAGCTCGGCGTACAGATCATTGAAGTCTGTTTAGCTCTAAAACACAGGAATGGTGGT
Oryzias_latipes|10226              TACGAGCTTGGTGTACAAATCATTGAAGTCTGTCTGGCTCTGAAGCACAGAAATGGAGGA
Tetraodon_nigroviridis|9655        TATGAACTTGGTGTGCAGATTATTGAGGTTTGTCTGGCCTTAAAACACAGAAATGGAGGC
Fugu_rubripes|27430                TATGAACTTGGCGTGCAGATTATTGAGGTGTGCCTGGCCTTAAAGCACAGAAACGGAGGC
Pteropus_vampyrus|11706            TATGAGCTGGGCGTCCAGATCATTGAAGTGTGCTTGGCCCTGAAGCACCGGAATGGAGGT
Myotis_lucifugus|11929             TATGAACTGGTGTTCCAGATTAATGAAGTGTGCCTGGGCCTGAAGCGGAAT------GGT
Tarsius_syrichta|10851             TATGAACTGGGTGTCCAGATTATCGAAGTGTGCCTGGCGCTGAAGCACCGGAATGGAGGT
Tursiops_truncatus|9958            TACGAGCTGGGTGTCCAGATTATCGAAGTGTGCCTGGCCCTGAAACACCGGAATGGAGNN
Felis_catus|45384                  TATGAGCTGGGTGTTCAGATCATCGAAGTGTGCCTGGCCCTGAAGCACCGGAATGGAGGT
Vicugna_pacos|3506                 TACGAGCTGGGTGTCCAGATTATCGAAGTGTGCCTGGCCCTGAAACACCGGAATGGAGGT
Callithrix_jacchus|51399           TATGAACTAGGTGTCCAAATTATCGAAGTGTGCCTGGCGCTGAAGCATCGGAATGGAGAA
Anolis_carolinensis|3064           TATGAATTAGGGGTCCAGATTATTGAAGTCTGTCTGGCTTTGAAGCACAGAAATGGAGGG
Gallus_gallus|12392                TATGAATTGGGTGTGCAGATTATTGAAGTTTGCCTGGCTCTGAAACACAGGAATGGAGGT
Rhesus_macaque|16823               TACGAACTAGGTGTCCAAATTATCGAAGTGTGCCTGGCGCTGAAGCATCGGAATGGAGGT
Gorilla_gorilla|26825              TACGAACTAGGTGTCCAAATTATCGAAGTGTGCCTGGCGCTGAAGCATCGGAATGGAGGT
Dipodomys_ordii|7049               TATGAACTTGGCGTCCAGATTATCGAAGTATGCCTGGCCCTGAAACACCGGAATGGAGGT
Echinops_telfairi|779              TACGAACTGGGGGTCCAGATGATTGAAGTGTGCCTGGCTTTGAAACACCGGAATGGAGGT
Cavia_porcellus|18394              TATGAGCTGGGCGTGCAGATCATCGAAGTGTGCCTGGCACTGCGGCACCGCAAAGGGGGG
Erinaceus_europaeus|6673           TATGAACTTGGTGTTCAGATTATTGAAGTGTGCCTGGCCCTGAAGCATCGGAATGGAGGT
Sorex_araneus|4958                 TATGAGCTGGGTGTCCAGATTATTGAAGTGTGCCTGGCTCTGAAGCATCGGAATGGAGGT
Mus_musculus|7291                  TATGAACTGGGTGTCCAGATTATTGAAGTGTGCCTGGCCCTCAAACATCGGAATGGAGGT
Rattus_norvegicus|6806             TATGAACTGGGCGTCCAGATTATTGAAGTGTGCCTGGCCCTAAAACATCGGAACGGAGGT
Pongo_abelii|12679                 TACGAACTAGGTGTCCAAATTATCGAAGTGTGCCTGGCGCTGAAGCATCGGAATGGAGGT
Dasypus_novemcinctus|961           TATGAGCTGGGTGTCCAGATTATTGAAGTATGCCTGGCCCTCAAGCACCGGAATGGAGGT
Monodelphis_domestica|9676         TATGAGCTGGGTGTTCAGATTATTGAAGTGTGTCTGGCACTAAAGCATCGGAATGGAGGT
Macropus_eugenii|16688             TATGAGCTGGGTGTTCAGATTATTGAGGTGTGCCTGGCACTGAAGCATCGTAATGGAGGT
Loxodonta_africana|14985           TACGAGCTGGGCGTCCAGATTATTGAAGTGTGCCTGGCCCTGAAGCACCGGAATGGAGGT
Bos_taurus|10546                   TACGAGCTGGGTGTCCAGATTATTGAAGTGTGCCTGGCCCTGAAGCACCGGAATGGAGGT
Choloepus_hoffmanni|13800          TATGAACTCGGTGTCCAGATTATCGAAGTATGCCTGGCCCTCAAGCACCGGAATGGAGGT
Canis_familiaris|27608             TACGAGCTGGGTGTCCAGATTATCGAAGTGTGCCTGGCTCTGAAGCACCGGAATGGAGGT
Equus_caballus|4328                TATGAGCTGGGCGTCCAGATTATTGAAGTGTGCCTGGCTCTGAAGCACCGGAATGGAGGT
Otolemur_garnettii|1318            TATGAATTGGGTGTCCAGATTATCGAAGTCTGCCTGGCGCTAAAGCACCGGAATGGAGGT
Oryctolagus_cuniculus|11511        TATGAGCTGGGCGTCCAGATTATCGAAGTGTGCCTGGCCCTGAAGCACCGCAATGGAGGT
Ochotona_princeps|17626            TATGAGCTGGGTGTCCAGATAATTGAAGTGTGCCTGGCCCTGAAGCATCGAAATGGAGGT
Procavia_capensis|1120             TATGAGCTGGGCGTCCAGATTATTGAGGTGTGCTTGGCCTTGAAGCACCGGAATGGAGGT
Spermophilus_tridecemlineatus|4014 TATGAGTTGGGCGTCCAGATTATCGAAGTGTGCCTGGCTCTAAAGCATCGGAATGGAGGT
Microcebus_murinus|14305           TATGAACTGGGCGTCCAAATTATTGAAGTGTGCCTGGCGCTGAAGCACCGGAATGGAGGT
Pan_troglodytes|15463              TACGAACTAGGTGTCCAAATTATCGAAGTGTGCCTGGCGCTGAAGCATCGGAATGGAGGT
                                   ** **. * .   .     .    .   . ..  .                      .  

Caenorhabditis_elegans|10738       ATCATG---ACAGTTGAAGAAATTCGTAATCGATTAATGAGAACACGATCAAGA---ACT
Daphnia_pulex|28609                TTGATT---ACTTTGGGTGAGTTGCGTCAGAGATTAATCAAAGCTAGAGGAAAAGCCCAA
Ixodes_scapularis|4074             CTCATG---AGCCTCGAGGAGCTCCGGGACCGGGTGGCCCGGTCCCGCGGCAGTCTGGCG
Pediculus_humanus|5472             TTGATT---GGATTAGAAGAATTGCGTAGGAGATTAATTAAAGCGAGAGGAAAAAGAAAA
Bombyx_mori|8215                   CTCATA---ACTTTAGAGGAATTACGTTCCAGACTTATAGCTTCTCGTGGCCGAGCAAAG
Tribolium_castaneum|4505           TTGATT---AGTTTGGATGAACTCAGGACGAGACTGATTAAAGCTAGAGGTAAGGGCAAA
Nasonia_vitripennis|13712          TTGATA---TCATTGGATGAGCTTAGGGATCGCTTAGTTCGAGCAAGGGGTCGTCGCCAA
Apis_mellifera|35646               TTAATA---TCATTAGATGAACTTAGAGCAAGATTAATTCAAGCTAGAGGTCGTAGAAAA
Linepithema_humile|7568            CTGATA---TCGCTGGACGAACTGAGAACACGCTTGATCCAAGCCAGAGGACGCAGAAAG
Pogonomyrmex_barbatus|11378        CTGATA---TCTCTGGACGAGCTAAGAACGCGTTTGATTCAAGCCAGAGGACGTAGAAAG
Drosophila_grimshawi|2974          CTAATG---GAACTGGATGAACTGCGTCGTCGCTTGATTGCCGCACGTGGCCAGAGTCCC
Drosophila_melanogaster|16877      CTTATG---GAGCTGGACGATCTGCGACGTCGGCTAATCGCCGCCAGAGGTCAGAGTTCA
Anopheles_gambiae|23803            CTGATG---GATCTGGACGAGCTACGCAATAGACTGGTGGCGGCCCGTGGCAAGAGCCAA
Culex_quinquefasciatus|14628       TTGATG---GAGCTGGAGGAGCTGAGGAATCGGTTGGTGGCTGCGCGAGGGCGTAAGCAG
Nematostella_vectensis|17566       TTAATG---ACTCTTGACAGCCTTCACAAAGCTATCCTCAAGTCAAGTAAAGCA------
Tupaia_belangeri|3892              NNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------
Branchiostoma_floridae|704         AAGCGG------------------------------------------------------
Xenopus_tropicalis|14336           CTGATT---ACCCTGGCTGAGCTCCATCAGCATGTACTGAAAGGCAGAGGGAAA------
Gasterosteus_aculeatus|11457       CTCATT---ACATTGGATGAACTCCATCACAGAGTGCTGAAG------------------
Danio_rerio|16283                  CTCATC---ACATTAGATGAACTTCACCATCGCGTCTTGAAAGGAAGAGGGAAG------
Danio_rerio|1670                   CTCATC---ACATTAGATGAACTTCACCATCGTGTCTTGAAAGGAAGAGGGAAG------
Oryzias_latipes|10226              CTTATA---ACTTTAGATGAGCTTCATCAGCGAGTTCTGAAGGGACGCGGTAAA------
Tetraodon_nigroviridis|9655        CTCATT---ACTTTGGATGAACTCCATCATAGAGTGTTAAAGGGACGAGGGAAA------
Fugu_rubripes|27430                CTCATT---ACTTTAGATGAACTCCATCATAGAGTGTTAAAGGGACGAGGTAAA------
Pteropus_vampyrus|11706            CTGATA---ACTCTGGAGGAACTACATCAACAGGTGCTAAAAGGAAGGGGCAAA------
Myotis_lucifugus|11929             CTAATA---ACTCTGGAGGAACTACATCAACAGGTGTTAAAAGGAAGGGGCAAA------
Tarsius_syrichta|10851             CTGATA---ACTCTGGAGGAACTGCAACATGAGGTGCTAAAAGGAAAGGGCAAG------
Tursiops_truncatus|9958            NNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------
Felis_catus|45384                  CTGATA---ACTCTGGAGGAACTACATCAGCAGGTGTTAAAAGGAAGGGGCAAA------
Vicugna_pacos|3506                 CTGATA---ACTCTGGAGGAACTACATCAACAGGTGCTGAAAGGGAGGGGCAAA------
Callithrix_jacchus|51399           CAAAAG---ATTACTAGCCATACTCATTGCAAATTATTCTCAGGAAGAGGACCC---TGT
Anolis_carolinensis|3064           CTAATA---ACACTGGAGGAGCTCCACCAGCAAGTACTCAAAGGAAGAGGAAAA------
Gallus_gallus|12392                CTGATA---ACACTGGAAGAACTTCATCAGCAAGTGCTGAAGGGAAGAGGGAAG------
Rhesus_macaque|16823               GAGGTTGAATCCATGGCAAGTCTCCATGGCCAAGGCCTTGAACTCCTGGGCTCA------
Gorilla_gorilla|26825              CTGATA---ACTTTGGAGGAACTACATCAACAGGTGTTGAAGGGAAGGGGCAAG------
Dipodomys_ordii|7049               CTGATA---ACTCTGGAGGAACTACATCAACAGGTGTTGAAAGGAAGGGGCAAA------
Echinops_telfairi|779              CTGATA---ACCCTGGAAGAACTGCACCAGCAGGTGTTGAACGGAAGGGGCAGG------
Cavia_porcellus|18394              CTGATA---ATGCTGGAGGAGCTGCACCAGCAGGTGTTAAAGGGCCGGGGCAAG------
Erinaceus_europaeus|6673           CTGATA---ACCCTGGAGGAGTTACATCAACAGGTGTTGAAAGGAAGAGGCAAA------
Sorex_araneus|4958                 CTGATA---ACTCTGGAGGAGCTCCATCAACAGGTGTTGAAAGGAAGGGGCAAA------
Mus_musculus|7291                  CTGATA---ACTCTGGAGGAGCTACATCAGCAGGTGTTAAAAGGAAGGGGCAAG------
Rattus_norvegicus|6806             CTGATA---ACTCTGGAGGAGCTACATCAGCAGGTGTTAAAAGGAAGGGGCAAG------
Pongo_abelii|12679                 CTGATA---ACTTTGGAGGAACTACATCAACAGGTGTTGAAGGGAAGGGGCAAG------
Dasypus_novemcinctus|961           CTTATA---ACACTGGAGGAGCTACATCAACAGGTGTTAAAAGGAAGGGGCAAG------
Monodelphis_domestica|9676         CTGATC---ACTTTGGAGGAGCTACATCAGCAGGTGTTGAAGGGAAGGGGCAAG------
Macropus_eugenii|16688             CTGATC---ACTCTGGAGGAACTACACCAGCAGGTGTTGAAGGGAAGGGGCAAG------
Loxodonta_africana|14985           TTGATA---ACTCTGGAGGAACTACATCAACAAGTGTTAAAAGGAAGGGGCAAG------
Bos_taurus|10546                   CTGATA---ACTTTGGAGGAACTGCATCAACAGGTGTTAAAAGGAAGGGGCAAA------
Choloepus_hoffmanni|13800          CTGATA---ACTCTAGAGGAACTACATCAACAGGTGTTAAAAGGAAGGGGCAAG------
Canis_familiaris|27608             CTGATA---ACTCTGGAGGAGCTACATCAACAGGTGTTAAAAGGAAGGGGCAAA------
Equus_caballus|4328                CTCATA---ACTCTGGAGGAGCTCCATCAGCAGGTGTTGAAAGGAAGGGGCAAA------
Otolemur_garnettii|1318            CTGATA---ACTCTGGAGGAACTACATCAACAAGTGTTAAAAGGAAGGGGCAAA------
Oryctolagus_cuniculus|11511        CTGATC---ACTCTGGAAGAGCTACATCAGCAGGTGTTAAAGGGAAGAGGCAAG------
Ochotona_princeps|17626            CTGATC---ACTCTGGAAGAGCTCCATCAGCAGGTGTTGAAAGGAAGAGGCAAG------
Procavia_capensis|1120             CTGATA---ACTCTGGAGGAACTACACCAACAGGTGTTAAAAGGAAGGGGCAAG------
Spermophilus_tridecemlineatus|4014 CTGATA---ACTCTGGAGGAACTACATCAACAAGTGTTAAAAGGAAGGGGCAAG------
Microcebus_murinus|14305           CTGATA---ACTCTGGAGGAACTACATCAACAGGTGTTAAAAGGAAGGGGCAAA------
Pan_troglodytes|15463              CTGATA---ACTTTGGAGGAACTACATCAACAGGTGTTGAAGGGAAGGGGCAAG------
                                                                                               

Caenorhabditis_elegans|10738       CGTAAAGATACCATTTCAACAGATGATATTCTTCGTGCCGTAGATAAATTGAAAGTACTT
Daphnia_pulex|28609                CACCATCAAGACATTTCAAATGATGACATTATAAGAGCAATCAAGAAACTGAAAGTGTTG
Ixodes_scapularis|4074             CGCCAGGAGGAAATCAGCCAGGACGACCTGCTCCGGGCCATCGAGAAGCTCGGCACGCTG
Pediculus_humanus|5472             GAACATCAAGAAATTACGGTCGATGATCTTTTAAGAGCTGCTAAAAAACTTAAAGTTTTC
Bombyx_mori|8215                   AAGCATCAAGACATCACAAATGAAGATCTGCTAGCGGCAGTGAAAAAACTAAGGATATTT
Tribolium_castaneum|4505           CAACACCAGGAGATCACGCAAGACGACTTGATTCGCGCGGCGCAAAAGTTGAAAATTTTG
Nasonia_vitripennis|13712          GAGCATCAAGAGATAACAAACGAGGACCTGTTAGCATCAGCTAAGAAACTTAAGATACTG
Apis_mellifera|35646               GAACATCAAGAAATTACAAATGAAGACTTACTAGCTGCAGCTAAAAAATTAAAAATTTTT
Linepithema_humile|7568            GAGCATCAAGAGATCACCAACGAAGATCTATTAGCTGCTGCGAAGAAGCTGAAAATATTT
Pogonomyrmex_barbatus|11378        GAACATCAGGAGATCACCAATGAGGATTTGCTGGCTGCTGCAAAGAAGTTGAGAATATTT
Drosophila_grimshawi|2974          ATGCATCAGGAGATCACAAAGGAGGACATACTAATGGCGACGAAAAAATTGAACATCTTT
Drosophila_melanogaster|16877      GTGCACCAGGAGATCACCAAGGAGGACATCCTAATGGCCGCTAAGAAATTGAGCATTTTT
Anopheles_gambiae|23803            ACTCACCAGGAAATCACGACCGAGGACATACTGATGGCGACGAAGAAGCTGAAAATATTC
Culex_quinquefasciatus|14628       ATTCACCAGGAAATAACCAACGAGGACATCTTGATGGCAACGAAGAAGTTGAACATTTTT
Nematostella_vectensis|17566       ---AGACAAGATGTGACTGAGGACGATCTGGAGAGAGCAATAAAAAAGCTGCATGCTTTA
Tupaia_belangeri|3892              NNNNNNNNNNNNNNNNNNNNAGACGACCTGATCAGAGCCATCAAGAAACTAAAGGCACTC
Branchiostoma_floridae|704         ------------------GGTGATGATTTGTTAAGAGCGATTAAGAAGCTGAAAGTCCTG
Xenopus_tropicalis|14336           CTTGCACAGGACGTTAGTCAGGATGATATCATTCGGGCAATTAAAAAGCTAAAAGTACTT
Gasterosteus_aculeatus|11457       ---ACCCTAAATGCGTGCAGAGACGACTTGATGAGAGCCATAAAGAAGCTAAAGGTGATG
Danio_rerio|16283                  TTTGCACAAGATGTGAGCCAGGATGATCTGGTGCGGGCCATCAAAAAGCTGAAGGCAATG
Danio_rerio|1670                   TTTGCACAAGATGTGAGCCAGGATGATCTGGTGCGGGCCATCAAAAAGCTGAAGGCAATG
Oryzias_latipes|10226              TATGCCCAAGATGTGAGCCAGGACGACTTGGTAAGAGCCATAAAAAAACTGAAAGCAATG
Tetraodon_nigroviridis|9655        TATGCCCAGGATGTGAGCCAAGATGACTTGATGAGAGCCATAAAGAAACTGAAGGTGATG
Fugu_rubripes|27430                TATGCTCAGGATGTAAGCCAAGATGACTTGATGAGAGCTATAAAGAAACTGAAGGTGATG
Pteropus_vampyrus|11706            TTCGCCCAGGATGTTAGCCAAGACGACCTGATCAGGGCCATTAAGAAACTAAAGGCACTT
Myotis_lucifugus|11929             TTCGCTCAGGATGTCAGCCAAGATGACCTGATCAGGGCCATCAAGAAACTGAAGGCCCTT
Tarsius_syrichta|10851             TTTGCTCAGGACGTCAGCCAAGACGACCTGATCAGGGCCATCAAGAAACTAAAGGCACTT
Tursiops_truncatus|9958            NNNNNNNNNNNNNNNNNNNNAGACGACCTGATCAGGGCCATCAAGAAGCTAAAGGCACTG
Felis_catus|45384                  TTCGCACAGGATGTCAGCCAAGACGACCTTATCAGGGCCATCAAGAAGCTGAAGGCGCTC
Vicugna_pacos|3506                 TTCGCCCAGGATGTCAGCCAAGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Callithrix_jacchus|51399           CTTTTTACTGATGTAGTTGAAGACGACCTGATCAGGGCCATCAAGAAACTAAAGGCACTT
Anolis_carolinensis|3064           TTTGCTCAGGATGTCAGCCAGGATGATCTCATCCGAGCGATTAAGAAGCTGAAAGTTCTA
Gallus_gallus|12392                TTTGCTCAGGAAGTCAGCCAAGATGATCTCCTTCGTGCAATCAAGAAACTGAAGGTCTTG
Rhesus_macaque|16823               ACAACTCTTCCTCACCTCAGAGACGACCTGATCAGAGCCATCAAGAAACTAAAGGCACTT
Gorilla_gorilla|26825              TTCGCCCAGGATGTCAGTCAAGATGACCTGATCAGAGCCATCAAGAAACTAAAGGCACTT
Dipodomys_ordii|7049               TTCGCCCAGGATGTTAGCCAGGACGATCTCATCAGGATC------AAACTAAAGGCACTG
Echinops_telfairi|779              TTCGCCCAGGATGTCAGCCAAGACGACTTGATCAGGGCTATCAAGAAACTCAAGGTGCTT
Cavia_porcellus|18394              TTTGCACAGGATGTCAGCCAAGACGACCTCATCAGGGCCATCAAGAAGCTCAAGGCACTG
Erinaceus_europaeus|6673           TTTGCCCAGGATGTCAGCCAAGACGACCTGATCCGAGCTATCAAGAAATTAAAGGCACTT
Sorex_araneus|4958                 TTCGCCCAGGATGTCAGCCAAGACGACCTGATCCGGGCCATCAAGAAACTGAAGGCGCTT
Mus_musculus|7291                  TTTGCTCAGGATGTCAGCCAAGACGACCTGATCAGGGCCATCAAGAAGCTGAAAGCCCTG
Rattus_norvegicus|6806             TTTGCTCAGGATGTCAGCCAAGACGACCTGATCAGGGCCATCAAGAAGCTGAAAGCACTG
Pongo_abelii|12679                 TTCGCCCAGGATGTCAGTCAAGATGACCTGATCAGAGCCATCAAGAAACTAAAGGCACTT
Dasypus_novemcinctus|961           TTCGCCCAGGATGTCAGCCAAGACGACCTGATCAGGGCCATCAAGAAACTAAAGGCACTT
Monodelphis_domestica|9676         TTTGCTCAGGATGTCAGCCAAGATGACCTCATCCGGGCCATCAAGAAACTGAAAGCCCTG
Macropus_eugenii|16688             TTTGCTCAGGATGTCAGCCAAGATGACCTCATCCGGGCCATCAAGAAACTGAAGGCCCTG
Loxodonta_africana|14985           TTCGCCCAGGATGTCAGTCAAGACGACCTGATCAGGGCCATCAAGAAACTAAAGGCACTT
Bos_taurus|10546                   TTCGCCCAGGATGTCAGCCAAGACGACCTGATCAGGGCCATCAAGAAACTAAAGGCACTC
Choloepus_hoffmanni|13800          TTCGCCCAGGATGTTAGCCAAGACGACCTGATCAGGGCCATCAAGAAACTAAAGGCACTT
Canis_familiaris|27608             TTCGCACAGGACGTCAGCCAAGATGACCTGATCAGAGCCATCAAGAAGCTGAAGGCGCTT
Equus_caballus|4328                TTTGCCCAGGACGTCAGCCAAGACGACCTGATCAGGGCCATCAAGAAACTAAAGGCACTT
Otolemur_garnettii|1318            TTCGCCCAGGATGTCAGCCAAGACGACCTGATCAGGGCCATCAAGAAACTAAAGGCACTT
Oryctolagus_cuniculus|11511        TTCGCGCAGGACGTCAGCCAAGATGACCTCATCAGGGCCATCAAGAAACTTAAGGCGCTC
Ochotona_princeps|17626            TTCGCGCAGGATGTTAGCCAAGACGACCTCATCAGGGCCATCAAGAAGCTCAAGGCCCTT
Procavia_capensis|1120             TTCGCCCAGGATGTCAGCCAAGACGACCTGATCAGGGCCATCAAGAAACTAAAGGTACTT
Spermophilus_tridecemlineatus|4014 TTCGCCCAGGATGTCAGCCAAGACGACCTGATCAGGGCCATCAAGAAACTAAAGGCATTG
Microcebus_murinus|14305           TTCGCCCAGGATGTCAGCCAAGACGACCTGATCAGGGCCATCAAGAAACTAAAGGCACTT
Pan_troglodytes|15463              TTCGCCCAGGATGTCAGTCAAGATGACCTGATCAGAGCCATCAAGAAACTAAAGGCACTT
                                                        ** .   .                    .        . 

Caenorhabditis_elegans|10738       GGAAACGGATTTGAATTGGTTCCTCTCGGTGGTGGTCGT---------------TTTCTG
Daphnia_pulex|28609                GGACCGGGATTCTCTATAGTATCCCTCAAA---GGTACCCAAGATACTTCAGATATTCTC
Ixodes_scapularis|4074             GGCAAAGGCTTCCGCCTCATCGCCGTCGGC---GCCCGC---------------TACCTG
Pediculus_humanus|5472             GGAAGTGGTTTTTCTGTTATTCCAATATCAAAGGGTCAG---------------TATTTA
Bombyx_mori|8215                   GGAAATGGGTTTACTGTAGTTCCGATCAGTAAAGGCAAA---------------TGGCTG
Tribolium_castaneum|4505           GGGAGTGGTTTCATGGTGGTCCCTGTGGGGAAGGGGCAG---------------TATATG
Nasonia_vitripennis|13712          GGTAATGGATTTTCGGTTGTGCCTATTAGCAAAGGAAAA---------------TATTTA
Apis_mellifera|35646               GGAAATGGATTTTCTATTGTTCCAATTGGAAGAGGTAAA---------------CACTTA
Linepithema_humile|7568            GGAAATGGCTTCTCTGTGGTTCCCATCGGCAGAGGAAGA---------------CACTTG
Pogonomyrmex_barbatus|11378        GGAAACGGTTTTTCTGTAGTTCCTATTGGCAGAGGAAAA---------------CATTTA
Drosophila_grimshawi|2974          GGCAACGGTTTCGTGGTACATAAATTGGGAAAGGGCAAG---------------TACATT
Drosophila_melanogaster|16877      GGCAACGGCTTTGTGGTTCACAAGCTGGGCAAGGGCAAG---------------TACATA
Anopheles_gambiae|23803            GGCAACGGCTTCACCGTGTACTCGGTCGGGAAGAACCGG---------------CACATG
Culex_quinquefasciatus|14628       GGTAATGGATTTACGGTTTATCCGGTGGGCAAGGGACGC---------------CACATG
Nematostella_vectensis|17566       GGCAGTGGTTTCCAGGTAATTGTGGCAGGA---AACAGA---------------AGACTT
Tupaia_belangeri|3892              GGCACTGGCTTCGGCATCATCCCCGTGGGT---GGTACT---------------TACCTC
Branchiostoma_floridae|704         GGGAGTGGGTTCACAGCCATCCCTGTGGGAGGGGGGCGG---------------TACCTG
Xenopus_tropicalis|14336           GGTAATGGATTTGGCATCATCCCTGTTGGA---GGTTCT---------------TATTTA
Gasterosteus_aculeatus|11457       GGGAACGGCTTCGGGATGATTCCGGTCGGA---GGCTCT---------------TATTTG
Danio_rerio|16283                  GGCAACGGCTTTGGGATGATTCCTGTTGGT---GGCACA---------------TATCTA
Danio_rerio|1670                   GGCAACGGCTTTGGGATGATTCCTGTTGGT---GGCACA---------------TATCTA
Oryzias_latipes|10226              GGGAGTGGTTTTGGGATGATTCCTGTTGGT---GGTTCC---------------TACTTG
Tetraodon_nigroviridis|9655        GGGAGCGGCTTTGGGATGATCCCTGTTGGT---GGGTCC---------------TATCTG
Fugu_rubripes|27430                GGCAATGGCTTTGGGATGATCCCTGTTGGT---GGCTCC---------------TATTTG
Pteropus_vampyrus|11706            GGCACNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNN---------------NNNNNN
Myotis_lucifugus|11929             GGCACTGGCTTCGGCATCATCCCTGTCAGC---GGCACT---------------TACCTC
Tarsius_syrichta|10851             GGCACTGGCTTCGGCATCATCCCTGTGGGC---GGCACT---------------TACCTC
Tursiops_truncatus|9958            GGCACTGGCTTCGGCATCATCCCTGTGGGC---GGCACT---------------TACCTC
Felis_catus|45384                  GGCACCGGCTTTGGCATCATCCCCGTGGGT---GGCACC---------------TACCTC
Vicugna_pacos|3506                 NNNNNNNNN---------------------------------------------------
Callithrix_jacchus|51399           GGGACTGGCTTCTGCATCATCCCTGTGGGC---GGCACT---------------TACCTC
Anolis_carolinensis|3064           GGAAATGGCTTTGGGATCCTTCCTGTCGGC---GGAACC---------------TACCTG
Gallus_gallus|12392                GGGAGTGGCTTTGGGATTATCCCTGTTGGT---GGAACA---------------TATCTG
Rhesus_macaque|16823               GGCACTGGCTTCGGCATCATCCCTGTGGGC---GGCACT---------------TACCTC
Gorilla_gorilla|26825              GGCACTGGCTTCGGCATCATCCCTGTGGGC---GGCACT---------------TACCTC
Dipodomys_ordii|7049               GGCACTGGCTTCGGCATCATCCCTGTGGGC---GGCACT---------------TATCTC
Echinops_telfairi|779              GGTTCTGGCTTTGGCATCATCCCCATGGGC---GGCACT---------------TACCTC
Cavia_porcellus|18394              GGCACAGGCTTCGGCATCATCCCGGTGGGC---GGCACC---------------TACCTC
Erinaceus_europaeus|6673           GGCACTGGTTTCAGCATTATCCCTGTGGGT---GGCACT---------------TACCTC
Sorex_araneus|4958                 GGCACTGGCTTCAGCATCATCCCCGTGGGC---GGCACT---------------TACCTC
Mus_musculus|7291                  GGCACTGGATTCGGCATCATCCCTGTGGGA---GGCACT---------------TACCTC
Rattus_norvegicus|6806             GGCACTGGATTTGGCATCATCCCTGTGGGA---GGAACT---------------TACCTC
Pongo_abelii|12679                 GGCACTGGCTTCGGCATCATCCCTGTGGGC---GGCACT---------------TACCTC
Dasypus_novemcinctus|961           GGCACTGGCTTCGGCATCATCCCTGTGGGC---GGCACT---------------TACCTC
Monodelphis_domestica|9676         GGCACTGGCTTCAGCATCATTCCTGTGGGA---GGCACT---------------TACCTG
Macropus_eugenii|16688             GGCACTGGCTTCAGCATCATTCCTGTGGGA---GGCACT---------------TACCTG
Loxodonta_africana|14985           GGCACCGGCTTCAGTATCATCCCCGTGGGC---GGCACT---------------TACCTC
Bos_taurus|10546                   GGCACTGGCTTCAGCATCATCCCTGTGGGT---GGCACT---------------TACCTC
Choloepus_hoffmanni|13800          GGCACTGGCTTCGGCATCATCCCTGTGGGT---GGCACT---------------TACCTC
Canis_familiaris|27608             GGTACTGGCTTTGGCATCATCCCCGTGGGT---GGCACC---------------TACCTC
Equus_caballus|4328                GGCACTGGCTTCGGTATCATCCCTGTGGGT---GGCACT---------------TACCTC
Otolemur_garnettii|1318            GGCACTGGCTTCGGCATCATCCCTGTGGGT---GGTACT---------------TACCTC
Oryctolagus_cuniculus|11511        GGCACCGGCTTCGGCATCATCCCCGTGGGC---GGCACT---------------TACCTC
Ochotona_princeps|17626            GGCACTGGCTTTGGCATCATCCCTGTTGGT---GGCACT---------------TACCTC
Procavia_capensis|1120             GGCACTGGCTTCGGCATCATCCCTGTGGGC---GGCACT---------------TACCTC
Spermophilus_tridecemlineatus|4014 GGCACTGGCTTCGGCATCATCCCTGTGGGC---GGTACT---------------TACCTC
Microcebus_murinus|14305           GGCACTGGCTTCGGCATCATCCCTGTGGGC---GGCACT---------------TACCTC
Pan_troglodytes|15463              GGCACTGGCTTCGGCATCATCCCTGTGGGC---GGCACT---------------TACCTC
                                   ..    ..                                                    

Caenorhabditis_elegans|10738       GTTCAGTCGGTTCCAGGAGAATTGAGTATGGATCATTCAAGAGTTCTTCAACTTGCA---
Daphnia_pulex|28609                ATAAGATCCATTCCAGGTGAATTGAGTGCTGACCACACTGAAGTCCTCAAAGCAGCA---
Ixodes_scapularis|4074             GTCCAGTCGGTGCCCACGGAGTTGAGCCTGGACCACACGACGCTCATCAGACAGGCC---
Pediculus_humanus|5472             GTTCAATCAGTTCCTGGTGAATTATCAATGGATCACACTGCTGTTCTTCATGCTGCTTCG
Bombyx_mori|8215                   GTTCAATCGGTGCCTGGTGAATTAAACATGGATCAAACACTAGTTCTTCAGAAGGCCAGT
Tribolium_castaneum|4505           GTGCAGTCCATCCCTGGGGAACTAAGTATGGACCATACGGCTGTTTTACAGCAAGCCACT
Nasonia_vitripennis|13712          GTGCAATCTATTCCTGGAGAATTGAGCATGGACCACACAGCAGTTTTGCAACAAACCAGT
Apis_mellifera|35646               GTACAATCTGTACCTGGTGAACTCAGTATGGACCATACTGCCGTACTACAACAAGCTAGT
Linepithema_humile|7568            GTGCAGTCGATACCTGGTGAACTCAGCATGGATCATACCGCTGTACTACGTCAGGCTAGT
Pogonomyrmex_barbatus|11378        GTACAGTCAGTACCTGGTGAACTCAGTATGGACCATACGGCAGTATTACGTCAAGCTAGC
Drosophila_grimshawi|2974          GTGCAATCCATTCCTGGCGAGCTGAGCATGGAGGAAACCAATATTTTAAGTGCAGCATCG
Drosophila_melanogaster|16877      GTTCAGTCCATTCCCGGAGAGCTGAGCATGGAGGAGACCAACATACTGAATGCCGCATCC
Anopheles_gambiae|23803            GTGCAGTCCATCCCGGGCGAGCTCAGCCTGCAGGAGACGACGGTGCTGAGTGCGGCCTCG
Culex_quinquefasciatus|14628       GTGCAGTCAATTCCGGGCGAGCTGAGCCTGCAGGAGACGTCGGTGCTGAGTGCGGCCGCC
Nematostella_vectensis|17566       GTCCAGTCAGTACCAGGGGAACTAAGCATGGATCACACAGATGCTCTCAAGCTAGCA---
Tupaia_belangeri|3892              ATTCAGTCTGTCCCAGCCGAGCTCAATATGGATCATACTGTGGTGCTGCAGCTGGCA---
Branchiostoma_floridae|704         GTGCAGTCAGTCCCAGGGGAGCTTAACATGGACCATACCACTGTACTGCAGCTAGCA---
Xenopus_tropicalis|14336           GTCCAGTCAGTTCCTGCTGAGCTAAACATGGATCACACAGTAGTCCTGCAGTTAGCA---
Gasterosteus_aculeatus|11457       GTGCAGTCGGTCCCAGCTGAGCTTAACATGGATCACACCGTGGTTCTGCAGCTGGCC---
Danio_rerio|16283                  GTGCAGTCTGTCCCAGCAGAGCTCAACATGGATCACACTGTGGTCCTTCAGCTGGCA---
Danio_rerio|1670                   GTGCAGTCTGTCCCAGCAGAGCTCAACATGGATCACACTGTGGTCCTTCAGCTGGCA---
Oryzias_latipes|10226              GTTCAGTCAGTTCCAGCAGAGCTCAATATGGATCACACTGTAGTTCTACAGCTGGCT---
Tetraodon_nigroviridis|9655        GTCCAGTCGGTACCAGCCGAGCTCAACATGGATCACACTGTGGTTCTGCAGCTGGCT---
Fugu_rubripes|27430                GTCCAGTCGGTACCAGCAGAGCTCAACATGGACCACACTGTCGTTCTGCAGCTGGCT---
Pteropus_vampyrus|11706            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---
Myotis_lucifugus|11929             ATTCAATCTGTTCCAGCTGAGCTCAATATGGATCACACTGTGGTGCTGCAGCTGGCA---
Tarsius_syrichta|10851             ATTCAGTCTGTTCCAGCTGAGCTCAATATGGATCACACTGTGGTGCTACAGCTGGCA---
Tursiops_truncatus|9958            ATTCAGTCTGTTCCAGCTGAGCTTAATATGGATCACACTGTGGTGCTGCAGCTGGCA---
Felis_catus|45384                  ATTCAGTCTGTTCCGGCTGAGCTCAATATGGACCACACGGTGGTGCTGCAGCTGGCG---
Vicugna_pacos|3506                 ------------------------------------------------------------
Callithrix_jacchus|51399           ATTCAGTCTGTTCCAGCTGAGCTCAATATGGATCACACAGTGGTGCTGCAGCTGGCA---
Anolis_carolinensis|3064           ATCCAGtctgtgccagcagaactgaacATGGATCACACTGTGGTGATACAGCTAGCT---
Gallus_gallus|12392                ATTCAGTCTGTACCAGCTGAACTGAACATGGATCACACGGTTGTCTTGCAGCTTGCA---
Rhesus_macaque|16823               ATTCAGTCTGTTCCAGCTGAGCTCAATATGGATCACACCGTGGTGCTACAGCTGGCA---
Gorilla_gorilla|26825              ATTCAGTCTGTTCCAGCTGAGCTCAATATGGATCACACCGTGGTGCTGCAGCTGGCA---
Dipodomys_ordii|7049               ATTCAGTNNNNNNNNNNNNNNNNNNATATGGATCACACTGTGGTGCTGCAGCTGGCA---
Echinops_telfairi|779              ATTCAGTCCGTTCCAGCTGAGCTCAACATGGATCATACTGTGGTGCTGCAGCTGGCA---
Cavia_porcellus|18394              ATCCAGTCCGTGCCGGCCGAGCTCAACATGGACCACACTGTGGTGCTGCAGCTGGCG---
Erinaceus_europaeus|6673           ATTCAATCCGTTCCTGCTGAGCTCAATATGGACCATACTGTGGTGTTGCAGCTGGCA---
Sorex_araneus|4958                 ATTCAGTCCGTTCCGGCCGAGCTCAGCATGGATCACACAGTAGTGCTGCAGCTGGCG---
Mus_musculus|7291                  ATCCAGTCTGTTCCCGCTGAGCTCAATATGGATCACACTGTTGTGCTGCAGCTGGCC---
Rattus_norvegicus|6806             ATTCAGTCTGTTCCAGCTGAGCTCAATATGGATCACACTGTTGTGCTGCAGCTGGCC---
Pongo_abelii|12679                 ATTCAGTCTGTTCCAGCTGAGCTCAATATGGATCACACCGTGGTGCTGCAGCTGGCA---
Dasypus_novemcinctus|961           ATTCAGTCTGTTCCAGCTGAGCTCAATATGGATCACACGGTGGTGCTGCAGCTGGCA---
Monodelphis_domestica|9676         GTCCAGTCAGTCCCTGCTGAACTCAACATGGATCATACTGTGGTATTGCAGTTGGCA---
Macropus_eugenii|16688             GTCCAGTCGGTTCCAGCTGAGCTCAACATGGATCATACTGTGGTGCTGCAGCTAGCA---
Loxodonta_africana|14985           ATTCAGTCGGTTCCAGCTGAGCTCAATATGGATCACACCGTGGTGCTGCAGCTGGCA---
Bos_taurus|10546                   ATTCAGTCTGTTCCTGCTGAGCTCAATATGGATCACACTGTGGTGCTGCAGCTGGCA---
Choloepus_hoffmanni|13800          ATTCAGTCTGTTCCAGCTGAGCTTAATATGGATCACACGGTGGTGCTGCAGCTGGCA---
Canis_familiaris|27608             ATTCAGTCTGTTCCAGCTGAGCTCAACATGGATCACACAGTGGTGCTGCAGCTGGCG---
Equus_caballus|4328                ATTCAGTCTGTTCCAGCAGAGCTCAATATGGATCACACTGTGGTGCTGCAGCTGGCG---
Otolemur_garnettii|1318            ATTCAGTCTGTTCCAGCTGAGCTCAATATGGATCACACCGTGGTGCTGCAGCTGGCA---
Oryctolagus_cuniculus|11511        ATTCAGTCTGTTCCAGCTGAACTCAACATGGATCACACCGTGGTGCTGCAGCTGGCA---
Ochotona_princeps|17626            ATTCAGTCTGTCCCAGCTGAACTCAATATGGATCACACCGTGGTGCTACAGCTGGCA---
Procavia_capensis|1120             ATTCAGTCGGTTCCAGCTGAGCTCAATATGGATCACACTGTGGTGCTGCAGTTGGCA---
Spermophilus_tridecemlineatus|4014 ATTCAGTCTGTTCCAGCTGAGCTCAATATGGATCACACTGTGGTGCTGCAGCTGGCA---
Microcebus_murinus|14305           ATTCAGTCTGTTCCAGCTGAGCTCAATATGGATCACACTGTGGTGCTGCAGCTGGCA---
Pan_troglodytes|15463              ATTCAGTCTGTTCCAGCTGAGCTCAATATGGATCACACCGTGGTGCTACAGCTGGCA---
                                                                                               

Caenorhabditis_elegans|10738       ---GAAGATGCTGCTTACGTTACAAAGGAATTGATTATTGATAAATTGAGATGGGACGAA
Daphnia_pulex|28609                ---GAAGTTCAATCATTCACTTCTGTCAAAGCATTAAAATCAACTTTGAATTGGGACGAC
Ixodes_scapularis|4074             ---AGCGCGACTGGCTACGCGTCCCTGGGCTCTCTGGTCAGGGACCTGTCTTGGGACGAG
Pediculus_humanus|5472             ACAAATGATAAAGCCTATGTATCAATCAGTAATTTACAACATGTTTTAAGGTGGGAAAAA
Bombyx_mori|8215                   GGACTTGGAACAGCGTGGGTCTCTGTTAGTGTTCTCACTAGCGACCTCGGTTGGACTGAA
Tribolium_castaneum|4505           CAGTCAAATCAGGCGTTTGTTTCCGTCAGTTATCTCAAACGGGAGCTGGGTTGGGAGGAT
Nasonia_vitripennis|13712          AATGCTGGAAATGCATTTATATCTAAATCATTATTACAAAAAGAATTGAAGTGGGAAGGT
Apis_mellifera|35646               TTATCTGGAAATGCATATGTTTCAAGATCCATGTTATGTAAAGAATTAAAATGGGAATCA
Linepithema_humile|7568            TTGTCCGCAAATGCTTACGTCTCCAAATCCATTTTGTGCAAAGAATTAAGATGGGAGGAG
Pogonomyrmex_barbatus|11378        TTATCCACAAATGCCTATGTTTCTAAGTCTATCTTGTGCAAGGAATTGAGATGGGAAGAG
Drosophila_grimshawi|2974          AATACAGAATCCGGCTGCGTTACTCAAAATCAACTCATGAACGATTTGGGCTGGACAGAA
Drosophila_melanogaster|16877      AATACCGAACAAGGCTGTGTTACGCAGAGTCAGCTGATCAAGGATTTGGGCTGGACCGAC
Anopheles_gambiae|23803            AACCAGGGACAAGGGTTCGTGACGGTCGCCTCGCTCATGAGCGATCTTGGATGGACGCAG
Culex_quinquefasciatus|14628       AACCAGGGCCAGGGATTCGTGACGAAGTCGTCGCTGATGACGGAGCTTGGCTGGAGCGAA
Nematostella_vectensis|17566       ---CAGGGTAAAGGTTTTACAAGCGTCACAGCATTAAAAAGAGACTTGGGCTGGGACGAA
Tupaia_belangeri|3892              ---GAGAAAAACGGCTTCGTGACTGTCAGTGAAATCAAAGCTAGTCTTAAATGGGAAACT
Branchiostoma_floridae|704         ---GAGGGAAGCGGGTTTGTGTCAGAATCTTCCATTGTCAACAAGCTCCGATGGGAGACA
Xenopus_tropicalis|14336           ---GAGAAAAAAGGATTTGTAACAGTAAATGAAATTAAATCAAGTTTAAATTGGGAAACC
Gasterosteus_aculeatus|11457       ---GAGAAAAAGGGCTACGTGACCGTGAGTGAGATCAAGGACAGTCTGAAGTGGGAGAAG
Danio_rerio|16283                  ---GAAAAAAAGGGTTACGTGACAGTGAGTGAAATCAGAGAGAGCCTCAAGTGGGAGAAA
Danio_rerio|1670                   ---GAAAAAAAGGGTTACGTGACAGTGAGTGAAATCAGAGAGAGCCTCAAGTGGGAGAAA
Oryzias_latipes|10226              ---GAGAAAAAAGGATATGTTACTGTTAGTGAAATCAAGGATGGTCTAAAATGGGAGAAG
Tetraodon_nigroviridis|9655        ---GAGAAAAAGGGCTACGTGACGGTGAGTGAGATCAAGAACGGTCTGAAGTGGGAGCGG
Fugu_rubripes|27430                ---GAGAAAAAGGGCTATGTGACAGTGAGCGAGATCAAGGATGGTCTGAAGTGGGAGAGG
Pteropus_vampyrus|11706            ---NNNAAAAATGGCTACGTGACTGTCAGTGATATCAAAGCCAGACTTAAATGGGAGACA
Myotis_lucifugus|11929             ---GAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|10851             ---GAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tursiops_truncatus|9958            ---GAGAAAAGTGGCTATGTGACTGTCAGTGACATCAAAGCCAGTCTTAAATGGGAGACG
Felis_catus|45384                  ---GAGAAAAGTGGCTACGTGACCGTCAGCGATATCAAAGCCAGTCTTAAATGGGAGACC
Vicugna_pacos|3506                 ---------------------------------------------------NNNNNNNNN
Callithrix_jacchus|51399           ---GAGAAAAATGGCTACGTGACTGTCAGTGAGATCAAAGCCAGTCTTAAATGGGAGACC
Anolis_carolinensis|3064           ---GAGAAAAAGGGATATGTAACTGTCAGTGAAATTAAGTCCAGTTTAAAGTGGGAGACA
Gallus_gallus|12392                ---GAGAAAAAGGGCTATGTAACAGTTGGTGAGATCAAGTCCAGTCTGAAGTGGGAGGTG
Rhesus_macaque|16823               ---GAGAAGAATGGCTACGTGACTGTCAGTGAGATCAAAGCAAGTCTTAAATGGGAGACC
Gorilla_gorilla|26825              ---GAGAAGAATGGCTACGTGACTGTCAGTGAGATCAAAGCCAGTCTTAAATGGGAGACC
Dipodomys_ordii|7049               ---GAGAAAAATGGGTACGTGACGGTCAGTGAAATCCAAGCCAGTCTTAAATGGGAGACT
Echinops_telfairi|779              ---GAGAAAAACGGCTATGTGACTGTCAGCGAAATCAAAGCCAGCCTTAAATGGGAGACC
Cavia_porcellus|18394              ---GAGAAAAACGGGTACGTGACAGTCAGTGAGATCCAGGCCAGCCTCCGGTGGGAGAAG
Erinaceus_europaeus|6673           ---GAGAAAAGCGGCTATGTGACTGTCAGTGACATCAAAGCCACTCTTAAGTGGGAGACC
Sorex_araneus|4958                 ---GAGAAAAATGGCTACGTGACTGTCAGTGATATCAAAGCCAGTCTTAAATGGGAGACA
Mus_musculus|7291                  ---GAGAAAAACGGGTATGTGACTGTCAGTGAAATCAAAACCAGTCTTAAATGGGAGACG
Rattus_norvegicus|6806             ---GAGAAAAACGGTTATGTGACTGTCAGTGAAATCAAAGCCAGTCTTAAATGGGAGACG
Pongo_abelii|12679                 ---GAGAAGAATGGCTACGTGACTGTCAGTGAGATCAAAGCCAGTCTTAATTGGGAGACC
Dasypus_novemcinctus|961           ---GAGAAAAATGGCTTCGTGACTGTCAGTGAAATCAAAACCAGTCTGAAATGGGAGACA
Monodelphis_domestica|9676         ---GAGAAAAATGGTTACGTGACAGTCAGTGAAATCAAAGCAAGTCTCAAATGGGAGACT
Macropus_eugenii|16688             ---GAGAAAAATGGTTATGTGACAGTCAGTGAGATCAAAGCAAGTCTCAAATGGGAGACA
Loxodonta_africana|14985           ---GAGAAAAACGGCTATGTGACCGTCAGTGAAATCAAAGCCAGTCTTAAATGGGAGACA
Bos_taurus|10546                   ---GAGAAAAATGGCTATGTGACTGTCAGTGCTATCAAGGCCAGTCTTAAATGGGAGACG
Choloepus_hoffmanni|13800          ---GAGAAAAATGGCTGCGTGACTGTCAGTGAAATCAAAGCCAGTCTTAAATGGGAGACA
Canis_familiaris|27608             ---GAGAAAAACGGCTACGTGACTGTCAGTGACATCAAAGCCAGTCTTAAATGGGAGACC
Equus_caballus|4328                ---GAGAAAAACGGCTACGTGACTGTCAGTGATGTCAAAGCCAGTCTTAAGTGGGAGACG
Otolemur_garnettii|1318            ---GAGAAAAATGGCTACGTGACTGTCAGCGAAATCAAAGCTAGTCTTAAATGGGAGACT
Oryctolagus_cuniculus|11511        ---GAGAAAAATGGTTACGTGACTGTAAGTGAAATCAAAGCCAGTCTTAAATGGGAGACC
Ochotona_princeps|17626            ---GAGAAAAACGGTTATGTGACTGTGAGTGAGATCAAAGCCAGTCTTAAATGGGAGACG
Procavia_capensis|1120             ---GAGAAAAACGGGTATGTGACTGTCAGTGAAATCAAAGCCAGTCTTAAATGGGAGACA
Spermophilus_tridecemlineatus|4014 ---GAGAAAAATGGGTACGTGACTGTCAGTGAAATCAAAGCCAGTCTTAAATGGGAGACG
Microcebus_murinus|14305           ---GAGAAGAATGGCTATGTGACTGTCAGTGAAATCAAAGCTAGTCTTAAATGGGAGACC
Pan_troglodytes|15463              ---GAGAAGAATGGCTACGTGACTGTCAGTGAGATCAAAGCCAGTCTTAAATGGGAGACC
                                                                                      ...      

Caenorhabditis_elegans|10738       GCCCGCGCAAGCTCTGCCTTGGAACATCTTGTGAAGGAAGGACTCGCATGGACAGATGAA
Daphnia_pulex|28609                GTTCGCTGTCTGCAAATCCTTAATGAACTTTTGCGTGATGGTGTGGCATGGGTTGACGAG
Ixodes_scapularis|4074             GACAGGGCCAGGAAGGCCCTCGAGGACCTACTCAAGGAGGGCTTGGTGTGGATCGACACC
Pediculus_humanus|5472             GAAAGAGCACAAAAGGCAGTTGATTATATGATAAAATTAGGTTTGGCATGGATCGACAAA
Bombyx_mori|8215                   ATCAGAGCCGAGAATGCTTTGAACCATATGGTGAGAGAAGGTCTCGCCTGGGTGGACTCG
Tribolium_castaneum|4505           GAGAGGGCCAGGAAAGCCCTGGACCATATGGTAGACCAAGGCCTGGCTTGGGTGGACTTG
Nasonia_vitripennis|13712          GAACGAGCACAGAAAGCATTAGACCACATGGTTAAAGAAGGATTGGCCTGGATAGATAAT
Apis_mellifera|35646               GATAGGACACAAAAAGCTTTGGACCATATGGTAAAAGAAGGATTGGCATGGTTAGATGAA
Linepithema_humile|7568            GATAGAGCGCAGAAGGCTCTGGATCACATGATGAAGGAAGGTCTGGCTTGGTTGGACGGG
Pogonomyrmex_barbatus|11378        GATAGAGCGCAGAAGGCTCTGGACTATATGATGAAGGAAGGATTAGCTTGGTTGGATAAA
Drosophila_grimshawi|2974          TATCGAACTAAGTGCGCATTGGAGAAAGTATTGGGCGAGGGCCTCTGTTGGATCGATAGA
Drosophila_melanogaster|16877      TATCGTGCTCAACAGTCACTGGACAAGGTGCTCGGCGAAGGTCTCTGTTGGATTGACAAG
Anopheles_gambiae|23803            GCGCGTGCAGAACAGGCGGTGGAGAAAATGCTCGGCGAAGGGATGGCATGGATCGATACG
Culex_quinquefasciatus|14628       CAACGCGCCAAACAGGCCGTCGATAAGATCGTTTCCGATGGGCTCGCGTGGGTGGACCAG
Nematostella_vectensis|17566       GAGCGGGCTTGTCGGGCCTTGAATCATCTTGTCCACGAGGAGCTGGCATGGGTTGATGAC
Tupaia_belangeri|3892              GAGCGAGCTCGGCAAGTGCTGGAACACCTGCTGAAGGAAGGGCTGGCCTGGCTGGACTTG
Branchiostoma_floridae|704         GAAAGGGCACAGAGAGTACTGGACCACATGGTGAAGGAAGGCCTGGCCTGGGTGGATGAC
Xenopus_tropicalis|14336           GAAAGAGCCAAACATGTTCTGGAACACTTACTAAAGGAAGGCTTGGCTTGGATAGACTCT
Gasterosteus_aculeatus|11457       GAACGAGCCTGTCACGTCTTGGACCACCTGCTGAAAGAAGGCCTGGCCTGGCTGGACTCT
Danio_rerio|16283                  GAGCGGGCCTGTCATGTTCTTGATCACCTGCTGAAAGAAGGTTTAGCGTGGCTGGACTCT
Danio_rerio|1670                   GAGCGGGCCTGTCATGTTCTTGATCACCTGCTGAAAGAAGGTTTAGCATGGCTGGACTCT
Oryzias_latipes|10226              GAAAGAGCCTGTCATGTCTTGGATCACTTGCTAAAGGAAGGCCTGGCTTGGCTTGACTCT
Tetraodon_nigroviridis|9655        GAGCGGGCCTGTCACGTCCTGGACCATCTGCTGAAGGAAGGCTTGGCTTGGCTGGACTCT
Fugu_rubripes|27430                GAACGGGCCTGTCACGTCCTGGATCATCTGCTGAAGGAAGGCCTGGCTTGGCTGGACTCT
Pteropus_vampyrus|11706            GAGCGAGCACGGCAAGTGCTGGAACACCTGCTGAAGGAAGGGCTGGCCTGGCTGGACTTG
Myotis_lucifugus|11929             NNNNNNNNNNNNNNNNNNNNNGAACACCTGCTGAAGGAAGGGCTGGCCTGGCTGGACCTG
Tarsius_syrichta|10851             NNNNNNNNNNNNNNNNNNNNNGAACACCTGCTGAAGGAAGGACTGGCCTGGCTGGATTTG
Tursiops_truncatus|9958            GAGCGAGCGCGGCAAGTGCTGGAACACCTGCTGAAGGAAGGGCTGGCTTGGCTGGACCTG
Felis_catus|45384                  GAGCGAGCGCGGCAAGTGCTGGAACACCTGCTGAAGGAAGGGCTGGCCTGGCTGGACCTG
Vicugna_pacos|3506                 NNNNNNNNNNNNNNNNNNNNNGAACACCTGCTGAAGGAAGGGCTGGCGTGGCTGGACCTG
Callithrix_jacchus|51399           GAGCGAGCGCGCCAAGTGCTGGAACACCTGCTGAAGGAAGGGCTGGCGTGGCTGGACTTG
Anolis_carolinensis|3064           GAACGAGCCAAGCAGGTGCTGGATCACCTACTGAAAGAAGGCATGGCCTGGCTTGATACC
Gallus_gallus|12392                GAACGTGCAAAGCAAATTCTGGAACACTTGCTGAAGGAAGGAATGGCCTGGCTGGATACA
Rhesus_macaque|16823               GAGCGAGCGCGGCAAGTGCTGGAACACCTGCTGAAGGAAGGGTTGGCGTGGCTGGACTTA
Gorilla_gorilla|26825              GAGCGAGCGCGGCAAGTGCTGGAACACCTGCTGAAGGAAGGGTTGGCGTGGCTGGACTTA
Dipodomys_ordii|7049               GAACGAGCGCGGCAAGTGCTGGAACACCTGCTGAAG---GGGCTGGCC---CTGGATTTG
Echinops_telfairi|779              GAGCGAGCGCGGCAAGTGCTGGAACACCTGCTCAAGGAGGGGCTGGCCTGGCTGGACTTA
Cavia_porcellus|18394              GAACGCGCACGCCAGGTGCTGGAGCACCTGCTCAAGGAGGGGCTGGCCTGGCTGGACCTG
Erinaceus_europaeus|6673           GAGCGAGCACGACAGGTGTTGGAACACCTACTGAAGGAAGGGCTGGCCTGGCTAGACCTA
Sorex_araneus|4958                 GAGCGAGCACGGCAAGTGTTGGAGCACCTGCTGAAGGAAGGGCTAGCCTGGCTGGACTTG
Mus_musculus|7291                  GAGCGAGCACGGCAAGTGCTGGAACACCTGCTGAAGGAAGGACTGGCCTGGCTGGATCTG
Rattus_norvegicus|6806             GAGCGAGCACGGCAAGTGCTGGAACACCTGCTGAAGGAAGGACTGGCCTGGCTGGATCTG
Pongo_abelii|12679                 GAGCGAGCGCGGCAAGTGCTGGAACACCTGCTGAAGGAAGGGTTGGCGTGGCTGGACTTA
Dasypus_novemcinctus|961           GAGCGAGCACGCCAAGTGCTGGAACACCTGCTGAAGGAGGGGCTGGCCTGGCTGGACTTG
Monodelphis_domestica|9676         GAGAGAGCTCGGCAGGTGCTGGAGCACCTACTGAAAGAAGGGTTGGCTTGGCTGGACCTG
Macropus_eugenii|16688             GAGAGAGCTCGGCAAGTGCTGGAGCACCTTCTGAAAGAAGGGCTGGCCTGGCTGGACTTG
Loxodonta_africana|14985           GAGCGAGCGCGGCAAGTGCTGGAGCACCTGCTGAAGGAAGGGCTGGCCTGGCTGGACTTG
Bos_taurus|10546                   GAGCGAGCGCGGCAAGTGCTGGAACACCTGCTGAAGGAAGGGCTGGCTTGGCTGGACCTG
Choloepus_hoffmanni|13800          GAGCGGGCGCGCCAAGTGCTGGAACACCTGCTGAAGGAGGGGTTAGCCTGGCTGGACCTG
Canis_familiaris|27608             GAGCGAGCCCGGCAAGTGCTGGAACACCTGCTGAAGGAAGGGCTGGCCTGGCTGGACCTG
Equus_caballus|4328                GAGCGAGCGCGGCAAGTGCTGGAACACCTGCTGAAAGAAGGGCTGGCCTGGCTGGACCTG
Otolemur_garnettii|1318            GAGCGAGCACGGCAAGTGCTGGAACACCTGCTGAAGGAAGGGCTGGTCTGGCTGGACTTA
Oryctolagus_cuniculus|11511        GAGCGTGCGCGCCAAGTGCTGGAACACCTGCTGAAGGAAGGGCTGGCCTGGCTGGACTTG
Ochotona_princeps|17626            GAGCGAGCATGCCAAGTGCTGGAACACCTGTTGAAGGAGGGGCTAGCCTGGCTGGACTTG
Procavia_capensis|1120             GAGCGAGCACGGCAAGTACTGGAGCACCTGCTAAAGGAAGGGCTGGCCTGGCTGGACCTG
Spermophilus_tridecemlineatus|4014 GAGCGGGCGCGCCAAGTGCTGGAACACCTGTTGAAGGAGGGGCTGGCCTGGCTGGACTTG
Microcebus_murinus|14305           GAGCGAGCGCGGCAAGTGCTGGAACACCTGCTGAAGGAAGGGCTGGCCTGGCTGGACTTG
Pan_troglodytes|15463              GAGCGAGCGCGGCAAGTGCTGGAACACCTGCTGAAGGAAGGGTTGGCGTGGCTGGACTTA
                                       .              . .*  *  *  *       *.  *          **    

Caenorhabditis_elegans|10738       CAGGCATCCGATACAACACAATACTGGTTCCCTTCACTTTTCCTTCAACAATAT------
Daphnia_pulex|28609                CAATCCCCCGAAAAAACG---TACTGGTTTCCTTCATTTTTCAAACCCCTCATG------
Ixodes_scapularis|4074             CAAGCGCCCGGCGAATACCTCTACTGGTTTCCGGGACTGCTCAGGCAGTCG---------
Pediculus_humanus|5472             CAAAATGTCGAAGAACCCCTGTATTGGTTTCCAAGCTTATTCGAAGGTTTAAAGACTCAC
Bombyx_mori|8215                   CAGGAACCGAAAGAGACGTTGTACTGGTTCCCTAGCATGTTT------------------
Tribolium_castaneum|4505           CAAAGCCCCAAAGAGAAATTATACTACTTTCCCAGTTTGTTCAATGCTTGTATT------
Nasonia_vitripennis|13712          CAAAATGAAGAAGAACCACTGTATTGGTTTCCAAGTTTGTTT------------------
Apis_mellifera|35646               CAAGGTGAAAATGAAATATTATATTGGTTTCCTAGTTTATTT------------------
Linepithema_humile|7568            CAGGGAGAAGACGAGACGTTATATTGGTTTCCCAGTTTATTC------------------
Pogonomyrmex_barbatus|11378        CAAGGAGAAGACGAGGTGTTATATTGGTTTCCTAGTTTATTC------------------
Drosophila_grimshawi|2974          CAAACAGATGAGGAACCAAGTTATTGGTTTCCCAGTTTATTTCCCGGTCGCAAT------
Drosophila_melanogaster|16877      CAGGCGGGCGATGAGCCAGCCTATTGGTTTCCCAGTTTGTTTCCCGGTCGAAAC------
Anopheles_gambiae|23803            CAAGGGGAGGAGAAGTCG---TACTGGTTCCCGAGTCTATTCCCGGGACGACTA------
Culex_quinquefasciatus|14628       CAGGGCGACGAGGAATCC---TACTGGTTCCCGAGTCTTTTCCCCGGTCGACAG------
Nematostella_vectensis|17566       CAGGCAGGCACAGAAAGACACTTCTGGTTCCCAACGCTCTTCCCTGACCCATTA------
Tupaia_belangeri|3892              CAGGCCCCAGGGGAGGCCCACTACTGGCTGCCAGCTCTCTTCACTGACCTCTAC------
Branchiostoma_floridae|704         CAGGCAACTGAAGGGAGACAGTACTGGTTCCCTGCACTATTCCCTGATCCTGCT------
Xenopus_tropicalis|14336           CAGGCTCAAGGTGAAGCCCAGTACTGGCTGCCAGCTCTCTTTACTGCACTTTAT------
Gasterosteus_aculeatus|11457       CAGGCCGCTGAAGAGGCGCAGTACTGGCTGCCCGCTCTCTTCGCCGAGCTGACC------
Danio_rerio|16283                  CAAGCTGCCGGGGAGCCGCAGTATTGGCTGCCTGCTCTGTTCTCAGAGCTCTTA------
Danio_rerio|1670                   CAAGCTGCCGGGGAGCCGCAGTATTGGCTGCCTGCTCTGTTCTCTGAGCTCTTA------
Oryzias_latipes|10226              CAGGCGGCTGGAGAGCCTCAATACTGGCTGCCGGCGCTCTTCTCCGAGCTTTCG------
Tetraodon_nigroviridis|9655        CAGGCCGCTGGAGAAGCTCAGTACTGGCTGCCGGCGCTCTTCTCCGAACTGACC------
Fugu_rubripes|27430                CAGGCAGCTGGAGAACCTCAGTACTGGCTGCCTGCACTCTTCTCTGAACTGACC------
Pteropus_vampyrus|11706            CAGGCCCCAGGGGAAGCCCACTACTGGCTGCCAGCTCTCTTCACTGACCTCTAC------
Myotis_lucifugus|11929             CAGGCCCCAGGCGAGGCCCACTACTGGCTGCCTGCTCTCTTCACTGACCTCTAC------
Tarsius_syrichta|10851             CAGGCCCCGGGGGAGGCCCACTACTGGCTGCCAGCTCTCTTCACTGACCTCTAC------
Tursiops_truncatus|9958            CAGGCCCCAGGGGAGGCCCACTACTGGCTGCCAGCTCTCTTCACTGACCTCTAC------
Felis_catus|45384                  CAGGCCCCCGGGGAGGCCCACTACTGGCTGCCCGCTCTTTTCACGGACCTCTAC------
Vicugna_pacos|3506                 CAGGCCCCAGGGGAGGCCCACTACTGGCTGCCAGCTCTCTTCACTGACCTCTAC------
Callithrix_jacchus|51399           CAGGCACCAGGAGAGGCCCACTACTGGCTGCCAGCTCTCTTCACTGACCTCTAC------
Anolis_carolinensis|3064           CAGGCTCCATCAGAACCTCAGTACTGGTTGCCTGCCCTCTTCACAGAGCTTTAT------
Gallus_gallus|12392                CAGGCAGCAGGAGAACCTCAGTACTGGCTGCCTGCTCTCTTTACAGAGTTGTAC------
Rhesus_macaque|16823               CAGGCCCCAGGGGAGGCCCACTACTGGCTGCCAGCTCTCTTCACTGACCTCTAC------
Gorilla_gorilla|26825              CAGGCCCCAGGGGAGGCCCACTACTGGCTGCCAGCTCTCTTCACTGACCTCTAC------
Dipodomys_ordii|7049               CAAGCCCCTGGGGAGGCCCACTACTGGCTGCCAGCTCTCTTCACAGACCTCTAT------
Echinops_telfairi|779              CAAGCCCCCGGCGAGGCCCAGTACTGGCTGCCAGCTCTCTCCACAGACCTCTGC------
Cavia_porcellus|18394              CAGGCTGCCGGCGAGGCACACTACTGGCTGCCCGCGCTCTTCACGGACCTCTAC------
Erinaceus_europaeus|6673           CAAGCCCCAGGGGAGGCCCACTACTGGTTGCCAGCTCTCTTCACTGACCTCTAC------
Sorex_araneus|4958                 CAGGCCCCAGGAGAGGCTCACTACTGGCTGCCTGCTCTCTTCACAGACCTTTAT------
Mus_musculus|7291                  CAGGCTCCAGGGGAGGCCCACTACTGGCTGCCAGCTCTTTTCACAGATCTCTAC------
Rattus_norvegicus|6806             CAGGCACCAGGGGAGGCCCACTACTGGCTGCCAGCTCTCTTCACAGATCTCTAC------
Pongo_abelii|12679                 CAGGCCCCAGGGGAGGCCCACTACTGGCTGCCAGCTCTCTTCACTGACCTCTAC------
Dasypus_novemcinctus|961           CAGGCCCCAGGGGAGGCCCACTACTGGCTGCCAGCTCTCTTCACTGACCTCTAC------
Monodelphis_domestica|9676         CAGGCTCCAGGGGAGGCACACTACTGGCTGCCAGCTCTCTTCACAGACCTATAC------
Macropus_eugenii|16688             CAGGCTCCAGGGGAAGCACACTACTGGCTGCCAGCTCTCTTCACAGACCTGTAC------
Loxodonta_africana|14985           CAGGCCCCTGGGGAGGCACACTACTGGCTGCCAGCTCTCTTCACTGATCTCTAC------
Bos_taurus|10546                   CAGGCCCCAGGGGAGGCCCACTACTGGCTGCCAGCTCTTTTCACTGACCTCTAC------
Choloepus_hoffmanni|13800          CAGGCCCCAGGGGAGGCCCACTACTGGCTGCCAGCGCTCTTCACTGACCTCTAC------
Canis_familiaris|27608             CAGGCCCCAGGGGAGGCCCACTACTGGCTGCCAGCTCTCTTCACTGACCTCTAC------
Equus_caballus|4328                CAGGCCCCAGGCGAGGCCCACTACTGGCTGCCCGCTCTCTTCACCGACCTCTAC------
Otolemur_garnettii|1318            CAGGCC---GGAGAGGCC---TACTGGCTG---GCTCTCTTCACTGAC---TAC------
Oryctolagus_cuniculus|11511        CAGGCCCCAGGAGAGGCCCACTACTGGCTGCCAGCTCTCTTCACTGACCTCTAC------
Ochotona_princeps|17626            CAGGCCCCAGGGGAGGCCCACTACTGGCTGCCTGCTCTCTTCACCGACCTCTAC------
Procavia_capensis|1120             CAGGCCCCTGGGGAAGCCCACTACTGGCTGCCAGCTCTCTTCACTGACCTCTAC------
Spermophilus_tridecemlineatus|4014 CAGGCCCCAGGGGAGGCCCACTACTGGCTGCCAGCTCTCTTCACTGACCTCTAC------
Microcebus_murinus|14305           CAGGCCCCAGGGGAGGCCCACTACTGGCTGCCAGCTCTCTTCACCGACCTCTAC------
Pan_troglodytes|15463              CAGGCCCCAGGGGAGGCCCACTACTGGCTGCCAGCTCTCTTCACTGACCTCTAC------
                                   **.         . .      *: *.  *        *                      

Caenorhabditis_elegans|10738       TGTCATTCGTCATCAAGCACTTCAGTTTCCGAATCTTTACACAGCATGAGCTTTAACAAT
Daphnia_pulex|28609                AGTGAGGATGAGATTGTTTTGCCGCCTCCTAAT---------------------------
Ixodes_scapularis|4074             ------------------------------------------------------------
Pediculus_humanus|5472             ACAACAGCAACAACAGCAACCGAAACTTTAAAAAACATTTTAATAATAAAAAGAAATCTG
Bombyx_mori|8215                   GCAGAATGCGTATCAGCA------------------------------------------
Tribolium_castaneum|4505           GACTCCACAATCAGC---------------------------------------------
Nasonia_vitripennis|13712          ACAGCTTGCATTGCTTCAAAAACA------------------------------------
Apis_mellifera|35646               ACAGCTTGCATTGTATCCAAAGAG------------------------------------
Linepithema_humile|7568            ACAGCTTGCATCGTTTCCAAAGAA------------------------------------
Pogonomyrmex_barbatus|11378        ACAGCGTGCATTGTTTCCAAAGAA------------------------------------
Drosophila_grimshawi|2974          GCGCAGCTTGTTGCTGCA------------------------------------------
Drosophila_melanogaster|16877      GCACAGACAACGGCCGCCACA---------------------------------------
Anopheles_gambiae|23803            ACAGCCAAAGTT------------------------------------------------
Culex_quinquefasciatus|14628       ------------------------------------------------------------
Nematostella_vectensis|17566       AACGAGTCT---------------------------------------------------
Tupaia_belangeri|3892              TCTGAGGAGATCACAGCTGAGGAGGCCAGAGAAGCCCTCCCC------------------
Branchiostoma_floridae|704         GGA---------------------------------------------------------
Xenopus_tropicalis|14336           GCCCAACAAATTAATATGGACGAGAACGGAGGACCTTCT---------------------
Gasterosteus_aculeatus|11457       TCCCGTGACGTCACACCGGAGGAGGCCAATCAGATGACACCT------------------
Danio_rerio|16283                  TCACAAGACGTTACACCTGAAGAGGCCAATCAAATGACACCT------------------
Danio_rerio|1670                   TCACAAGACGTTACACCTGAAGAGGCCAATCAAATGACACCT------------------
Oryzias_latipes|10226              TCTCGTGACGTCACACCAGAGGAGGCCAACCAGATGACACCT------------------
Tetraodon_nigroviridis|9655        TCCCGTGACGTCAGCCCGGAAGAAGCCAATCAGATGACACCT------------------
Fugu_rubripes|27430                TCCCGAGATGTCAGCCCAGAAGAAGCCAATCAGATGACACCT------------------
Pteropus_vampyrus|11706            TCCCAGGAGATTACAGCTGAGGAGGCCAGAGAGGCCCTCCCC------------------
Myotis_lucifugus|11929             TCCCAGGAGATTACAGCTGAGGAGGCCAGAGAAGCCCTCCCT------------------
Tarsius_syrichta|10851             TCCCAGGAGATTACTGCTGAGGAGGCCAGAGAAGCCCTCCCC------------------
Tursiops_truncatus|9958            TCCCAGGAGATTACAGCTGAGGAGGCCAGAGAAGCCCTCCCC------------------
Felis_catus|45384                  TCCCAGGAGATTACAGCCGAGGAGGCCAGAGAAGCCCTCCCC------------------
Vicugna_pacos|3506                 TCCCAGGAGATTACAGCTGAGGAGGCCAGAGAAGCCCTCCCC------------------
Callithrix_jacchus|51399           TCCCAGGAGATTACAGCTGAGGAGGCCAGAGAAGCCCTTCCC------------------
Anolis_carolinensis|3064           TCTCAAGAAATCACTCCAGAAGAAGCCAAGGAAGCTTTACCT------------------
Gallus_gallus|12392                TCTCAGGAAATCACTCCAGAGGAAGCCAAGGAGGCAATACCT------------------
Rhesus_macaque|16823               TCCCAGGAGATTACAGCTGAAGAGGCCAGAGAAGCCCTCCCC------------------
Gorilla_gorilla|26825              TCCCAGGAGATTACAGCTGAGGAGGCCAGAGAAGCCCTCCCC------------------
Dipodomys_ordii|7049               TCCCAGGAGATTACTGCAGAGGAG---AGAGAAGCCCTCCCT------------------
Echinops_telfairi|779              TCCCAGGAGATTACCACTGAGGAGGCCAGAGAAGCCCTCCCC------------------
Cavia_porcellus|18394              TCGCAGGAGATCACGGCCGAGGAGGCCCGCGAGGCGCTGCCC------------------
Erinaceus_europaeus|6673           TCCCAGGAGATAACAGCCGATGAGGCCAGAGAAGCTCTTCCC------------------
Sorex_araneus|4958                 TCCCAGGACATCACAGCTGACGAGGCCCGAGAAGCCGCCCCC------------------
Mus_musculus|7291                  TCCCAGGAGATATCAGCTGAGGAGGCCAAAGAAGCCTTCCCT------------------
Rattus_norvegicus|6806             TCCCAGGAGATATCAGCTGAGGAGGCCAAAGAAGTCTTTCCT------------------
Pongo_abelii|12679                 TCCCAGGAGATTACAGCTGAGGAGGCCAGAGAAAGCCCTCCC------------------
Dasypus_novemcinctus|961           TCCCAGGAGATTACAGCTGAGGAGGCTAGAGAAGCCCTCCCC------------------
Monodelphis_domestica|9676         TCCCAGGAGATCACAGCTGAGGAGGCCAGGGAGGCCCTCCCC------------------
Macropus_eugenii|16688             TCCCAGGAAATCACAGCTGAGGAAGCCAGGGAGGCCCTCCCC------------------
Loxodonta_africana|14985           TCCCAGGAGGTTACAGCTGAGGAGGCCAGAGAAGCCCTCCCT------------------
Bos_taurus|10546                   TCCCAGGAGATTACAGCAGAGGAGGCCAGAGAAGCGCTCCCT------------------
Choloepus_hoffmanni|13800          TCCCAGGAGATTACAGCTGAGGAGGCCAGAGAAGCTCTCTCC------------------
Canis_familiaris|27608             TCCCAGGAGATTACGGCTGAGGAGGCCAGAGAAGCCCTCCCT------------------
Equus_caballus|4328                TCCCAGGAGATCACCGCTGAGGAGGCCAGAGAAGCCCTCCCC------------------
Otolemur_garnettii|1318            TCCCAGGAGATTACAGCTGAGGAGGCCAGAGAAGCCCTCCCC------------------
Oryctolagus_cuniculus|11511        TCCCAGGAAATCACAGCTGAGGAGGCCAGAGAAGCCCTCCCC------------------
Ochotona_princeps|17626            TCCCAGGAGATTACAGCTGAGGAGGCCAGAGAAGCCCTCCCC------------------
Procavia_capensis|1120             TCCCAGGAAATCACCGCTGAGGAGGCCAGAGAAGCCCTCCCC------------------
Spermophilus_tridecemlineatus|4014 TCACAGGAGATAACAGCTGAGGAGGCCAGAGAAGCCCTTCCC------------------
Microcebus_murinus|14305           TCCCAGGAGATCACAGCTGAAGAGGCCAGAGAAGCCCTCCCC------------------
Pan_troglodytes|15463              TCCCAGGAGATTACAGCTGAGGAGGCCAGAGAAGCCCTCCCC------------------
                                                                                               

Caenorhabditis_elegans|10738       TATCAG---TGA
Daphnia_pulex|28609                ---------TGA
Ixodes_scapularis|4074             ---------TAG
Pediculus_humanus|5472             ATGAACCGGTAA
Bombyx_mori|8215                   ---------TGA
Tribolium_castaneum|4505           ---------TAA
Nasonia_vitripennis|13712          ------------
Apis_mellifera|35646               ---------TAA
Linepithema_humile|7568            ---------TAA
Pogonomyrmex_barbatus|11378        ---------TAG
Drosophila_grimshawi|2974          ---------TAG
Drosophila_melanogaster|16877      ---------TAG
Anopheles_gambiae|23803            ---------TG-
Culex_quinquefasciatus|14628       ---------TGA
Nematostella_vectensis|17566       ---------TAG
Tupaia_belangeri|3892              ---------TGA
Branchiostoma_floridae|704         ---------TAG
Xenopus_tropicalis|14336           ---------TGA
Gasterosteus_aculeatus|11457       ---------TGA
Danio_rerio|16283                  ---------TAA
Danio_rerio|1670                   ---------TAA
Oryzias_latipes|10226              ---------TGA
Tetraodon_nigroviridis|9655        ------------
Fugu_rubripes|27430                ---------TAA
Pteropus_vampyrus|11706            ---------TGA
Myotis_lucifugus|11929             ---------TGA
Tarsius_syrichta|10851             ---------TAG
Tursiops_truncatus|9958            ---------TGA
Felis_catus|45384                  ---------TGA
Vicugna_pacos|3506                 ---------TGA
Callithrix_jacchus|51399           ---------TGA
Anolis_carolinensis|3064           ---------TGA
Gallus_gallus|12392                ---------TGA
Rhesus_macaque|16823               ---------TGA
Gorilla_gorilla|26825              ---------TGA
Dipodomys_ordii|7049               ---------TGA
Echinops_telfairi|779              ---------TGA
Cavia_porcellus|18394              ---------TGA
Erinaceus_europaeus|6673           ---------TGA
Sorex_araneus|4958                 ---------TGA
Mus_musculus|7291                  ---------TGA
Rattus_norvegicus|6806             ---------TGA
Pongo_abelii|12679                 ------------
Dasypus_novemcinctus|961           ---------TGA
Monodelphis_domestica|9676         ---------TGA
Macropus_eugenii|16688             ---------TGA
Loxodonta_africana|14985           ---------TGA
Bos_taurus|10546                   ---------TGA
Choloepus_hoffmanni|13800          ---------TGA
Canis_familiaris|27608             ---------TGA
Equus_caballus|4328                ---------TGA
Otolemur_garnettii|1318            ---------TGA
Oryctolagus_cuniculus|11511        ---------TGA
Ochotona_princeps|17626            ---------TGA
Procavia_capensis|1120             ---------TGA
Spermophilus_tridecemlineatus|4014 ---------TGA
Microcebus_murinus|14305           ---------TGA
Pan_troglodytes|15463              ---------TGA
                                               

multiple sequence alignment in CLUSTALW format


Caenorhabditis_elegans|9688        MATRRRIGVAAIQKKQETAN-KFAAKGDQMAGEQLVQFSQQLEQLSAGLEMFAQRHRDEI
Daphnia_pulex|11772                --MRKRPGIGAIHKQRVEQE-RFRGKATELQDNVFEQMTNQMEKFRTNLETFASKHRNEI
Ixodes_scapularis|4093             -MRRRVGGVGAIQKQQLTQA-RFKDKGSELAEEQLQQMTRQMDAFRTKLQAFASKHKNEI
Pediculus_humanus|5361             --MRRRAGIAAIQKKNLEQE-KYRDKGTEIQENQLEQMTKQMEVFRVNLEEFARKHKNDI
Bombyx_mori|9397                   --MRRRAGVGAIQKHRLEQE-KYKEKGTEIQENQFQQMSKQLEVFRENLEDFASKHKSEI
Tribolium_castaneum|7305           --MRRRAGLGAIQKHKLEQE-KYKDKGSEIQENLFEQMTKQLGVLEENLEEFATKHKNKI
Nasonia_vitripennis|3656           --MRRKPGVGAIHKQKYEQE-RYRDKGTELQENQFEQMTKQLETFRINLEEFASKHKNEI
Apis_mellifera|4731                --MRRKAGVGAIQKQKLEQE-KYKDKGTEIQENQFEQMTKQMETFRVNLEEFATKYKNEI
Linepithema_humile|7653            --MRRKAGVGAIHKQKLEQE-KYRDKGTEIQENQFEQMTKHMETFRVNLEEFASKHKNEI
Pogonomyrmex_barbatus|3826         --MRRKAGVGAIQKQKLEQE-KYRDKGTEIQENQFEQMTKHMETFRVNLEEFASKHKNEI
Drosophila_grimshawi|6162          --MRRRVGLGAIQQQKLAAE-KYKDKGADIQESQLEQMTKQMDVFRIKLEEFAMKHKDDI
Drosophila_melanogaster|15505      --MRRRVGLGAIQQQKLAAE-KYKDKGTDLQENQLEQMTKQMEVFRVKLEEFAMKHKEDI
Anopheles_gambiae|615              --MRRRAGVGAIQKQRLEAE-KYKDKGTELQESQFEQMVKQMEALKENLEEFASKHRSEI
Culex_quinquefasciatus|8330        --MRRRAGVGAIQKQKLDAE-RYRDKGTELQDSQFEQMVRQMEVLKEGLEEFAAKHKAEI
Nematostella_vectensis|15411       -MRRGPGGVGAINKHRLAKA-KYAEKGTEIADIQLSQMGKQLDSFKNYLEDFASKHKSDI
Tupaia_belangeri|3386              -MXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXMSKQLDMFKTNLEEFASKHKQEI
Branchiostoma_floridae|6107        -MRRRGVGAGAIAKKKLAEA-RYKDRGTEIAADQLAQMSKQLETFQKHLEEFATKHKDDI
Xenopus_tropicalis|5428            ------------------------------------------------------------
Gasterosteus_aculeatus|5016        -----TPGGGMTKYFPLQPA-KYKERGNVLAEDQIVQMSKQLETFKSNLEEFASKHKQEI
Danio_rerio|2657                   -MHRRGVGAGAIAKKKLAEA-KYKERGSVLAEDQIAQMSKQLDTFKTHLEEFASKHKQEI
Danio_rerio|25263                  -MHRRGVGAGAIAKKKLAEA-KYKERGSVLAEDQIAQMSKQLDTFKTHLEEFASKHKQEI
Oryzias_latipes|14698              -KMRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQIVQMSKQLETFKSNLEEFASKHKQEI
Tetraodon_nigroviridis|7654        -MHRRGVGAGAIAKKKLAEATKYKERGTVIAEDQIAQMSKQLETFKSNLEEFASKHKQEI
Fugu_rubripes|29863                -MHRRGVGAGAIAKKKLAEA-KYKERGTVIAEDQIAQMSKQLETFKSNLEEFASKHKQEI
Pteropus_vampyrus|11032            -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Myotis_lucifugus|10723             -MHRRGVGAGAIA------A-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Tarsius_syrichta|9946              -------------------------------------MSKQLDMFKTNLEEFASKHKQEI
Tursiops_truncatus|9412            -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQXXXXXXXXXXXXXXXXXXXXXXX
Felis_catus|11449                  -MHRRGVGAGAIAXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Vicugna_pacos|3268                 -MLRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Callithrix_jacchus|42398           -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Anolis_carolinensis|6090           -MHHRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Gallus_gallus|3847                 -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Rhesus_macaque|23500               -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Gorilla_gorilla|20878              -MHRRGVGAGAIAKKKLAEV-SRKKADPQPAPDSIQQMSKQLDMFKTNLEEFASKHKQEI
Dipodomys_ordii|6612               -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Echinops_telfairi|614              -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Cavia_porcellus|14457              -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLNQMSKQLDMFKTNLEEFASKHKQEI
Erinaceus_europaeus|5504           -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQXXXXXXXXXXXXXXXXXXXXXXX
Sorex_araneus|4418                 -------------------A-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Mus_musculus|3529                  -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Rattus_norvegicus|18789            -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Pongo_abelii|6700                  -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Dasypus_novemcinctus|839           -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMS-QLDMFKTNLEEFHSKYKQLL
Monodelphis_domestica|17790        -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Macropus_eugenii|15207             -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Loxodonta_africana|13695           -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Bos_taurus|23176                   -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Choloepus_hoffmanni|12179          -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Canis_familiaris|17902             -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Equus_caballus|19548               -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Otolemur_garnettii|1133            -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Oryctolagus_cuniculus|20782        -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Ochotona_princeps|15363            -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Procavia_capensis|1047             -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Spermophilus_tridecemlineatus|3609 -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Microcebus_murinus|12130           -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEI
Pan_troglodytes|9675               -MHRRGVGAGAIAKKKLAEA-KYKERGTVLAEDQLAQ-----------------------
                                                                                               

Caenorhabditis_elegans|9688        KKNSQFRRHFQEMCASVGVDPLASSK-GFWAKALGFGDFYYELGIQIVEICLSTTHINGG
Daphnia_pulex|11772                KKNPAFRKQFQDMCASIGVDPLASSK-GFWSELLGVGDFYYEIAVQVIEVCLATSPRNGG
Ixodes_scapularis|4093             RKNPHFRRQFQEMCATAGVDPLASSK-GFWADMLGVGDFYYELGVQVVEVCLATSHRNGG
Pediculus_humanus|5361             KSNPQFRKQFQDMCAAIGVDPLTSVK-GFWS-VLGIGDFYYELAVQIIEVCLATSSRNGG
Bombyx_mori|9397                   KKNAQFRRQFQEMCAAIGVDPLASGK-GFWS-VLGIGDFYYELGVQIVEVCLATNYKNGG
Tribolium_castaneum|7305           RKNPEFRRQFQEMCASIGVDPLSSGKQGFWS-VLGIGDFYYELAVQIVEVCLATNYKTGG
Nasonia_vitripennis|3656           KKNAQFRRQFTEMCASIGVDPLASGK-GFWS-VLGIGDFYYELAVQIVEVCLATNYKNGG
Apis_mellifera|4731                KKNARFRRQFTEMCASIGVDPLASGK-GFWS-VLGIGDFYYELAVQIVEVCMATNYKNGG
Linepithema_humile|7653            KKNARFRRQFTEMCASIGVDPLASGK-GFWS-VLGIGDFYYELAVQIVEVCMATNYKNGG
Pogonomyrmex_barbatus|3826         KKNAHFRRQFTEMCASIGVDPLASGK-GFWS-VLGIGDFYYELAVQIVEVCMATNYKNGG
Drosophila_grimshawi|6162          RKNSQFRKQFQEMCAAIGVDPLATGK-GFWS-VLGMGDFYYELSVQVVDVCLAANHKTGG
Drosophila_melanogaster|15505      RKNSQFRKQFQEMCAAIGVDPLATGK-GFWS-VLGMGDFYYELGVQVVEVCLAANHKTGG
Anopheles_gambiae|615              KKNPQFRRQFQEMCAAIGVDPLASAK-GFWS-VLGMGDFFYELSVQVVEVCLAHNHITGG
Culex_quinquefasciatus|8330        RKNAQFRRQFQEMCAAIGVDPLASGK-GFWS-VLGMGDFYYELGVQVVEVCLAANHSTGG
Nematostella_vectensis|15411       KKNPEFRGHFQKMCARIGVDPLASSK-GFWAELLGVGDFYYELGVQIVEICMAMRPKNGG
Tupaia_belangeri|3386              RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELXXXXXXXXXXXXXXXXX
Branchiostoma_floridae|6107        RRNAEFRRQFQEMCAAVGVDPLASGK-GFWSEMLGIGDFYYELGVQIVEVCLATKPRNGG
Xenopus_tropicalis|5428            -----------------------AGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHHNGG
Gasterosteus_aculeatus|5016        RKNSQFRVQFQEMCSTIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Danio_rerio|2657                   RKSSQFRVQFQEMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Danio_rerio|25263                  RKSSQFRVQFQEMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Oryzias_latipes|14698              RKNSQFRVQFQEMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Tetraodon_nigroviridis|7654        RKNPQFRVQFQEMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Fugu_rubripes|29863                RKNSQFRVQFQEMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Pteropus_vampyrus|11032            RKNPEFRVQFQDMCATIGVDPLAXXX-XXXXXXXXXXXXYYELGVQIIEVCLALKHRNGG
Myotis_lucifugus|10723             RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELVFQINEVCLGLKRN--G
Tarsius_syrichta|9946              RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Tursiops_truncatus|9412            XXXXXXXXXXXXXXXXXXXXXXXXGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGX
Felis_catus|11449                  XXXXXXXXXXXXXXXXXXXXXXXXGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Vicugna_pacos|3268                 RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Callithrix_jacchus|42398           RKNPEFRVQFQDMCATIGVDPLASFS-LFFKKMF---NFYYELGVQIIEVCLALKHRNGE
Anolis_carolinensis|6090           RKNPQFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Gallus_gallus|3847                 RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Rhesus_macaque|23500               RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Gorilla_gorilla|20878              RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Dipodomys_ordii|6612               RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Echinops_telfairi|614              RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQMIEVCLALKHRNGG
Cavia_porcellus|14457              RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALRHRKGG
Erinaceus_europaeus|5504           XXXXXXXVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Sorex_araneus|4418                 RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Mus_musculus|3529                  RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Rattus_norvegicus|18789            RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Pongo_abelii|6700                  RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Dasypus_novemcinctus|839           QKNLKFQVQFQDMYATI-VD-LASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Monodelphis_domestica|17790        RKNPQFRLQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Macropus_eugenii|15207             RKNPQFRLQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Loxodonta_africana|13695           RKNPEFRVQFQDMCATIGVDPLKAGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Bos_taurus|23176                   RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Choloepus_hoffmanni|12179          RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Canis_familiaris|17902             RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Equus_caballus|19548               RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Otolemur_garnettii|1133            RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Oryctolagus_cuniculus|20782        RKNPEFRVQFQDMCATIGVDPLASGK-GFWSQMLGVGDFYYELGVQIIEVCLALKHRNGG
Ochotona_princeps|15363            RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Procavia_capensis|1047             RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Spermophilus_tridecemlineatus|3609 RKNPEFRVQFQDMCANIGVDLLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Microcebus_murinus|12130           RKNPEFRVQFQDMCATIGVDPLASGK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
Pan_troglodytes|9675               ------------------------GK-GFWSEMLGVGDFYYELGVQIIEVCLALKHRNGG
                                                                          :**:                 

Caenorhabditis_elegans|9688        IM-TVEEIRNRLMRTRSR-TRKDTISTDDILRAVDKLKVLGNGFELVPLGGGR-----FL
Daphnia_pulex|11772                LI-TLGELRQRLIKARGKAQHHQDISNDDIIRAIKKLKVLGPGFSIVSLK-GTQDTSDIL
Ixodes_scapularis|4093             LM-SLEELRDRVARSRGSLARQEEISQDDLLRAIEKLGTLGKGFRLIAVG-AR-----YL
Pediculus_humanus|5361             LI-GLEELRRRLIKARGKRKEHQEITVDDLLRAAKKLKVFGSGFSVIPISKGQ-----YL
Bombyx_mori|9397                   LI-TLEELRSRLIASRGRAKKHQDITNEDLLAAVKKLRIFGNGFTVVPISKGK-----WL
Tribolium_castaneum|7305           LI-SLDELRTRLIKARGKGKQHQEITQDDLIRAAQKLKILGSGFMVVPVGKGQ-----YM
Nasonia_vitripennis|3656           LI-SLDELRDRLVRARGRRQEHQEITNEDLLASAKKLKILGNGFSVVPISKGK-----YL
Apis_mellifera|4731                LI-SLDELRARLIQARGRRKEHQEITNEDLLAAAKKLKIFGNGFSIVPIGRGK-----HL
Linepithema_humile|7653            LI-SLDELRTRLIQARGRRKEHQEITNEDLLAAAKKLKIFGNGFSVVPIGRGR-----HL
Pogonomyrmex_barbatus|3826         LI-SLDELRTRLIQARGRRKEHQEITNEDLLAAAKKLRIFGNGFSVVPIGRGK-----HL
Drosophila_grimshawi|6162          LM-ELDELRRRLIAARGQSPMHQEITKEDILMATKKLNIFGNGFVVHKLGKGK-----YI
Drosophila_melanogaster|15505      LM-ELDDLRRRLIAARGQSSVHQEITKEDILMAAKKLSIFGNGFVVHKLGKGK-----YI
Anopheles_gambiae|615              LM-DLDELRNRLVAARGKSQTHQEITTEDILMATKKLKIFGNGFTVYSVGKNR-----HM
Culex_quinquefasciatus|8330        LM-ELEELRNRLVAARGRKQIHQEITNEDILMATKKLNIFGNGFTVYPVGKGR-----HM
Nematostella_vectensis|15411       LM-TLDSLHKAILKSSKA---RQDVTEDDLERAIKKLHALGSGFQVIVAG-NR-----RL
Tupaia_belangeri|3386              XX-XXXXXXXXXXXXXXX--XXXXXXXDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
Branchiostoma_floridae|6107        KR------------------------GDDLLRAIKKLKVLGSGFTAIPVGGGR-----YL
Xenopus_tropicalis|5428            LI-TLAELHQHVLKGRGK--LAQDVSQDDIIRAIKKLKVLGNGFGIIPVG-GS-----YL
Gasterosteus_aculeatus|5016        LI-TLDELHHRVLK-------TLNACRDDLMRAIKKLKVMGNGFGMIPVG-GS-----YL
Danio_rerio|2657                   LI-TLDELHHRVLKGRGK--FAQDVSQDDLVRAIKKLKAMGNGFGMIPVG-GT-----YL
Danio_rerio|25263                  LI-TLDELHHRVLKGRGK--FAQDVSQDDLVRAIKKLKAMGNGFGMIPVG-GT-----YL
Oryzias_latipes|14698              LI-TLDELHQRVLKGRGK--YAQDVSQDDLVRAIKKLKAMGSGFGMIPVG-GS-----YL
Tetraodon_nigroviridis|7654        LI-TLDELHHRVLKGRGK--YAQDVSQDDLMRAIKKLKVMGSGFGMIPVG-GS-----YL
Fugu_rubripes|29863                LI-TLDELHHRVLKGRGK--YAQDVSQDDLMRAIKKLKVMGNGFGMIPVG-GS-----YL
Pteropus_vampyrus|11032            LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTXXXXXXXX-XX-----XX
Myotis_lucifugus|10723             LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFGIIPVS-GT-----YL
Tarsius_syrichta|9946              LI-TLEELQHEVLKGKGK--FAQDVSQDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
Tursiops_truncatus|9412            XX-XXXXXXXXXXXXXXX--XXXXXXXDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
Felis_catus|11449                  LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
Vicugna_pacos|3268                 LI-TLEELHQQVLKGRGK--FAQDVSQDXXXXXXXXXXXXXXX-----------------
Callithrix_jacchus|42398           QK-ITSHTHCKLFSGRGP-CLFTDVVEDDLIRAIKKLKALGTGFCIIPVG-GT-----YL
Anolis_carolinensis|6090           LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKVLGNGFGILPVG-GT-----YL
Gallus_gallus|3847                 LI-TLEELHQQVLKGRGK--FAQEVSQDDLLRAIKKLKVLGSGFGIIPVG-GT-----YL
Rhesus_macaque|23500               EVESMASLHGQGLELLGS--TTLPHLRDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
Gorilla_gorilla|20878              LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
Dipodomys_ordii|6612               LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRI--KLKALGTGFGIIPVG-GT-----YL
Echinops_telfairi|614              LI-TLEELHQQVLNGRGR--FAQDVSQDDLIRAIKKLKVLGSGFGIIPMG-GT-----YL
Cavia_porcellus|14457              LI-MLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
Erinaceus_europaeus|5504           LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFSIIPVG-GT-----YL
Sorex_araneus|4418                 LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFSIIPVG-GT-----YL
Mus_musculus|3529                  LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
Rattus_norvegicus|18789            LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
Pongo_abelii|6700                  LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
Dasypus_novemcinctus|839           LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
Monodelphis_domestica|17790        LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFSIIPVG-GT-----YL
Macropus_eugenii|15207             LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFSIIPVG-GT-----YL
Loxodonta_africana|13695           LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFSIIPVG-GT-----YL
Bos_taurus|23176                   LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFSIIPVG-GT-----YL
Choloepus_hoffmanni|12179          LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
Canis_familiaris|17902             LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
Equus_caballus|19548               LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
Otolemur_garnettii|1133            LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
Oryctolagus_cuniculus|20782        LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
Ochotona_princeps|15363            LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
Procavia_capensis|1047             LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKVLGTGFGIIPVG-GT-----YL
Spermophilus_tridecemlineatus|3609 LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
Microcebus_murinus|12130           LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
Pan_troglodytes|9675               LI-TLEELHQQVLKGRGK--FAQDVSQDDLIRAIKKLKALGTGFGIIPVG-GT-----YL
                                                              :                                

Caenorhabditis_elegans|9688        VQSVPGELSMDHSRVLQLA--EDAAYVTKELIIDKLRWDEARASSALEHLVKEGLAWTDE
Daphnia_pulex|11772                IRSIPGELSADHTEVLKAA--EVQSFTSVKALKSTLNWDDVRCLQILNELLRDGVAWVDE
Ixodes_scapularis|4093             VQSVPTELSLDHTTLIRQA--SATGYASLGSLVRDLSWDEDRARKALEDLLKEGLVWIDT
Pediculus_humanus|5361             VQSVPGELSMDHTAVLHAASTNDKAYVSISNLQHVLRWEKERAQKAVDYMIKLGLAWIDK
Bombyx_mori|9397                   VQSVPGELNMDQTLVLQKASGLGTAWVSVSVLTSDLGWTEIRAENALNHMVREGLAWVDS
Tribolium_castaneum|7305           VQSIPGELSMDHTAVLQQATQSNQAFVSVSYLKRELGWEDERARKALDHMVDQGLAWVDL
Nasonia_vitripennis|3656           VQSIPGELSMDHTAVLQQTSNAGNAFISKSLLQKELKWEGERAQKALDHMVKEGLAWIDN
Apis_mellifera|4731                VQSVPGELSMDHTAVLQQASLSGNAYVSRSMLCKELKWESDRTQKALDHMVKEGLAWLDE
Linepithema_humile|7653            VQSIPGELSMDHTAVLRQASLSANAYVSKSILCKELRWEEDRAQKALDHMMKEGLAWLDG
Pogonomyrmex_barbatus|3826         VQSVPGELSMDHTAVLRQASLSTNAYVSKSILCKELRWEEDRAQKALDYMMKEGLAWLDK
Drosophila_grimshawi|6162          VQSIPGELSMEETNILSAASNTESGCVTQNQLMNDLGWTEYRTKCALEKVLGEGLCWIDR
Drosophila_melanogaster|15505      VQSIPGELSMEETNILNAASNTEQGCVTQSQLIKDLGWTDYRAQQSLDKVLGEGLCWIDK
Anopheles_gambiae|615              VQSIPGELSLQETTVLSAASNQGQGFVTVASLMSDLGWTQARAEQAVEKMLGEGMAWIDT
Culex_quinquefasciatus|8330        VQSIPGELSLQETSVLSAAANQGQGFVTKSSLMTELGWSEQRAKQAVDKIVSDGLAWVDQ
Nematostella_vectensis|15411       VQSVPGELSMDHTDALKLA--QGKGFTSVTALKRDLGWDEERACRALNHLVHEELAWVDD
Tupaia_belangeri|3386              IQSVPAELNMDHTVVLQLA--EKNGFVTVSEIKASLKWETERARQVLEHLLKEGLAWLDL
Branchiostoma_floridae|6107        VQSVPGELNMDHTTVLQLA--EGSGFVSESSIVNKLRWETERAQRVLDHMVKEGLAWVDD
Xenopus_tropicalis|5428            VQSVPAELNMDHTVVLQLA--EKKGFVTVNEIKSSLNWETERAKHVLEHLLKEGLAWIDS
Gasterosteus_aculeatus|5016        VQSVPAELNMDHTVVLQLA--EKKGYVTVSEIKDSLKWEKERACHVLDHLLKEGLAWLDS
Danio_rerio|2657                   VQSVPAELNMDHTVVLQLA--EKKGYVTVSEIRESLKWEKERACHVLDHLLKEGLAWLDS
Danio_rerio|25263                  VQSVPAELNMDHTVVLQLA--EKKGYVTVSEIRESLKWEKERACHVLDHLLKEGLAWLDS
Oryzias_latipes|14698              VQSVPAELNMDHTVVLQLA--EKKGYVTVSEIKDGLKWEKERACHVLDHLLKEGLAWLDS
Tetraodon_nigroviridis|7654        VQSVPAELNMDHTVVLQLA--EKKGYVTVSEIKNGLKWERERACHVLDHLLKEGLAWLDS
Fugu_rubripes|29863                VQSVPAELNMDHTVVLQLA--EKKGYVTVSEIKDGLKWERERACHVLDHLLKEGLAWLDS
Pteropus_vampyrus|11032            XXXXXXXXXXXXXXXXXXX--XKNGYVTVSDIKARLKWETERARQVLEHLLKEGLAWLDL
Myotis_lucifugus|10723             IQSVPAELNMDHTVVLQLA--EXXXXXXXXXXXXXXXXXXXXXXXXXEHLLKEGLAWLDL
Tarsius_syrichta|9946              IQSVPAELNMDHTVVLQLA--EXXXXXXXXXXXXXXXXXXXXXXXXXEHLLKEGLAWLDL
Tursiops_truncatus|9412            IQSVPAELNMDHTVVLQLA--EKSGYVTVSDIKASLKWETERARQVLEHLLKEGLAWLDL
Felis_catus|11449                  IQSVPAELNMDHTVVLQLA--EKSGYVTVSDIKASLKWETERARQVLEHLLKEGLAWLDL
Vicugna_pacos|3268                 -------------------------------------XXXXXXXXXXEHLLKEGLAWLDL
Callithrix_jacchus|42398           IQSVPAELNMDHTVVLQLA--EKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDL
Anolis_carolinensis|6090           IQSVPAELNMDHTVVIQLA--EKKGYVTVSEIKSSLKWETERAKQVLDHLLKEGMAWLDT
Gallus_gallus|3847                 IQSVPAELNMDHTVVLQLA--EKKGYVTVGEIKSSLKWEVERAKQILEHLLKEGMAWLDT
Rhesus_macaque|23500               IQSVPAELNMDHTVVLQLA--EKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDL
Gorilla_gorilla|20878              IQSVPAELNMDHTVVLQLA--EKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDL
Dipodomys_ordii|6612               IQXXXXXXXMDHTVVLQLA--EKNGYVTVSEIQASLKWETERARQVLEHLLK-GLA-LDL
Echinops_telfairi|614              IQSVPAELNMDHTVVLQLA--EKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDL
Cavia_porcellus|14457              IQSVPAELNMDHTVVLQLA--EKNGYVTVSEIQASLRWEKERARQVLEHLLKEGLAWLDL
Erinaceus_europaeus|5504           IQSVPAELNMDHTVVLQLA--EKSGYVTVSDIKATLKWETERARQVLEHLLKEGLAWLDL
Sorex_araneus|4418                 IQSVPAELSMDHTVVLQLA--EKNGYVTVSDIKASLKWETERARQVLEHLLKEGLAWLDL
Mus_musculus|3529                  IQSVPAELNMDHTVVLQLA--EKNGYVTVSEIKTSLKWETERARQVLEHLLKEGLAWLDL
Rattus_norvegicus|18789            IQSVPAELNMDHTVVLQLA--EKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDL
Pongo_abelii|6700                  IQSVPAELNMDHTVVLQLA--EKNGYVTVSEIKASLNWETERARQVLEHLLKEGLAWLDL
Dasypus_novemcinctus|839           IQSVPAELNMDHTVVLQLA--EKNGFVTVSEIKTSLKWETERARQVLEHLLKEGLAWLDL
Monodelphis_domestica|17790        VQSVPAELNMDHTVVLQLA--EKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDL
Macropus_eugenii|15207             VQSVPAELNMDHTVVLQLA--EKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDL
Loxodonta_africana|13695           IQSVPAELNMDHTVVLQLA--EKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDL
Bos_taurus|23176                   IQSVPAELNMDHTVVLQLA--EKNGYVTVSAIKASLKWETERARQVLEHLLKEGLAWLDL
Choloepus_hoffmanni|12179          IQSVPAELNMDHTVVLQLA--EKNGCVTVSEIKASLKWETERARQVLEHLLKEGLAWLDL
Canis_familiaris|17902             IQSVPAELNMDHTVVLQLA--EKNGYVTVSDIKASLKWETERARQVLEHLLKEGLAWLDL
Equus_caballus|19548               IQSVPAELNMDHTVVLQLA--EKNGYVTVSDVKASLKWETERARQVLEHLLKEGLAWLDL
Otolemur_garnettii|1133            IQSVPAELNMDHTVVLQLA--EKNGYVTVSEIKASLKWETERARQVLEHLLKEGLVWLDL
Oryctolagus_cuniculus|20782        IQSVPAELNMDHTVVLQLA--EKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDL
Ochotona_princeps|15363            IQSVPAELNMDHTVVLQLA--EKNGYVTVSEIKASLKWETERACQVLEHLLKEGLAWLDL
Procavia_capensis|1047             IQSVPAELNMDHTVVLQLA--EKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDL
Spermophilus_tridecemlineatus|3609 IQSVPAELNMDHTVVLQLA--EKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDL
Microcebus_murinus|12130           IQSVPAELNMDHTVVLQLA--EKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDL
Pan_troglodytes|9675               IQSVPAELNMDHTVVLQLA--EKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDL
                                                                                  : ::   :   * 

Caenorhabditis_elegans|9688        QASDTTQYWFPSLFLQQY--CHSSSSTSVSESLHSMSFNNYQ-
Daphnia_pulex|11772                QSPEKT-YWFPSFFKPLM--SEDEIVLPPPN------------
Ixodes_scapularis|4093             QAPGEYLYWFPGLLRQS--------------------------
Pediculus_humanus|5361             QNVEEPLYWFPSLFEGLKTHTTATTATETLKNILIIKRNLMNR
Bombyx_mori|9397                   QEPKETLYWFPSMF------AECVSA-----------------
Tribolium_castaneum|7305           QSPKEKLYYFPSLFNACI--DSTIS------------------
Nasonia_vitripennis|3656           QNEEEPLYWFPSLF------TACIASKT---------------
Apis_mellifera|4731                QGENEILYWFPSLF------TACIVSKE---------------
Linepithema_humile|7653            QGEDETLYWFPSLF------TACIVSKE---------------
Pogonomyrmex_barbatus|3826         QGEDEVLYWFPSLF------TACIVSKE---------------
Drosophila_grimshawi|6162          QTDEEPSYWFPSLFPGRN--AQLVAA-----------------
Drosophila_melanogaster|15505      QAGDEPAYWFPSLFPGRN--AQTTAAT----------------
Anopheles_gambiae|615              QGEEKS-YWFPSLFPGRL--TAKV-------------------
Culex_quinquefasciatus|8330        QGDEES-YWFPSLFPGRQ-------------------------
Nematostella_vectensis|15411       QAGTERHFWFPTLFPDPL--NES--------------------
Tupaia_belangeri|3386              QAPGEAHYWLPALFTDLY--SEEITAEEAREALP---------
Branchiostoma_floridae|6107        QATEGRQYWFPALFPDPA--G----------------------
Xenopus_tropicalis|5428            QAQGEAQYWLPALFTALY--AQQINMDENGGPS----------
Gasterosteus_aculeatus|5016        QAAEEAQYWLPALFAELT--SRDVTPEEANQMTP---------
Danio_rerio|2657                   QAAGEPQYWLPALFSELL--SQDVTPEEANQMTP---------
Danio_rerio|25263                  QAAGEPQYWLPALFSELL--SQDVTPEEANQMTP---------
Oryzias_latipes|14698              QAAGEPQYWLPALFSELS--SRDVTPEEANQMTP---------
Tetraodon_nigroviridis|7654        QAAGEAQYWLPALFSELT--SRDVSPEEANQMTP---------
Fugu_rubripes|29863                QAAGEPQYWLPALFSELT--SRDVSPEEANQMTP---------
Pteropus_vampyrus|11032            QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Myotis_lucifugus|10723             QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Tarsius_syrichta|9946              QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Tursiops_truncatus|9412            QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Felis_catus|11449                  QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Vicugna_pacos|3268                 QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Callithrix_jacchus|42398           QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Anolis_carolinensis|6090           QAPSEPQYWLPALFTELY--SQEITPEEAKEALP---------
Gallus_gallus|3847                 QAAGEPQYWLPALFTELY--SQEITPEEAKEAIP---------
Rhesus_macaque|23500               QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Gorilla_gorilla|20878              QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Dipodomys_ordii|6612               QAPGEAHYWLPALFTDLY--SQEITAEE-REALP---------
Echinops_telfairi|614              QAPGEAQYWLPALSTDLC--SQEITTEEAREALP---------
Cavia_porcellus|14457              QAAGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Erinaceus_europaeus|5504           QAPGEAHYWLPALFTDLY--SQEITADEAREALP---------
Sorex_araneus|4418                 QAPGEAHYWLPALFTDLY--SQDITADEAREAAP---------
Mus_musculus|3529                  QAPGEAHYWLPALFTDLY--SQEISAEEAKEAFP---------
Rattus_norvegicus|18789            QAPGEAHYWLPALFTDLY--SQEISAEEAKEVFP---------
Pongo_abelii|6700                  QAPGEAHYWLPALFTDLY--SQEITAEEARESPP---------
Dasypus_novemcinctus|839           QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Monodelphis_domestica|17790        QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Macropus_eugenii|15207             QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Loxodonta_africana|13695           QAPGEAHYWLPALFTDLY--SQEVTAEEAREALP---------
Bos_taurus|23176                   QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Choloepus_hoffmanni|12179          QAPGEAHYWLPALFTDLY--SQEITAEEAREALS---------
Canis_familiaris|17902             QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Equus_caballus|19548               QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Otolemur_garnettii|1133            QA-GEA-YWL-ALFTD-Y--SQEITAEEAREALP---------
Oryctolagus_cuniculus|20782        QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Ochotona_princeps|15363            QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Procavia_capensis|1047             QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Spermophilus_tridecemlineatus|3609 QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Microcebus_murinus|12130           QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
Pan_troglodytes|9675               QAPGEAHYWLPALFTDLY--SQEITAEEAREALP---------
                                   *      :::  :