Orthologs Set ID: EOG4006D6


Orthology Database
OrthoDB4
Gene Symbol(s)
GH14944,GL21141,GK19106

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Drosophila grimshawi 7526
Drosophila melanogaster 11143
Drosophila persimilis 7292
Drosophila willistoni 14374

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Drosophila grimshawi 7526 FBtr0150358 6557870 FBgn0122419 GH14944 droGri2
Drosophila melanogaster 11143 FBtr0076285 39196 FBgn0052061 CG32061 dm3
Drosophila persimilis 7292 FBtr0186756 6597934 FBgn0158735 GL21141 droPer1
Drosophila willistoni 14374 FBtr0249757 6646418 FBgn0221104 GK19106 r1.3

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Drosophila grimshawi 4837 FBpp0148850 6557870 FBgn0122419 GH14944 droGri2
Drosophila melanogaster 10144 FBpp0076014 39196 FBgn0052061 CG32061 dm3
Drosophila persimilis 10813 FBpp0185248 6597934 FBgn0158735 GL21141 droPer1
Drosophila willistoni 8933 FBpp0248249 6646418 FBgn0221104 GK19106 r1.3

multiple sequence alignment in CLUSTALW format


Drosophila_willistoni|14374   ATGTTAAATCTTAAATTAATAGACCTAACAATTTTT---TTGATTTCTATTGTGCATTTG
Drosophila_grimshawi|7526     ---ATGATTCCTAAATTTGCATACATTTTGTTGTTTCTGGGCCTTTCGGTCTGCCACATA
Drosophila_melanogaster|11143 ATGTTCATACCCAAAATACGAGACATTGGTTACTTTGCGCTGCTGACATCCCTGCACTTG
Drosophila_persimilis|7292    ------ATGCTAAAACTCAGGGACATTATATATTTCGTTCTCCTCACCGGAATACACGTC
                                    *: *  *** *   . **.*:   :: **       .* :*       **  * 

Drosophila_willistoni|14374   TGCTCTTTGATGCAGCCCACCATAGATGTTAATTCTCGAATCCGTTATGCATATCCCAAT
Drosophila_grimshawi|7526     TGTGCCCACTTAAGGCCAATAATCGAGGCGAAGGTGAGCATTATACCCATCAGTCTGCAA
Drosophila_melanogaster|11143 GGCTCAAATCTTCAGCCGGTCATCGAGGCGAATGCCAATCTAAAAACGGTCTATCCCTCC
Drosophila_persimilis|7292    TGTGCAGTGATCCAGCCCACGGTTGAGGTCAATGCTAAACTCAATTGGAGCAGCTCGAAC
                               *  *  :  * ..*** .  .* ** *  **    .. .* . :   . .:.     . 

Drosophila_willistoni|14374   GTGGAGAGAAGTTTCAAAATTCGCTTGGGCTACATACCACAATTCGCCTCAACA---CTA
Drosophila_grimshawi|7526     CTCTCCCGCAAACTGAACATATCTGTTGGCTAC------GAATATCACCAAACAATGCTT
Drosophila_melanogaster|11143 GTGAATCGTAATCTAACGCTTCAATTGGGCTAT------AAATACAATCACTGGATGCTG
Drosophila_persimilis|7292    GTGGACCGTAGCCTGCGGCTGAACGTTGGTTAC------CAGTACAAGCCCTTGATGCTG
                               *  . .* *.  * .  .*     * ** **        *.*:  .  ..: .   ** 

Drosophila_willistoni|14374   TGCCAGACATCCATATTTGCGATGATCGTGTTGTTTGTGAAGGAACGTCGCCGTCATTAT
Drosophila_grimshawi|7526     TGGGTTGCAATCGTGAATTCAATGCTGATGGTCTTTGGCTTCTGGCGTTGTCAACAC---
Drosophila_melanogaster|11143 GTTAAGGCCATAATGTATTCACTACTATCTATGATCGGAGTTTGGTACTCACGACACTTG
Drosophila_persimilis|7292    ACCCGGTCCATGATGTACTCTCTGCTGACGATGATTGGGCTGTGGCATGGGCGCCATCGA
                                     *.:  .*.::  * .*..*     * :* *   :  .. .    *. **    

Drosophila_willistoni|14374   TTGGCCATGAGAAAGGAGTGGCAGGAGCTGCAAACGCTGGAACAAAAACTTGAGACTCGT
Drosophila_grimshawi|7526     ------------GAAGCGGACAAGGCGCTTCACCAAAAACACAATATTGGC---------
Drosophila_melanogaster|11143 ------------CAAAGTGGCAAAAGTGAGGTATCGATGGAAAAGAAAGGA---------
Drosophila_persimilis|7292    GATGCAGTGAAGCGGGCGGAGAAGAGGCAGGATGAGATCGAGCGGCGGGCACGGCGGGGA
                                           ...   . .*..   :  :  ...:  * .. .              

Drosophila_willistoni|14374   GAC---GCCAATGATGAAACCATTTCAAGTGCTGAGAAAATCAAA---------ATGGAC
Drosophila_grimshawi|7526     ------GCCAACAAGAAGTTAACTGCAGCAGCAGCGAAGGTGAAG---------------
Drosophila_melanogaster|11143 ------ATCCTTAAAACTACGACAACAGCTGCAGAGCAAGTGAAA---------AACAAT
Drosophila_persimilis|7292    AGCATTCTCATTAGATCCTACTCCAGCCAGCTGGAAAGAGCGCGGCAGCTAATGAACGAG
                                      *.: ..  . :  :    .      *......  ...               

Drosophila_willistoni|14374   TATCTGCGGCGACTATTA------------------------------------------
Drosophila_grimshawi|7526     CCAATTTGCCAAAGCAAGACTCCT------------------------------------
Drosophila_melanogaster|11143 TGGATCAAAAAACAGAATTCCGCA------------------------------------
Drosophila_persimilis|7292    TGGGTGCGCCGGCAAAAGGAGGCGTCCTTATCGGACCTCCAAGAGGACGAGGCTGCGCTT
                                  *  . ....  ::                                           

Drosophila_willistoni|14374   ------------------AGCAAGAATTGTAGCAGAAATATATTAAATATTCCATTGGAA
Drosophila_grimshawi|7526     ------------------TCCAGCTGGCAACTGTTTCCGTTGCGCTACTTTGTTTTGTGT
Drosophila_melanogaster|11143 ------------------TTGAAAAACGGAACCCTGCCGCGGAATATATTCCTGTTATTT
Drosophila_persimilis|7292    GACGCGGAGCTGAATCAGTCGGAGGGCTCCTATTTTCCTTGGAGGAAGTTCCTCCTCATT
                                                :  ..  .          ..   .   :: :*     *   :

Drosophila_willistoni|14374   ACATTGATTTGGTCCCTGATAATTGTGATCAATCAAATTGTGGGTTATGCAAGGCTCAAT
Drosophila_grimshawi|7526     GCTGTGCCTTGGCTGACCACACTACTGCTTAATTTAATATTGAATTATTCACAACTGAAT
Drosophila_melanogaster|11143 GCTTTGCCCTGGATATTGACCTTTGTGGCCAGCGGATTGATCAACTATATTCGATTTTAC
Drosophila_persimilis|7292    GCCCTGCCCTGGACGCTGACGTTTGTCGTCGCCGGAATGCTCAACTACGGCCGGCTATAT
                              .*  **.  ***      *   *: *    .    *:*  * .. **    ... * :* 

Drosophila_willistoni|14374   GCTATAATGTATCACTTTGGCAACTCTAATCTAAATACATTGGAGCAGCTTTTGCGTTTG
Drosophila_grimshawi|7526     ATGGTTCTCGGACACTTCTGCACATCACCGTGGGAGGTGTTGGCTCTCTATGGACGGGTT
Drosophila_melanogaster|11143 ATGGTCATACAGCATTTTTGCATATCTAACTGGAGGGCGATTCAGCTTTATGGAGAACTG
Drosophila_persimilis|7292    CTGGTCATCCAGAACTTTAGCCTCACCCACTGGCAGACGGTCATGCTCTATGCGAAGATC
                                 .* .*  . .* **  **. .:* ..   . . . . *    *:  :*  . .  * 

Drosophila_willistoni|14374   CAGTCAATGTTCCTATATCAAACATTTATACAGATGCCATATGAAATTGCAGCAAAAGTT
Drosophila_grimshawi|7526     CAGATGCTCTATCTGCAACGTTTGCTC------------------GCCAGCATTGCTGCA
Drosophila_melanogaster|11143 CAAGGCCTCTTTTGGCATCGTTCTACA------------------TCCGTGACTTTAATA
Drosophila_persimilis|7292    CAGATGCTCTTCCTGCACCGCATGATT------------------GAGGTGTCCTTGGCT
                              **.   .* *:   . * *. :                          .        . :

Drosophila_willistoni|14374   CCACACAATGATCAATTC------------------------------------------
Drosophila_grimshawi|7526     CCTTCTTCTGGCACCTTTAAGTCCATATTTGCAGCACATACA------------------
Drosophila_melanogaster|11143 CCCTATTGGTCGCAAATTATCGGCGGAGGAGTATCCTTGGAGAAGGCATCTCATCTTTCT
Drosophila_persimilis|7292    TCCTACTGGCGGCAGTTT---------CCCGTCACTGTGGAC------------------
                               *  . :     .. :*                                           

Drosophila_willistoni|14374   ---GATGGCATTATCTATGAACCACATTTGCTGGAT---------TAA
Drosophila_grimshawi|7526     ---GGCCAATTTACCTTCGAAAACAATCTGTTGGTCGGAGAAGATTGA
Drosophila_melanogaster|11143 GGAAATTGTATTTCCATTGAAACACATCTTTTGGAC---------TGA
Drosophila_persimilis|7292    ---AACTACATCAGCCTCGAGACGCATCTGCTGGCAACGGAA---TGA
                                 ..  . :* : * : **... .** *  ***           *.*

multiple sequence alignment in CLUSTALW format


Drosophila_willistoni|8933    MLNLKLIDLTIF-LISIVHLCSLMQPTIDVNSRIRYAYPNVERSFKIRLGYIPQFAST-L
Drosophila_grimshawi|4837     -MIPKFAYILLFLGLSVCHICAHLRPIIEAKVSIIPISLQLSRKLNISVGY--EYHQTML
Drosophila_melanogaster|10144 MFIPKIRDIGYFALLTSLHLGSNLQPVIEANANLKTVYPSVNRNLTLQLGY--KYNHWML
Drosophila_persimilis|10813   --MLKLRDIIYFVLLTGIHVCAVIQPTVEVNAKLNWSSSNVDRSLRLNVGY--QYKPLML
                                  *:  :  *  ::  *: : ::* ::.:  :     .:.*.: : :**  ::    *

Drosophila_willistoni|8933    CQTSIFAMIVLFVKERRRHYLAMRKEWQELQTLEQKLETRD-ANDETISSAEKIK---MD
Drosophila_grimshawi|4837     WVAIVNSMLMVFGFWRCQH-----EADKALHQKHNIG-----ANKKLTAAAAKVK-----
Drosophila_melanogaster|10144 VKAIMYSLLSMIGVWYSRHL----QSGKSEVSMEKKG-----ILKTTTTAAEQVK---NN
Drosophila_persimilis|10813   TRSMMYSLLTMIGLWHGRHRDAVKRAEKRQDEIERRARRGSILIRSYSSQLERARQLMNE
                                : : ::: ::     :*     .  :     ..             :   : :     

Drosophila_willistoni|8933    YLRRLL--------------------SKNCSRNILNIPLETLIWSLIIVINQIVGYARLN
Drosophila_grimshawi|4837     PICQSKTP------------------SSWQLFPLRYFVLCAVPWLTTLLLNLILNYSQLN
Drosophila_melanogaster|10144 WIKKQNSA------------------LKNGTLPRNIFLLFALPWILTFVASGLINYIRFY
Drosophila_persimilis|10813   WVRRQKEASLSDLQEDEAALDAELNQSEGSYFPWRKFLLIALPWTLTFVVAGMLNYGRLY
                               : :                       .        : * :: *   ::   ::.* :: 

Drosophila_willistoni|8933    AIMYHFGNSNLNTLEQLLRLQSMFLYQTFIQMPYEIAAKVPHNDQF--------------
Drosophila_grimshawi|4837     MVLGHFCTSPWEVLALYGRVQMLYLQRLL------ASIAAPSSGTFKSIFAAHT------
Drosophila_melanogaster|10144 MVIQHFCISNWRAIQLYGELQGLFWHRST------SVTLIPYWSQIIGGGVSLEKASHLS
Drosophila_persimilis|10813   LVIQNFSLTHWQTVMLYAKIQMLFLHRMI------EVSLASYWRQF---PVTVD------
                               :: :*  :  ..:    .:* ::  :             .    :              

Drosophila_willistoni|8933    -DGIIYEPHLLD---
Drosophila_grimshawi|4837     -GQFTFENNLLVGED
Drosophila_melanogaster|10144 GNCISIETHLLD---
Drosophila_persimilis|10813   -NYISLETHLLATE-
                               . :  * :**