Orthologs Set ID: EOG4006D8


Orthology Database
OrthoDB4
Gene Symbol(s)
GH24176,CG13539

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Drosophila grimshawi 1323
Drosophila melanogaster 8413

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Drosophila grimshawi 1323 FBtr0159590 6565700 FBgn0131632 GH24176 droGri2
Drosophila melanogaster 8413 FBtr0071998, NM_137924 37680 FBgn0034833 CG13539 dm3

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Drosophila grimshawi 13875 FBpp0158082 6565700 FBgn0131632 GH24176 droGri2
Drosophila melanogaster 7585 FBpp0071907 37680 FBgn0034833 CG13539 dm3

multiple sequence alignment in CLUSTALW format


Drosophila_grimshawi|1323    ATGGATGAGCACGGAGCCGGTGGCGGACAGGCTGATAAGGATACAGAAGGTGACATTTTG
Drosophila_melanogaster|8413 ATGACCGACCATTCAGCCCAT---------------------------------------
                             ***.. ** **   **** .*                                       

Drosophila_grimshawi|1323    CCGCGCTTCAAGGGATTGCCAAATATCGTCGAGGGCGTCAATGATATCTATGCGCATTTG
Drosophila_melanogaster|8413 ------------------CCAAACGAGGAGGAGGTGATCGGGGACATCTACTTGTCCCTA
                                               ***** .: *: ****  .**.. ** *****   * .  *.

Drosophila_grimshawi|1323    GTGCAACGCCATGTTCAAAACTATCCCCCCGATGGCAGCTTTACGAAATGGGTAGACCCG
Drosophila_melanogaster|8413 CTCTCGCGACATGCCCACAGATATCCAGAGGATGGAAGCCACAAGTCGTGGATCCTTCCG
                              *  ..**.****  **.*..*****. . *****.*** : *.*:..***.*. : ***

Drosophila_grimshawi|1323    CAAATAATCATACTATTCGAGACGGGCAATATTAATCAGGTGATTGAAGCGGCTGTCAGG
Drosophila_melanogaster|8413 CGCATGATGGTTCTGTTCGCCAGTGGGGATATGGATCAGGTTATAGAGGCCATAGTCTCG
                             *..**.** .*:**.****. *  ** .**** .******* **:**.** . :***: *

Drosophila_grimshawi|1323    GATCTTAAGCATCCCATTGGCACGGGCCTTGTGGCCAGCATACTGGTGCAGGAGCCATTG
Drosophila_melanogaster|8413 GACATGATCCATCCGATTGGTACTGGACTGGTGGCCAGTGTTCTGGTCGAGGAGTCCATA
                             ** .* *: ***** ***** ** **.** ******** .*:*****  ***** *.:*.

Drosophila_grimshawi|1323    AGTCAGACATTGATATACAAAATCCGTGCCCGAATGGAGCTGATGGATGAGCGCATTGCT
Drosophila_melanogaster|8413 CGGGACGAGATGATTAAGAGAATACGAGCCAACTTGAAGCCGATGAGCGAGCGCATCCAA
                             .*  * ...:****::* *.***.**:***...:**.*** ****.. ********  .:

Drosophila_grimshawi|1323    GCACATCCAAATTTTTTGAACACACTGAAAATGATTGAGCGAATGAATTGCAAGACTATC
Drosophila_melanogaster|8413 CACCATCCCAATTACCTGAAGACAGTGAAGCTCATCGATCGAATGAACTGCTCCACCATT
                              ..*****.****:  **** *** ****..* ** ** ******** ***:. ** ** 

Drosophila_grimshawi|1323    AAAATTGAGGAATATGATCCGGCGGATAAGCAAAAGCTATATGGTCGAATGAAACCGAGA
Drosophila_melanogaster|8413 CACATCGAGGAGTTCGAGGAGTCGGATACGAAGAAGCGTTATGGTCGCCGGATGAAGGGA
                             .*.** *****.*: **  .* ******.*.*.**** :********.. **:...*.**

Drosophila_grimshawi|1323    TCACCAATTGTCGTTTTGGACTTTCCACAAATCTATTTTGGCAACAAGCCATCGGCTGTT
Drosophila_melanogaster|8413 TCCCCTTTGATAGTCTTGGATTTCCCCCAATTCTATTTCGGTGGCAAGCCCACGGCCATA
                             **.**::* .*.** ***** ** **.***:******* ** ..******.:**** .*:

Drosophila_grimshawi|1323    ATAACGATAAATACGTTTCGGAATTTAAAAGAAGCCGTTAAGCTTTGTCGTCGAGAGGGT
Drosophila_melanogaster|8413 ATGACTATGAGCACCTTTCGCAATATGAATGAAGTGGTTAAGTTGCATTCGCGCGAAGGT
                             **.** **.*. ** ***** ***:*.**:****  ****** *  .*   **.**.***

Drosophila_grimshawi|1323    CTCGAGTTCGATACGGTTTCCGTGTGGACAAGCAAATTAACGGAGGGCTATGATCTGCTC
Drosophila_melanogaster|8413 CTGAATTTCGACTGTATTACCGTGTGGTCAGCCAAGTTGGCCCAGTGCTTCGACCTGCTC
                             ** .* ***** :  .**:********:**. ***.**..*  ** ***: ** ******

Drosophila_grimshawi|1323    TATGGTCTCTCAAGATACCCAAATTTCAGATTCAATTGTATA------------------
Drosophila_melanogaster|8413 ACCAGGGTGCCCACGGTGGACCAGTGGACCTTCAACTGCACCAAGGAATCCATCAAGGTT
                             :. .*  *  *.* . :  ...* *  * .***** ** * .                  

Drosophila_grimshawi|1323    ---AATGTGCCCTTCAAGGCCCATGCCATGGTAACGATCAAAAACGGGTATCACTATGAA
Drosophila_melanogaster|8413 CCAAAACTGCCAGCTCAACCGACCACCACAGTTATAATCGTTAAGAACATTCACTATGAA
                                **: ****.   .*. * .. .*** .**:* .***.::** .. ::**********

Drosophila_grimshawi|1323    GTGATTGCAGTTGACGGCGAGTTGAAGACCATTGTTTTTCCACTACAAGACGACTCCTAA
Drosophila_melanogaster|8413 GTCCACGTCATTGGCGGAAAGATCAAAACTATAGCGTTTCCAATCGTAGATACTTCTTGA
                             ** .: * ..***.***..**:* **.** **:*  ******.*. :*** .. ** *.*

multiple sequence alignment in CLUSTALW format


Drosophila_grimshawi|13875   MDEHGAGGGQADKDTEGDILPRFKGLPNIVEGVNDIYAHLVQRHVQNYPPDGSFTKWVDP
Drosophila_melanogaster|7585 MTDHSAH-------------------PNEEEVIGDIYLSLLSRHAHRYPEDGSHKSWILP
                             * :*.*                    **  * :.***  *:.**.:.** ***...*: *

Drosophila_grimshawi|13875   QIIILFETGNINQVIEAAVRDLKHPIGTGLVASILVQEPLSQTLIYKIRARMELMDERIA
Drosophila_melanogaster|7585 RMMVLFASGDMDQVIEAIVSDMIHPIGTGLVASVLVEESIRDEMIKRIRANLKPMSERIQ
                             ::::** :*:::***** * *: **********:**:*.: : :* :***.:: *.*** 

Drosophila_grimshawi|13875   AHPNFLNTLKMIERMNCKTIKIEEYDPADKQKLYGRMKPRSPIVVLDFPQIYFGNKPSAV
Drosophila_melanogaster|7585 HHPNYLKTVKLIDRMNCSTIHIEEFEESDTKKRYGRRMKGSPLIVLDFPQFYFGGKPTAI
                              ***:*:*:*:*:****.**:***:: :*.:* ***    **::******:***.**:*:

Drosophila_grimshawi|13875   ITINTFRNLKEAVKLCRREGLEFDTVSVWTSKLTEGYDLLYGLSRYPNFRFNCI------
Drosophila_melanogaster|7585 MTMSTFRNMNEVVKLHSREGLNFDCITVWSAKLAQCFDLLTRVPTVDQWTFNCTKESIKV
                             :*:.****::*.***  ****:** ::**::**:: :***  :.   :: ***       

Drosophila_grimshawi|13875   -NVPFKAHAMVTIKNGYHYEVIAVDGELKTIVFPLQDDS
Drosophila_melanogaster|7585 PKLPAQPTTTVIIVKNIHYEVHVIGGKIKTIAFPIVDTS
                              ::* :. : * * :. **** .:.*::***.**: * *