Orthologs Set ID: EOG4006DB


Orthology Database
OrthoDB4
Gene Symbol(s)
NRIP3

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Anolis carolinensis 8198 261, 486, 572, 796, 1008
Bos taurus 5943 46, 261, 486, 572, 796, 1008, 1190
Callithrix jacchus 37201 261, 486, 572, 796, 1008, 1190
Canis familiaris 12357 46, 141, 261, 486, 572, 796, 1008, 1190
Cavia porcellus 4856 147, 183, 261, 486, 572, 796, 1008, 1190
Choloepus hoffmanni 13102 486, 572, 796, 1008, 1190
Daphnia pulex 17047
Dasypus novemcinctus 15056 279, 342, 435, 521, 642, 795
Dipodomys ordii 10643 486, 572, 796, 1008, 1020, 1149, 1190
Echinops telfairi 2271 486, 572
Equus caballus 25060 261, 486, 572, 796, 1008, 1190
Erinaceus europaeus 14979 261, 486, 572, 796, 1008, 1190
Felis catus 41335 261, 486, 572, 796, 1008, 1190
Gallus gallus 16456 132, 168, 486, 572, 796, 1008, 1190
Gorilla gorilla 25241 138, 261, 486, 572, 796, 1008, 1190
Homo sapiens 16897 261, 486, 572, 796, 1008, 1190
Loxodonta africana 10680 46, 261, 486, 572, 796, 1008, 1190
Macropus eugenii 16357 261, 486, 510, 572, 796, 1008, 1190
Microcebus murinus 5690 261, 486, 572, 796, 1008, 1152, 1155, 1190
Monodelphis domestica 24368 46, 261, 486, 572, 796, 1008, 1190
Mus musculus 40149 46, 261, 486, 572, 796, 1008, 1190
Myotis lucifugus 14920 62, 79, 102, 118, 175, 261, 486, 572, 796, 1008, 1190
Ochotona princeps 5743 427, 486, 572, 796, 1008, 1190
Ornithorhynchus anatinus 27562 486, 572, 796, 1008, 1190
Otolemur garnettii 14599 486, 572, 612, 795, 1008, 1190
Pan troglodytes 6422 261, 486, 572, 796, 1008, 1190
Pongo abelii 4980 261, 486, 572, 796, 1008, 1190
Procavia capensis 14866 261, 486, 572, 796, 1008
Pteropus vampyrus 2435 261, 486, 572, 796, 1008, 1190
Rattus norvegicus 2890 46, 261, 486, 572, 796, 1008, 1190
Rhesus macaque 13034 261, 486, 572, 792, 1008, 1190
Sorex araneus 5452 486, 572, 796, 1008, 1190
Spermophilus tridecemlineatus 2505 252, 261, 486, 572, 796, 1008, 1048, 1190
Sus scrofa 19730 261, 486, 572, 796, 1008
Sus scrofa 19736 261, 486, 549, 572, 796, 1008, 1190
Taeniopygia guttata 11868 261, 486, 572, 796, 1008
Tarsius syrichta 10059 261, 486, 572, 796, 1008, 1190
Tupaia belangeri 5033 486, 572, 796, 1008, 1190
Tursiops truncatus 1175 261, 486, 572, 796, 1008, 1190
Vicugna pacos 12023 486, 572, 796, 1008, 1190
Xenopus tropicalis 1834 486, 572, 796, 1008, 1190

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 8198 ENSACAT00000009848 100560560 ENSACAG00000009845 nrip3 anoCar1
Bos taurus 5943 ENSBTAT00000017779 ENSBTAG00000013366 NP_001095688.1 bosTau4
Callithrix jacchus 37201 ENSCJAT00000022641 100406633 ENSCJAG00000011630 NRIP3 calJac3
Canis familiaris 12357 ENSCAFT00000011232 ENSCAFG00000007014 NRIP3 canFam2
Cavia porcellus 4856 ENSCPOT00000011218 100730967 ENSCPOG00000011114 NRIP3 cavPor3
Choloepus hoffmanni 13102 ENSCHOT00000013103 ENSCHOG00000013063 NRIP3 choHof1
Daphnia pulex 17047 fgenesh1_pg.C_scaffold_11016000001 1.1
Dasypus novemcinctus 15056 ENSDNOT00000008215 ENSDNOG00000008220 NRIP3 dasNov2
Dipodomys ordii 10643 ENSDORT00000010349 ENSDORG00000010349 Nrip3 dipOrd1
Echinops telfairi 2271 ENSETET00000002223 ENSETEG00000002225 NRIP3 TENREC
Equus caballus 25060 ENSECAT00000010118 100055591 ENSECAG00000009783 NRIP3 equCab2
Erinaceus europaeus 14979 ENSEEUT00000013495 103120737 ENSEEUG00000013501 NRIP3 eriEur1
Felis catus 41335 ENSFCAT00000015240 ENSFCAG00000015236 NRIP3 felCat3
Gallus gallus 16456 ENSGALT00000009496 423050 ENSGALG00000005903 NRIP3 galGal3
Gorilla gorilla 25241 ENSGGOT00000007849 101145361 ENSGGOG00000007817 NRIP3 gorGor3
Homo sapiens 16897 ENST00000396639 ENSG00000175352 NRIP3 hg19,GRCh37
Loxodonta africana 10680 ENSLAFT00000010675 100667117 ENSLAFG00000010675 NRIP3 loxAfr3
Macropus eugenii 16357 ENSMEUT00000016354 ENSMEUG00000016310 NRIP3 Meug_1.0
Microcebus murinus 5690 ENSMICT00000005304 ENSMICG00000005306 NRIP3 micMur1
Monodelphis domestica 24368 ENSMODT00000009558 100020920 ENSMODG00000007557 NRIP3 monDom5
Mus musculus 40149 ENSMUST00000041460 78593 ENSMUSG00000034825 mm9
Myotis lucifugus 14920 ENSMLUT00000014726 102418021 ENSMLUG00000014724 NRIP3 myoLuc1
Ochotona princeps 5743 ENSOPRT00000004821 101522417 ENSOPRG00000004825 NRIP3 OchPri2.0
Ornithorhynchus anatinus 27562 ENSOANT00000004939 ENSOANG00000003114 NRIP3 ornAna1
Otolemur garnettii 14599 ENSOGAT00000014019 100946757 ENSOGAG00000014016 NRIP3 otoGar1
Pan troglodytes 6422 ENSPTRT00000006332 748039 ENSPTRG00000003341 NRIP3 panTro2
Pongo abelii 4980 ENSPPYT00000004170 100452876 ENSPPYG00000003499 NRIP3 ponAbe2
Procavia capensis 14866 ENSPCAT00000014602 ENSPCAG00000014622 NRIP3 proCap1
Pteropus vampyrus 2435 ENSPVAT00000000417 ENSPVAG00000000417 NRIP3 pteVam1
Rattus norvegicus 2890 ENSRNOT00000017976 361625 ENSRNOG00000013290 Nrip3 rn4
Rhesus macaque 13034 ENSMMUT00000009370 704753 ENSMMUG00000006689 NRIP3 rheMac2
Sorex araneus 5452 ENSSART00000005334 ENSSARG00000005355 NRIP3 sorAra1
Spermophilus tridecemlineatus 2505 ENSSTOT00000002505 101958954 ENSSTOG00000002510 NRIP3 speTri1
Sus scrofa 19730 ENSSSCT00000015920 100519788 ENSSSCG00000014570 NRIP3 susScr2
Sus scrofa 19736 ENSSSCT00000015926 susScr2
Taeniopygia guttata 11868 ENSTGUT00000008657 100228745 ENSTGUG00000008315 NRIP3 taeGut1
Tarsius syrichta 10059 ENSTSYT00000012982 103256797 ENSTSYG00000012991 NRIP3 tarSyr1
Tupaia belangeri 5033 ENSTBET00000005034 ENSTBEG00000005044 NRIP3 tupBel1
Tursiops truncatus 1175 ENSTTRT00000004731 101338482 ENSTTRG00000004736 NRIP3 turTru1
Vicugna pacos 12023 ENSVPAT00000003910 102526016 ENSVPAG00000003910 NRIP3 vicPac1
Xenopus tropicalis 1834 ENSXETT00000009632 ENSXETG00000004423 nrip3 xenTro2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 9532 ENSACAP00000009651 100560560 ENSACAG00000009845 nrip3 anoCar1
Bos taurus 11693 ENSBTAP00000017779 ENSBTAG00000013366 NP_001095688.1 bosTau4
Callithrix jacchus 28853 ENSCJAP00000021420 100406633 ENSCJAG00000011630 NRIP3 calJac3
Canis familiaris 10696 ENSCAFP00000010407 ENSCAFG00000007014 NRIP3 canFam2
Cavia porcellus 3786 ENSCPOP00000009994 100730967 ENSCPOG00000011114 NRIP3 cavPor3
Choloepus hoffmanni 11576 ENSCHOP00000011575 ENSCHOG00000013063 NRIP3 choHof1
Daphnia pulex 30339 JGI_V11_124851 1.1
Dasypus novemcinctus 13306 ENSDNOP00000006361 ENSDNOG00000008220 NRIP3 dasNov2
Dipodomys ordii 9993 ENSDORP00000009727 ENSDORG00000010349 Nrip3 dipOrd1
Echinops telfairi 1803 ENSETEP00000001804 ENSETEG00000002225 NRIP3 TENREC
Equus caballus 7823 ENSECAP00000007781 100055591 ENSECAG00000009783 NRIP3 equCab2
Erinaceus europaeus 12316 ENSEEUP00000012307 103120737 ENSEEUG00000013501 NRIP3 eriEur1
Felis catus 7151 ENSFCAP00000014132 ENSFCAG00000015236 NRIP3 felCat3
Gallus gallus 6076 ENSGALP00000009482 423050 ENSGALG00000005903 NRIP3 galGal3
Gorilla gorilla 19705 ENSGGOP00000007644 101145361 ENSGGOG00000007817 NRIP3 gorGor3
Homo sapiens 41112 ENSP00000379879 ENSG00000175352 NRIP3 hg19,GRCh37
Loxodonta africana 10982 ENSLAFP00000008936 100667117 ENSLAFG00000010675 NRIP3 loxAfr3
Macropus eugenii 14917 ENSMEUP00000014914 ENSMEUG00000016310 NRIP3 Meug_1.0
Microcebus murinus 4834 ENSMICP00000004834 ENSMICG00000005306 NRIP3 micMur1
Monodelphis domestica 11591 ENSMODP00000009374 100020920 ENSMODG00000007557 NRIP3 monDom5
Mus musculus 22573 ENSMUSP00000044116 78593 ENSMUSG00000034825 mm9
Myotis lucifugus 13398 ENSMLUP00000013399 102418021 ENSMLUG00000014724 NRIP3 myoLuc1
Ochotona princeps 4989 ENSOPRP00000004441 101522417 ENSOPRG00000004825 NRIP3 OchPri2.0
Ornithorhynchus anatinus 8013 ENSOANP00000004938 ENSOANG00000003114 NRIP3 ornAna1
Otolemur garnettii 12548 ENSOGAP00000012549 100946757 ENSOGAG00000014016 NRIP3 otoGar1
Pan troglodytes 5101 ENSPTRP00000005840 748039 ENSPTRG00000003341 NRIP3 panTro2
Pongo abelii 9691 ENSPPYP00000004014 100452876 ENSPPYG00000003499 NRIP3 ponAbe2
Procavia capensis 13907 ENSPCAP00000013646 ENSPCAG00000014622 NRIP3 proCap1
Pteropus vampyrus 2304 ENSPVAP00000000387 ENSPVAG00000000417 NRIP3 pteVam1
Rattus norvegicus 28309 ENSRNOP00000017976 361625 ENSRNOG00000013290 Nrip3 rn4
Rhesus macaque 15777 ENSMMUP00000008804 704753 ENSMMUG00000006689 NRIP3 rheMac2
Sorex araneus 4846 ENSSARP00000004830 ENSSARG00000005355 NRIP3 sorAra1
Spermophilus tridecemlineatus 2245 ENSSTOP00000002240 101958954 ENSSTOG00000002510 NRIP3 speTri1
Sus scrofa 15446 ENSSSCP00000015500 100519788 ENSSSCG00000014570 NRIP3 susScr2
Sus scrofa 15452 ENSSSCP00000015506 susScr2
Taeniopygia guttata 12056 ENSTGUP00000008566 100228745 ENSTGUG00000008315 NRIP3 taeGut1
Tarsius syrichta 9223 ENSTSYP00000011913 103256797 ENSTSYG00000012991 NRIP3 tarSyr1
Tupaia belangeri 4346 ENSTBEP00000004335 ENSTBEG00000005044 NRIP3 tupBel1
Tursiops truncatus 1113 ENSTTRP00000004459 101338482 ENSTTRG00000004736 NRIP3 turTru1
Vicugna pacos 11169 ENSVPAP00000003634 102526016 ENSVPAG00000003910 NRIP3 vicPac1
Xenopus tropicalis 23769 ENSXETP00000009632 ENSXETG00000004423 nrip3 xenTro2

multiple sequence alignment in CLUSTALW format


Daphnia_pulex|17047                ---------CAAGTAGCTGCTCCGATTCCCGTAAGTAGTAATGAAGGAGATGTAAATGAT
Xenopus_tropicalis|1834            ------------------------------------------------------------
Dasypus_novemcinctus|15056         ------------------------------------------------------------
Procavia_capensis|14866            ---------------------------------ATGTTTTACTCAGGGCTCCTCACCGAG
Ornithorhynchus_anatinus|27562     ------------------------------------------------------------
Echinops_telfairi|2271             ------------------------------------------------------------
Microcebus_murinus|5690            ------------------------------------------------------------
Spermophilus_tridecemlineatus|2505 ---------------------------------ATGTTTTACTCAGGGCTCCTCACGGAG
Monodelphis_domestica|24368        CTAAACAAGCTATCTGTGATTCCAGGGTCTGCGACTGCATGCAAAGGGCTTCTGACCGAG
Macropus_eugenii|16357             ---------------------------------ATGTTTTACTCAGGGCTCCTGACCGAG
Sus_scrofa|19730                   ---------------------------------ATGTTTTACTCAGGGCTCCTCACCGAG
Sus_scrofa|19736                   ---------------------------------ATGTTTTACTCAGGGCTCCTCACCGAG
Rhesus_macaque|13034               ---------------------------------ATGTTTTACTCAGGGCTTCTCACTGAG
Rattus_norvegicus|2890             ATGGCTCAGCTGTCAGTGATCCCGGGATCGGCCGCTGCATGGACAGGGCTCCTCACCGAG
Mus_musculus|40149                 ATGGCTCAGCTGTCAGTCATCCCGGGATCGGCCGCGGCGTGGACAGGACTCCTCACCGAG
Dipodomys_ordii|10643              ------------------------------------------------------------
Erinaceus_europaeus|14979          ---------------------------------ATGTTTTATTCAGGGCTCCTCACCGAG
Choloepus_hoffmanni|13102          ------------------------------------------------------------
Sorex_araneus|5452                 ------------------------------------------------------------
Loxodonta_africana|10680           ATGGCCCAGCTGTCGGTGATCCCGGGGTCTGCCACGGCGTGGACAGGGCTCCTCACCGAG
Ochotona_princeps|5743             ------------------------------------------------------------
Cavia_porcellus|4856               ---------------------------------ATGTTTTACTCAGGGCTCCTGACCGAA
Tursiops_truncatus|1175            ---------------------------------ATGTTTTACTCAGGACTCCTCACCGAG
Equus_caballus|25060               ---------------------------------ATGTTTTACTCAGGGCTGCTCACCGAG
Myotis_lucifugus|14920             ---------------------------------------------GGGCTCCCGATCGCG
Pongo_abelii|4980                  ---------------------------------ATGTTTTACTCAGGGCTCCTCACTGAG
Homo_sapiens|16897                 ---------------------------------ATGTTTTACTCAGGGCTCCTCACTGAG
Callithrix_jacchus|37201           ---------------------------------ATGTTTTACTCAGGGCTCCTCACCGAG
Gorilla_gorilla|25241              ---------------------------------ATGTTTTACTCAGGGCTCCTCACTGAG
Pan_troglodytes|6422               ---------------------------------ATGTTTTACTCAGGGCTCCTCACTGAG
Pteropus_vampyrus|2435             ---------------------------------ATGTTTTACTCAGGGCTCCTCACCGAG
Otolemur_garnettii|14599           ------------------------------------------------------------
Bos_taurus|5943                    ATGGCCCAGCTGTCTGTGATCCCGGGGTCGGCCACGTCGTGGACAGGGCTCCTCACCGAG
Canis_familiaris|12357             ATGGCTCAGCTGGCGGTGATCCCCGGGTCGGCCACGGCGTGGCCAGGGCTCCTCCGCGAG
Felis_catus|41335                  ---------------------------------ATGTTTTACTCAGGGCTCCTCAGCGAG
Tarsius_syrichta|10059             ---------------------------------ATGTTTTACTCAGGGCTCCTCACGGAG
Tupaia_belangeri|5033              ------------------------------------------------------------
Vicugna_pacos|12023                ------------------------------------------------------------
Gallus_gallus|16456                CCGGCTCTGCGGGAGCTGCACGCCGGCAGCAAGATGTTCTATTCGGGCGTTCTGACGGAG
Anolis_carolinensis|8198           ---------------------------------ATGTTTTACTCGGGTCTCCTCACAGAG
Taeniopygia_guttata|11868          ---------------------------------atgTTTTATTCGGGGATCCTGACAGAG
                                                                                               

Daphnia_pulex|17047                GGAAAGGGTGAAGGTGGTAAATTGCAATGCGCTAGAATTGGAGTTCGCATTGGCAAAGAT
Xenopus_tropicalis|1834            ------------------------------------------------------------
Dasypus_novemcinctus|15056         ------------------------------------------------------------
Procavia_capensis|14866            GGCGGTCGCAAAGAGACCGATATGCGGGAGGCGGCG---TCGTTGCGGCAGCAGCGCAGG
Ornithorhynchus_anatinus|27562     ------------------------------------------------------------
Echinops_telfairi|2271             ------------------------------------------------------------
Microcebus_murinus|5690            ------------------------------------------------------------
Spermophilus_tridecemlineatus|2505 GGCGGCCGCAAGGAGACCGAAATGCGGGAGGCGGCG---TCGCTTCGGCAGCAGCGCCGG
Monodelphis_domestica|24368        GGGGGCCGCAAGGAGGCCGACATGCGAGAGGCAGCT---TCACTGAGGCAGCAGCGCCGG
Macropus_eugenii|16357             GGGGGCCGCAAGGAGGCTGAGATGCGTGAGGCGGCT---TCTCTGCGGCAACAGCGCCGG
Sus_scrofa|19730                   GGCGGCCGCAAGGAGACGGACATGCGGGAGGCGGCG---TCGCTGCGGCAGCAGCGCCGG
Sus_scrofa|19736                   GGCGGCCGCAAGGAGACGGACATGCGGGAGGCGGCG---TCGCTGCGGCAGCAGCGCCGG
Rhesus_macaque|13034               GGCGGCCGCAAGGAGACCGACATGCGGGAGGCGGCG---TCGCTGCGACAGCAGCGCCGG
Rattus_norvegicus|2890             GGCGGCCGCAAGGAGACAGACATGCGGGAAGCGGCG---TCCCTGCGGCAGCAGCGCCGG
Mus_musculus|40149                 GGCGGCCGCAAGGAGACAGACATGCGGGAAGCGGCG---TCCCTGCGGCAGCAGCGCCGG
Dipodomys_ordii|10643              ------------------------------------------------------------
Erinaceus_europaeus|14979          AGCGGCCGCAAGGAGACCGACCTGCGGGAGGCGGCG---TCGCTGCGGCAGCAGCGCAGG
Choloepus_hoffmanni|13102          ------------------------------------------------------------
Sorex_araneus|5452                 ------------------------------------------------------------
Loxodonta_africana|10680           GGTGGCCGCAAGGAGACCGACGTGCGGGAGGCGGCG---TCGTTGCGGCAGCAGCGCCGG
Ochotona_princeps|5743             ------------------------------------------------------------
Cavia_porcellus|4856               GGGGTACGCAACGAGACCGACATGCGAGAGGCGGCGGTCGCTGCGGGAAGCAGCATCTGC
Tursiops_truncatus|1175            GGCGGCCGCAAGGAGACGGACAGGCGGGAGGGGGCG---TCGCTGCGGCAGCAGCGCCGG
Equus_caballus|25060               GGCAGCCGCAAGGAGACCGACATG---------------------CGGCAGCAGCGCCGA
Myotis_lucifugus|14920             GACACCCTCAAGGAGATTTCCAGCTGGGAGAGTGCG---TCG---AGACGGCAGCATCGT
Pongo_abelii|4980                  GGCGGCCGCAAGGAGACCGACAGGCGAGAGGCGGCG---TCACTGCGACAGCAGCGCCGG
Homo_sapiens|16897                 GGCGGCCGCAAGGAGACCGACATGCGGGAGGCGGCG---TCACTGCGACAGCAGCGCCGG
Callithrix_jacchus|37201           GGTGGCCGCAAGGAGACCGACATGCGGGAGGCGGCG---TCGCTGCGACAGCAGCGCCGG
Gorilla_gorilla|25241              GGCGGCCGAAAGGAGACCGACATGCGGGAGGCGGCG---TCGCTGCGACAGCAGCGCCGG
Pan_troglodytes|6422               GGCGGCCGCAAGGAGACCGACATGCGGGAGGCGGCG---TCGCTGCGACAGCAGCGCCGG
Pteropus_vampyrus|2435             GGCGGCCGCAAGGAGACGGACATGCGGGAGGCGGCG---TCGCTGCGGCAGCAGCGCCGG
Otolemur_garnettii|14599           ------------------------------------------------------------
Bos_taurus|5943                    GGCGGCCGCAAGGAGACAGACATGCGGGAGGCGGCG---TCGCTGAGGCAGCAGCGCCGA
Canis_familiaris|12357             GGCGGCCGCCAGGATTCGGACATGCGGGAGGCGGCG---TCGCTGCGGCAGCAGCGCCGG
Felis_catus|41335                  GGCGGCCGCAAGGAAACGGACATGCGGGAGGCCGCG---TCGCTGCGGCAGCAGCGCCGG
Tarsius_syrichta|10059             GGCGGCCGCAAGGAGGGCGACATGCGGGAGGCTGCT---TCGCTGCGACAGCAGCGCCGG
Tupaia_belangeri|5033              ------------------------------------------------------------
Vicugna_pacos|12023                ------------------------------------------------------------
Gallus_gallus|16456                CCGACGAGGAAAGAAGTGGAGATCCGGGAGGCCGCC---TCGCTGCGCCAGCAGAGGAGG
Anolis_carolinensis|8198           TCGTCCAGGAAGGAGGTGGACATGAGGGAAGCTGCA---TCCCTTCGACAGCAAAGGAGG
Taeniopygia_guttata|11868          CCGAGCAGGAAAGAAGTGGAGCTAAGGGAAGAGGCG---TCCCTCCGCCAGCAGAGGAGG
                                                                                               

Daphnia_pulex|17047                AAAGTAGATGCTTTG------GTTGATTCGTGCGCTTCCGTTTCTCTGGTTTCTTTCGAT
Xenopus_tropicalis|1834            ------------------------------------------------------------
Dasypus_novemcinctus|15056         ------------------------------------------------------------
Procavia_capensis|14866            ATGAAGCAGGCGGTG---CAGTTCATCCACAAGGACTCCGCTGACCTGCTGCCCCTGGAC
Ornithorhynchus_anatinus|27562     ------------------------------------------------------------
Echinops_telfairi|2271             ------------------------------------------------------------
Microcebus_murinus|5690            ------------------------------------------------------------
Spermophilus_tridecemlineatus|2505 ATGAAACAGGCCGTG---CAGTTCATCCACAAGGACTCCGCTGACCTACTGCCCCTGGAT
Monodelphis_domestica|24368        GTGAAGCAGGCTGTG---CAGTTCATCCACAAAGACTCGGCTGACCTGCTGCCCCTCGAT
Macropus_eugenii|16357             ATGAAGCAGGCTGTG---CAGTTCATCCACAAGGACTCGGCTGACCTGCTGCCCCTGGAC
Sus_scrofa|19730                   ATGAAGCAGGCGGTG---CAGTTCATCCACAAGGACTCGGCCGACCTGCTGCCCTTGGAC
Sus_scrofa|19736                   ATGAAGCAGGCGGTG---CAGTTCATCCACAAGGACTCGGCCGACCTGCTGCCCTTGGAC
Rhesus_macaque|13034               ATGAAGCAGGCGGTG---CAGTTCATCCACAAGGACTCCGCCGACCTGCTGCCCCTGGAC
Rattus_norvegicus|2890             ATGAAGCAGGCGGTG---CAGTTCATCCACAAAGACTCAGCCGATCTGCTGCCCCTGGAC
Mus_musculus|40149                 ATGAAGCAGGCGGTG---CAGTTCATCCACAAGGACTCAGCCGACCTGCTGCCCCTGGAC
Dipodomys_ordii|10643              ------------------------------------------------------------
Erinaceus_europaeus|14979          ATGAAGCAGGCCGTG---CAGTTCATCCACAAGGACTCCGCCGACCTGCTGCCGCTGGAC
Choloepus_hoffmanni|13102          ------------------------------------------------------------
Sorex_araneus|5452                 ------------------------------------------------------------
Loxodonta_africana|10680           ATGAAGCAGGCGGTG---CAGTTCATCCACAAGGACTCCGCCGACCTGCTGCCCCTGGAC
Ochotona_princeps|5743             ------------------------------------------------------------
Cavia_porcellus|4856               ATGAAGCAAGCGGTG---CAGTTCATC---AGGGACTCCGCAGCCCTGCTGCCCCTGGAC
Tursiops_truncatus|1175            ATGAAGCAGGCCGTG---CAGTTCATCCACAAGGACTCGGCCGACCTGCTGCCCTTGGAC
Equus_caballus|25060               ATGAAGCAAGCTGTG---CAGTTCATCCACAAGGACTCGGCCGACCTGCTGCCCCTGGAC
Myotis_lucifugus|14920             ATGAAGCAGTCCGGG---CAGTTCATGCACAAGGACTCGGCCGACCTCCTGCCCCTGGAC
Pongo_abelii|4980                  ATGAAGCAGGCGGTG---CAGTTCATCCACAAGGACTCCGCCGACCTGCTGCCCCTGGAC
Homo_sapiens|16897                 ATGAAGCAGGCGGTG---CAGTTCATCCACAAGGACTCCGCCGACCTGCTGCCCCTGGAC
Callithrix_jacchus|37201           ATGAAGCAGGCGGTG---CAGTTTATCCACAAGGACTCCGCCGACCTGCTGCCCCTGGAC
Gorilla_gorilla|25241              ATGAAGCAGGCGGTGCAGCAGTTCATCCACAAGGACTCCGCCGACCTGCTGCCCCTGGAC
Pan_troglodytes|6422               ATGAAGCAGGCGGTG---CAGTTCATCCACAAGGACTCCGCCGACCTGCTGCCCCTGGAC
Pteropus_vampyrus|2435             ATGAAGCAGGCTGTG---CAGTTCATCCACAAGGACTCCGCCGACCTGCTGCCCCTGGAC
Otolemur_garnettii|14599           ------------------------------------------------------------
Bos_taurus|5943                    ATGAAGCAGGCCGTG---CAGTTCATCCACAAGGACTCGGCCGACCTGCTGCCCTTGGAC
Canis_familiaris|12357             ATGAAACAGGCCGTG---CAG------------GACTCCGCCGACCTGCTGCCCTTGGAC
Felis_catus|41335                  ATGAAGCAAGCCGTG---CAGTTCATTCATAAGGACTCCGCCGACCTGCTGCCCTTGGAC
Tarsius_syrichta|10059             ATGAAGCAAGCCGTG---CAGTTCATCCACAAGGACTCCGCCGACCTGCTGCCCCTGGAC
Tupaia_belangeri|5033              ------------------------------------------------------------
Vicugna_pacos|12023                ------------------------------------------------------------
Gallus_gallus|16456                ATGAAGCAGGCGGTC---TCTCCTTTCCCACGGGGCTCAGCAGAAGCTCTTCCCCCTGAC
Anolis_carolinensis|8198           ATGAAGCAGGCTGTC---CAGTTTAACCACAAGGACTCGGCTGACCTCCTGCCGTTGGAT
Taeniopygia_guttata|11868          ATGAAGCAGGCGGTT---CAGTTTATTCACAAGGATTCTGCAGATCTCCTCCCTCTGGAC
                                                                                               

Daphnia_pulex|17047                TTTATCAATAAATATGGCTTAAAAATCAAGAAAAATGTTTCTATCAAAATAGTATCAATA
Xenopus_tropicalis|1834            ------------------------------------------------------------
Dasypus_novemcinctus|15056         ------------------------------------------------------------
Procavia_capensis|14866            GGCCTCAAGAAG------------------------------------------------
Ornithorhynchus_anatinus|27562     ------------------------------------------------------------
Echinops_telfairi|2271             ------------------------------------------------------------
Microcebus_murinus|5690            GGCCTCAAGAAG------------------------------------------------
Spermophilus_tridecemlineatus|2505 GGCCTCAAGAAG------------------------------------------------
Monodelphis_domestica|24368        GGACTCAAGAAG------------------------------------------------
Macropus_eugenii|16357             GGGCTCAAGAAG------------------------------------------------
Sus_scrofa|19730                   GGCCTCAAGAAG------------------------------------------------
Sus_scrofa|19736                   GGCCTCAAGAAG------------------------------------------------
Rhesus_macaque|13034               GGCCTCAAGAAG------------------------------------------------
Rattus_norvegicus|2890             GGCCTCAAAAAG------------------------------------------------
Mus_musculus|40149                 GGCCTCAAAAAG------------------------------------------------
Dipodomys_ordii|10643              ------------------------------------------------------------
Erinaceus_europaeus|14979          GGCCTCAAGAAG------------------------------------------------
Choloepus_hoffmanni|13102          ------------------------------------------------------------
Sorex_araneus|5452                 ------------------------------------------------------------
Loxodonta_africana|10680           GGCCTCAAGAAG------------------------------------------------
Ochotona_princeps|5743             ------------------------------------------------------------
Cavia_porcellus|4856               GGC---AAGAAG------------------------------------------------
Tursiops_truncatus|1175            GGCCTCAAGAAG------------------------------------------------
Equus_caballus|25060               GGCCTCAAGAAG------------------------------------------------
Myotis_lucifugus|14920             GGCCTCAAGAAG------------------------------------------------
Pongo_abelii|4980                  GGCCTCAAGAAG------------------------------------------------
Homo_sapiens|16897                 GGCCTCAAGAAG------------------------------------------------
Callithrix_jacchus|37201           GGCCTGAAGAAG------------------------------------------------
Gorilla_gorilla|25241              GGCCTCAAGAAG------------------------------------------------
Pan_troglodytes|6422               GGCCTCAAGAAG------------------------------------------------
Pteropus_vampyrus|2435             GGCCTCAAGAAG------------------------------------------------
Otolemur_garnettii|14599           ------------------------------------------------------------
Bos_taurus|5943                    GGCCTCAAGAAG------------------------------------------------
Canis_familiaris|12357             GGCCTCCAGAAG------------------------------------------------
Felis_catus|41335                  GGCCTCAAGAAG------------------------------------------------
Tarsius_syrichta|10059             GGCCTCAAGAAG------------------------------------------------
Tupaia_belangeri|5033              ------------------------------------------------------------
Vicugna_pacos|12023                ------------------------------------------------------------
Gallus_gallus|16456                TTTGCTCTGCTC------------------------------------------------
Anolis_carolinensis|8198           GGGCTGAAAAAA------------------------------------------------
Taeniopygia_guttata|11868          GGGCTGAAGAAG------------------------------------------------
                                                                                               

Daphnia_pulex|17047                TTTGGCGCTTCAACCAAGATCAAGGGGGTTACCATTTTCAAAGTACGAATAGGTCCACGT
Xenopus_tropicalis|1834            ---------------------CAGCCGCACAATATCCTCCAGCGGCGCTTG---------
Dasypus_novemcinctus|15056         ---------------------CAACCTCATAACATTTTG---------TTC---------
Procavia_capensis|14866            CTAGGCTCGTCCAAGGACACGCAACCTCATAACATTCTGCAAAGACGCCTC---------
Ornithorhynchus_anatinus|27562     ---------------------CAACCGCACAACATTCTGCAGCGGCGCCTC---------
Echinops_telfairi|2271             ---------------------CCTTTTCAAAACGTTTCCCAGATACGCCCC---------
Microcebus_murinus|5690            CTGGGCTCGTCCAAGGACACGCAACCTCATAACATTCTGCAGAGGCGCCTT---------
Spermophilus_tridecemlineatus|2505 CTGGGCTCGTCC---GACACGCAACCTCATAACATTCTGCAGAGGCGACTC---------
Monodelphis_domestica|24368        CTGGGCTCCTCCAAGGACACGCAACCTCACAACATCCTACAAAGACGCCTC---------
Macropus_eugenii|16357             CTGGGCTCCTCCAAGGACACGCAACCCCACAACATCCTGCAGAGGCGCCTC---------
Sus_scrofa|19730                   CTGGGCTCGTCCAAGGACACGCAACCTCACAACATTCTGCAGAGACGGCTC---------
Sus_scrofa|19736                   CTGGGCTCGTCCAAGGACACGCAACCTCACAACATTCTGCAGAGACGGCTC---------
Rhesus_macaque|13034               CTGGGCTCGTCCAAGGACACGCAACCCCATAATATTCTGCAGAGGCGCCTC---------
Rattus_norvegicus|2890             CTGGGCTCGTCCAAGGACACGCAACCTCATAACATTCTGCAGAGGCGCCTC---------
Mus_musculus|40149                 CTGGGCTCGTCCAAGGACACGCAACCCCATAACATTCTGCAGAGGCGCCTC---------
Dipodomys_ordii|10643              ---------------------CAACCTCATAACATCCTGCAGAGGCGCCTC---------
Erinaceus_europaeus|14979          CTGGGGTCGTCCAAGGACACGCAACCTCATAACATTCTTCAGAGACGTCTT---------
Choloepus_hoffmanni|13102          ---------------------CAACCTCATAACATTCTGCAGAGGCGCCTC---------
Sorex_araneus|5452                 ---------------------CAACCTCATAACATTCTGCAAAGACGCCTG---------
Loxodonta_africana|10680           CTGGGCTCGTCCAAGGACACGCAACCTCATAACATTCTGCAGAGACGCCTC---------
Ochotona_princeps|5743             ---------------------CAACCTCACAACATTCTGCAGAGGCGCCTC---------
Cavia_porcellus|4856               CTGGGCTCGTCTAAGGACACGCAACCTCATAACATTCTGCAGAGGCGCCTC---------
Tursiops_truncatus|1175            CTGGGCTCGTCCAAGGACACGCAACCTCATAACATTCTGCAGAGGCGCCTC---------
Equus_caballus|25060               CTGGGCTCGTCCAAGGACACGCAACCTCATAACATTCTGCAGAGGCGCCTC---------
Myotis_lucifugus|14920             CTGGGCTCGTCCAAGGACACGCAACCGCATAACATTCTGCAGAGGCGCCTC---------
Pongo_abelii|4980                  CTGGGCTCGTCCAAGGACACGCAACCTCATAATATTCTGCAGAGGCGCCTC---------
Homo_sapiens|16897                 CTGGGCTCGTCCAAGGACATGCAACCTCATAATATTCTGCAGAGGCGCCTC---------
Callithrix_jacchus|37201           CTGGGCTCGTCCAAGGACACGCAACCTCATAATATTCTGCAGAGGCGCCTC---------
Gorilla_gorilla|25241              CTGGGCTCGTCCAAGGACATGCAACCTCATAATATTCTGCAGAGGCGCCTC---------
Pan_troglodytes|6422               CTGGGCTCGTCCAAGGACATGCAACCTCATAATATTCTGCAGAGGCGCCTC---------
Pteropus_vampyrus|2435             CTGGGCTCGTCCAAGGACACGCAACCTCATAACATTCTGCAGAGGCGCCTC---------
Otolemur_garnettii|14599           ---------------------CAACCTCATAATATCCTGCAGAGGCGCCTC---------
Bos_taurus|5943                    CTGGGTTCGTCCAAGGACACGCAACCTCATAACATTCTGCAGAGGCGCCTC---------
Canis_familiaris|12357             CTGGGCTCGTCCCAGGTCACGCAACCTCATAACATTCTGCAGAGGCGCCTC---------
Felis_catus|41335                  CTGGGCTCGTCCAAGGACACGCAACCTCATAACATTCTGCAGAGGCGCCTC---------
Tarsius_syrichta|10059             CTGGGCTCGTCCAAGGACACGCAACCTCACAACATTCTGCAGAGGCGCCTC---------
Tupaia_belangeri|5033              ---------------------CAACCTCATAACATTCTGCAGAGGCGCCTC---------
Vicugna_pacos|12023                ---------------------CAACCTCATAACATTCTGCAGAGACGCCTC---------
Gallus_gallus|16456                TTTCTTTGCGTGTCCTTAAAGCAACCACACAACATCCTGCAGAGGCGCCTG---------
Anolis_carolinensis|8198           CTAGGAACCTCCAAAGACACtCAACCACACAGCATCCTGCAGAAACGCTTG---------
Taeniopygia_guttata|11868          CTGGGGACGTCGAAGGATACTCAGCCACACAACATCCTGCAGAAGCGCCTG---------
                                                        ..     : *  .*                         

Daphnia_pulex|17047                ACTTACAAATGCAAGGCTTTGGTGCTGGAAGAATCAATGTACCCGCTGTTGCTGGGA---
Xenopus_tropicalis|1834            ------------------------CTGGAGACCAACCTGTCCAAACTGAGGACCAAT---
Dasypus_novemcinctus|15056         ------------------------ATGGAAACC------ACCAAGATCCAAAGCAGT---
Procavia_capensis|14866            ------------------------ATGGAAACAAACCTATCTAAGCTCCGAAGCAGC---
Ornithorhynchus_anatinus|27562     ------------------------ATGGAGACCAACCTGTCGAAGCTCCGGAAC------
Echinops_telfairi|2271             ------------------------GTGGAAACCGGCTTGTCAAAGCTCCAGAGCACC---
Microcebus_murinus|5690            ------------------------ATGGAAACCAACCTGTCTAAACTCCGAAGCAGT---
Spermophilus_tridecemlineatus|2505 ------------------------ATGGAAACCAACCTGTCTAAGTTCCGAAGCAGT---
Monodelphis_domestica|24368        ------------------------ATGGAGACCAACCTTTCCAAGCTCCGCAATAGC---
Macropus_eugenii|16357             ------------------------ATGGAGACCAACCTCTCCAAGCTCCGCAGCAGC---
Sus_scrofa|19730                   ------------------------CTGGAAACCAACCTGTCTAAGCTGCGAAGCAGT---
Sus_scrofa|19736                   ------------------------CTGGAAACCAACCTGTCTAAGCTGCGAAGCAGT---
Rhesus_macaque|13034               ------------------------ATGGAAACCAACCTGTCTAAGCTCCGAAGCGGC---
Rattus_norvegicus|2890             ------------------------ATGGAAACCAACCTGTCTAAGCTCCGGAGCAGC---
Mus_musculus|40149                 ------------------------ATGGAAACCAACCTGTCTAAGCTCCGGAGCACT---
Dipodomys_ordii|10643              ------------------------ATGGAAACCAACTTGTCTAAGCTCCGAAGCACT---
Erinaceus_europaeus|14979          ------------------------ATGGAAACCAATCTGTCTAAGCTCAGAAGCAGC---
Choloepus_hoffmanni|13102          ------------------------ATGGAAACCAACTTATCTAAGCTCCGAAGCAGT---
Sorex_araneus|5452                 ------------------------ATGGAAACCAATCTGTCTAAGCTTCGAAGTAGC---
Loxodonta_africana|10680           ------------------------ATGGAAACCAACCTATCTAAGCTCCGAAGCAGC---
Ochotona_princeps|5743             ------------------------ATGGAGACCAATCTGTCTAAGCTCCGAAGCAGT---
Cavia_porcellus|4856               ------------------------ATGGAAACAAATCTGTCTAAGCTCCGAAGCGGT---
Tursiops_truncatus|1175            ------------------------ATGGAAACCAACCTGTCAAAGCTCCGAAGCAGT---
Equus_caballus|25060               ------------------------ATGGAAACCAACCTGTCGAAGCTCCGAAGCAGT---
Myotis_lucifugus|14920             ------------------------ATGGAAACCAACCTGTCTAAGCTCCGAAGCAGT---
Pongo_abelii|4980                  ------------------------ATGGAAACCAACCTGTCTAAGCTCCGAAGCGGC---
Homo_sapiens|16897                 ------------------------ATGGAAACCAACCTGTCTAAGCTCCGAAGCGGTCCC
Callithrix_jacchus|37201           ------------------------ATGGAAACCAACCTGTCTAAGCTCCGAAGCAGC---
Gorilla_gorilla|25241              ------------------------ATGGAAACCAACCTGTCTAAGCTCCGAAGCAGC---
Pan_troglodytes|6422               ------------------------ATGGAAACCAACCTGTCTAAGCTCCGAAGCGGC---
Pteropus_vampyrus|2435             ------------------------ATGGAAACGAACCTGTCTAAGCTCCGAAGCAGT---
Otolemur_garnettii|14599           ------------------------ATGGAAACCAACCTGTCAAAGCTTCGAAGCAGT---
Bos_taurus|5943                    ------------------------ATGGAAACCAACCTATCTAAGCTCCGAAGCAGT---
Canis_familiaris|12357             ------------------------ATGGAAACCAACCTGTCTAAACTTCGAAGCAGT---
Felis_catus|41335                  ------------------------ATGGAAACCAACCTGTCTAAACTTCGAAGCAGC---
Tarsius_syrichta|10059             ------------------------ATGGAAACCAACCTGTCTAAGCTCCGAAGCAGT---
Tupaia_belangeri|5033              ------------------------ATGGAAACCAACCTTTCTAAGCTCCGGAGCAGT---
Vicugna_pacos|12023                ------------------------ATGGAAACCAACCTGTCTAAGCTTCGAAGCAGT---
Gallus_gallus|16456                ------------------------ATGGAGACAAACCTATCAAAGCTGCGAGGCAGC---
Anolis_carolinensis|8198           ------------------------ATGGAGACAAACATGTCCAAACTGCGCCATGGA---
Taeniopygia_guttata|11868          ------------------------ATGGAGACAAACCTATCCAAGTTCCGAGGCAGC---
                                                            ****...       :. ... *             

Daphnia_pulex|17047                ---CTTGATTGGTTGGTTGCAAACAAGTGCAACTTGAACTTTGACCAAATGGTATTGGAA
Xenopus_tropicalis|1834            CGCTCCACCTGGGCGCCCAAGAATGACGTCTCGGCCCAAAGTAAGAAACAGAACCAGGCG
Dasypus_novemcinctus|15056         GGTATACCTTGGGGCTCCAAG------------------ACCAACATACTCCATCAGTTT
Procavia_capensis|14866            CGTGTTCCTTGGGCCTCCAAG------------------ACCAACAGATTCAGTCAGGCT
Ornithorhynchus_anatinus|27562     CGGGCCCCTTGGGCCCCGAAGAGCGAAGCGGCCAACAAGGCGTCCAGGGGCCACCAGGGG
Echinops_telfairi|2271             CTTGTCCCTTGTGCCTCCAAG------------------ACTCCCCCACTCTCTCTTGCC
Microcebus_murinus|5690            CGTGTCCCTTGGGCCTCGAAG------------------ACCAACAAACTTAATCAAGCT
Spermophilus_tridecemlineatus|2505 CGTGTACCTTGGGCCTCCAAG------------------ACCAACAAATTCAATCAAGCT
Monodelphis_domestica|24368        CGGGTCCCTTGGGCCCCCAAG------------------GCCAACAGATTCAATCAGGCC
Macropus_eugenii|16357             CGGGTCCCTTGGGCTCCGAAG------------------ACCAACAGACTCAATCAGGCC
Sus_scrofa|19730                   CGTGTCCCTTGGGCCTCCAAG------------------TCCAGCAGACTGAGTCAGGCC
Sus_scrofa|19736                   CGTGTCCCTTGGGCCTCCAAG------------------TCCAGCAGACTGAGTCAGGCC
Rhesus_macaque|13034               CGTGTCCCTTGGGCCTCTAAG------------------ACGAACAAACTCAATCAGGCT
Rattus_norvegicus|2890             CGTGTCCCTTGGGCCTCCAAG------------------ACCAACAAATTCAGTCAGACT
Mus_musculus|40149                 CGTGTCCCTTGGGCCTCTAAG------------------ACCAACAAATTCAATCAGGCT
Dipodomys_ordii|10643              CGTGTTCCTTGGGCCTCCAAG------------------ACCAACAAACTCTCTCAGTCT
Erinaceus_europaeus|14979          CGTGTCCCTTGGTCCTCCAAG------------------ACCAACAAACTCAATCAGTCT
Choloepus_hoffmanni|13102          CGTGTCCCTTGGGCCTCCAAG------------------ACCAACAGATTCAATCAGTCT
Sorex_araneus|5452                 CGTGTCCCTTGGGCATCCAAG------------------ACCAACAAACTCAATCATTCT
Loxodonta_africana|10680           CGTGTTCCTTGGGCCTCCAAG------------------ACCAGCAGACTCAATCAGGCT
Ochotona_princeps|5743             CGTATCCCTTGGGCCTCCAAG------------------ACCAACAAGTTCAGTCAAGCT
Cavia_porcellus|4856               CGTGTTCCTTGGGCCTCCAAG------------------ACCAACAAACTCAATCAGACT
Tursiops_truncatus|1175            CGTGTCCCTTGGGCCTCCAAG------------------ACCAACAAACTCAATCATGCC
Equus_caballus|25060               CGTATCCCTTGGGCCTCCAAG------------------ACCAACAAATTCAATCAGGCG
Myotis_lucifugus|14920             CGTGTCCCATGGACCTCCAAG------------------ACCAACAAACTCAATCAGGCT
Pongo_abelii|4980                  CGTGTCCCTTGGGCCTCTAAG------------------ACGAACAAACTCAATCAGGCT
Homo_sapiens|16897                 CGTGTCCCTTGGGCCTCTAAG------------------ACGAACAAACTCAATCAGGCT
Callithrix_jacchus|37201           CGTGTCCCTTGGGCCTCTAAG------------------ACGAACAAAGTCAATCAGGCT
Gorilla_gorilla|25241              CGTGTCCCTTGGGCCTCTAAG------------------ACGAACAAACTCAATCAGGCT
Pan_troglodytes|6422               CGTGTCCCTTGGGCCTCTAAG------------------ACGAACAAACTCAATCAGGCT
Pteropus_vampyrus|2435             CGTGTCCCTTGGGCATCCAAG------------------ACCAACAAACTCAATCAGACT
Otolemur_garnettii|14599           CGTGTCCCTTGGGCCTCCAAG------------------ACCAACAAACTCAATCAGGCT
Bos_taurus|5943                    CGTGTCCCTTGGGCCTCCAAG------------------ACCAACAAATTCAATCAGGCC
Canis_familiaris|12357             CGTGTGCCTTGGGCCTCCAAG------------------ACCAACAAACTGAATCAGGCT
Felis_catus|41335                  CGTGTTCCTTGGGCCTCCAAG------------------ACCAACAAACTGAATCAGGCT
Tarsius_syrichta|10059             CGTGTTCCTTGGGCCTCCAAG------------------ACCAACAAACTCAATCAGGCT
Tupaia_belangeri|5033              CGTGTCCCTTGGGCCTCCAAG------------------ACCAACAAACTCAATCAGGCC
Vicugna_pacos|12023                CGTGTCCCTTGGGCCTCCAAG------------------ACCAACAAACTCAACCAGGCC
Gallus_gallus|16456                CGGGGCAGCTGGGCCTCGAAGAGTGATGCTCCAGCACAGAGCAACAGGCTGAACCAAGCC
Anolis_carolinensis|8198           CGAGGGACAAGCTCTCAGAAGAATGACCTCCCAGCCCAGACAAATAAACTGAATCAAATG
Taeniopygia_guttata|11868          CGAGGCAGCTGGGCTCCGAAGGGAGATCTCTCATCACAGACCAACAAGCTGAACCAAACC
                                            :*       ...                        . .       :    

Daphnia_pulex|17047                TTTCCAAATGGAGATAGGAAACCAATAATGGTCAAGAAGGATGAGTCTAGAGTTTTATCG
Xenopus_tropicalis|1834            AAGTGCGAGAGTCCGAGGAAGAGC---------GAGGATGACGACATGATCTACGTCTGG
Dasypus_novemcinctus|15056         AAGTCTGATGGGCTATCTAAGGGT---------GTT------AACATGATTTTGGTTTCT
Procavia_capensis|14866            AAGTCTGAGAGTCTAAAGAAGTCT---------GAGGATGATGACATGATTTTGGTTTCT
Ornithorhynchus_anatinus|27562     AAGCCTGAGGGGCTGAAGAAGGTG---------GAGGAAGAGGACATGATTCTGGTGTCC
Echinops_telfairi|2271             AAGTCTGAGAGTCTAAAGAAGTCC---------GAGGATGATGACATGACCTTGTTTTCT
Microcebus_murinus|5690            AAGTCTGAGGGGCTAAAGAAGTCT---------GAGGATGATGACATGATTTTGGTTTCT
Spermophilus_tridecemlineatus|2505 AAGTCTGAGGGGCTAAAGAAGTCT---------GAGGATGATGATATGATTTTGGTTTCT
Monodelphis_domestica|24368        AAGTCTGAGGGGCTGAAGAAGGCT---------GAGGAAGGGGACATGATCCTGGTTTCC
Macropus_eugenii|16357             AAGTTTGAGGGGATGAAGAAGACT---------GAAGAAGGGGACATGATCCTGGTGCCT
Sus_scrofa|19730                   AAGTCGGAGGGGCTCAGGAAGTCT---------GAGGAG---GACATGATCTGGGTTCCT
Sus_scrofa|19736                   AAGTCGGAGGGGCTCAGGAAGTCT------------GAGGAGGACATGATCTGGGTTCCT
Rhesus_macaque|13034               AAGTCTGAGGGGCTAAAGAAGTCT---------GAGGAGGATGACATGATTTTGGTTTCT
Rattus_norvegicus|2890             AAGTCTGAAGGGCTAAAGAAGTGT---------GACGATGATGACATGATTTTAGTGTCT
Mus_musculus|40149                 AAGTCTGAAGGGCTGAAGAAGTGT---------GAAGATGAAGACATGATTTTAGTGTCT
Dipodomys_ordii|10643              AAGTCTGAGGGGCTAAAGAAGTCT---------GAAGATGATGACATGATTTTGATTTCT
Erinaceus_europaeus|14979          AAGACAGAGGGGCTGAAGAAATCT---------GAGGATGATGACATGATTTTGGTTTCT
Choloepus_hoffmanni|13102          AAATCTGAGGGGCTAAAGAAGTCT---------GAGGATGATGACATGATTTTGGTTTCT
Sorex_araneus|5452                 AAGTCAGAGGGGCTAAAGAAGTCT---------GAGGATGATGACATGATTTTGGTTTCT
Loxodonta_africana|10680           AAGTCTGAGAGTCTAAAGAAGTCT---------GAGGATGATGACATGATTTTGGTTTCT
Ochotona_princeps|5743             AAGGCCGAGGGGCTAAAGAAATCT---------GAGGACGATGACATGATTTTGGTCTCT
Cavia_porcellus|4856               AAATCTGAAGGACTAAAGAAGTCT---------GAGGAGGATGACATGATTTTGGTTTCT
Tursiops_truncatus|1175            AAGTCTGAGGGGCTAAAGAAGTCT---------GAGGTTGATGACATGATTTTGGTTTCT
Equus_caballus|25060               AAGTCTGAGGGACTAAAGAAGTCT---------GAGGATGATGACATGATTTTGGTTTCT
Myotis_lucifugus|14920             AAGTCTGAGGGACTGAAGAAGTCT---------GAGGATGATGACATGATTTTGGTTTCT
Pongo_abelii|4980                  AAGTCTGAGGGGCTAAAGAAGTCT---------GAGGAGGATGACATGATTTTGGTTTCT
Homo_sapiens|16897                 AAGTCTGAGGGGCTAAAGAAGTCT---------GAGGAGGATGACATGATTTTGGTTTCT
Callithrix_jacchus|37201           AAGTCTGAGGGGCTAAAGAAGTCT---------GAGGAGGATGACATGATTTTGGTTTCT
Gorilla_gorilla|25241              AAGTCTGAGGGGCTAAAGAAGTCT---------GAGGAGGATGACATGATTTTGGTTTCT
Pan_troglodytes|6422               AAGTCTGAGGGGCTAAAGAAGTCT---------GAGGAGGATGACATGATTTTGGTTTCT
Pteropus_vampyrus|2435             AAGTCTGAGGGACTGAAGAAATCT---------GAGGATGATGACATGATTTTGATTTCT
Otolemur_garnettii|14599           AAGTCTGAGGGACTAAAGAAGTCT---------GAGGATGATGACATGATTTTGGTTTCT
Bos_taurus|5943                    AAGTCTGAGGGGCTGAAGAAGTCT---------GAGGATGATGACATGATTTTGGTTTCT
Canis_familiaris|12357             AAGTCTGAGGGACTAAAGAAGTCT---------GATGATGATGACATGATTTTGGTTTCT
Felis_catus|41335                  AAGTCTGAGGGACTAAAGAAGTCT---------GATGATGATGACATGATTTTGGTTTCT
Tarsius_syrichta|10059             AAGTCTGAGGGGCTAAAGAAGTCT---------GAGGACGATGACATGATTTTGGTTTCT
Tupaia_belangeri|5033              AAGTCTGAGGGGCTAAAGAAGTCT---------GAGGATGATGACATGATTTTGGTTTCT
Vicugna_pacos|12023                AAGTCTGAGGGGCTAAAGAAGTCT---------GAGGATGATGACCTGATTTTGGTTTCT
Gallus_gallus|16456                AAACTGGGGAGCTCCAGGAGCGTG---------GAGGATGAGGAGCTCCTGGTGGTGAGC
Anolis_carolinensis|8198           AAACTGGATTGCCCCAAGAAAACA---------GAGCAAGATGATCTCATCTTAGTATGT
Taeniopygia_guttata|11868          AAACTGGGCAGCTCGGGGAAAACA---------CAGGATGAAGAGCTCATAGTGGTGAGC
                                   ::    ..  *       *.                      .*    .      *    

Daphnia_pulex|17047                GTTCGC------------TCAAGACTCGAGGTAATTCTCCAA---GGAGGCGAAAGGGCA
Xenopus_tropicalis|1834            TGTCAG---TGCGCCGGGAAGGACGTTAGGGCCCAGATCGACACCTCCTGCCCCCACAGC
Dasypus_novemcinctus|15056         TGCCAA---TGTGCTAGAAAGGATACGAAAGACTTGGTTGACACAGGCTGTCAGTATAAG
Procavia_capensis|14866            TGCCAG---TGTGCTGGAAGGGATGTGAAAGCCGTGGTTGACACAGGCTGTCAGTATAAT
Ornithorhynchus_anatinus|27562     TGCCAG---TGCTTTGGGAAGGATTTGAAAGCTGTGGTGGACACCGGCTGTCAGTATAAC
Echinops_telfairi|2271             TGCCAC---TGTGCTGGCAAGGACGTGAAAGCCTTGGTTGACACAGGCTGTCGGTACAAT
Microcebus_murinus|5690            TGCCAG---TGTGCTGGAAAGGATGTAAAAGCCTTGGTTGACACAGGCTGTCAATATAAT
Spermophilus_tridecemlineatus|2505 TGTCAG---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Monodelphis_domestica|24368        TGCCAG---TGCGCTGGAAAGGACTTGAAAGCTTTGGTTGACACTGGCTGTCAACATAAT
Macropus_eugenii|16357             TGCCAG---TGTGCTGGAAAGGATTTGAAA---TTGGTTGACACTGGCTGTCAACATAAT
Sus_scrofa|19730                   TGCCAG---TGTGCTGGAAAGGATGTGAAAGCCTTGGTTGACACGGGCTGCCAGTACAAT
Sus_scrofa|19736                   TGCCAGCCCTGCCTTTCCTGCGACATCTGTTTCTTGCTCTTT---GGATCTTCCTTCCCT
Rhesus_macaque|13034               TGCCAG---TGTGCTGGAAAGGATGTGAAAGCCTTGGTTGACACAGGCTGCCTATATAAT
Rattus_norvegicus|2890             TGCCAG---TGTGCTGGGAGGGATGTGAAAGCTTTGGTTGACACTGGCTGCCAACATAAT
Mus_musculus|40149                 TGCCAG---TGTGCTGGGAAGGACGTGAAAGCTTTGGTTGACACTGGCTGTCAATATAAT
Dipodomys_ordii|10643              TGCCAG---TGTGCTGGAAAGGATGTGAAAGCTGTGGTTGACACAGGCTGTCAATACAAT
Erinaceus_europaeus|14979          TGCCAG---TGTGCTGGAAAGGATGTGAAGGTCTTGATTGATACAGGGTGTCAACATAAT
Choloepus_hoffmanni|13102          TGCCAG---TGTGCTGGAAAGGATGTGAAAGCCTTGGTTGACACAGGCTGTCACTATAAT
Sorex_araneus|5452                 TGCCAG---TGTGTTGGCAAGGATGTGAAAGCCTTGGTTGACACAGGCTGTCAGTATAAT
Loxodonta_africana|10680           TGTCAG---TGTGCTGGAAAGGATATGAAAGCCTTGGTTGACACAGGCTGTCAATATAAT
Ochotona_princeps|5743             TGCCAG---TGTGCTGGAAAGGATGTGAAAGCCTTGGTGGACACAGGCTGTCAATATAAT
Cavia_porcellus|4856               TGCCAG---TGTGCTGGAAAGGATGTGAAAGCCTTGGTTGACACAGGCTGTCAGTATAAT
Tursiops_truncatus|1175            TGCCAG---TGTGCTGGAAAGGATGTGAAAGCCTTGGTTGACACAGGCTGTCAATATAAT
Equus_caballus|25060               TGCCAG---TGTGCTGGAAAGGATGTGAAAGCCTTGGTTGACACAGGCTGTCAGTATAAT
Myotis_lucifugus|14920             TGCCAG---TGTGCTGGAAAGGATGTGAAAGCCCTGATTGACACAGGCTGCCAATATAAT
Pongo_abelii|4980                  TGCCAG---TGTGCTGGAAAGGATGTGAAAGCCGTGGTTGACACAGGCTGCCTACATAAT
Homo_sapiens|16897                 TGCCAG---TGTGCTGGAAAGGATGTGAAAGCCTTGGTTGACACAGGCTGCCTATATAAT
Callithrix_jacchus|37201           TGCCAG---TGTGCTGGAAAGGATGTGAAAGCCTTGGTTGACACAGGCTGTCTGTATAAT
Gorilla_gorilla|25241              TGCCAG---TGTGCTGGAAAGGATGTGAAAGCCTTGGTTGACACAGGCTGCCTATATAAT
Pan_troglodytes|6422               TGCCAG---TGTGCTGGAAAGGATGTGAAAGCCTTGGTTGACACAGGTTGCCTATATAAT
Pteropus_vampyrus|2435             TGCCAG---TGTGCTGGAAAGGATGTGAAAGCCTTGGTTGACACAGGCTGTCAGTATAAT
Otolemur_garnettii|14599           TGCCAG---TGCGCTGGAAAGGATATGAAAGCCTTGGTTGACACAGGCTGTCAATATAAT
Bos_taurus|5943                    TGCCAG---TGTGCTGGAAAGGATGTGAAAGCCTTGGTTGACACAGGCTGTCAATATAAT
Canis_familiaris|12357             TGCCAG---TGTGCTGGAAAGGATGTGAAAGCCTTGGTTGACACAGGCTGTCAATATAAT
Felis_catus|41335                  TGCCAG---TGTGCTGGAAAGGATGTGAAAGCCTTGGTTGACACAGGCTGTCAATATAAT
Tarsius_syrichta|10059             TGCCAG---TGTGCTGGAAAGGATGTAAAAGCCTTGGTTGACACAGGCTGTCAATATAAT
Tupaia_belangeri|5033              TGCCAG---TGTGCTGGAAAGGATGTGAAAGCCTTGGTTGATACAGGCTGTCAATATAAT
Vicugna_pacos|12023                TGCCAG---TGTGCTGGAAAGGATGTGAAAGCCTTGGTTGACACCGGCTGTCAATATAAT
Gallus_gallus|16456                TGCCAG---TGTGCCGGGAAGGAGCTGAAGGCCGTGGTGGACACTGGCTCACAGCACAAC
Anolis_carolinensis|8198           TGCCAG---TGTGCTGGGAAAGAACTGCAAGTTGTGGTTGACACAGGATGCCAACGCAAT
Taeniopygia_guttata|11868          TGCCAG---TGTGCGGGGAAGGAGCTGAAGGCCGTGGTGGACACTGGCTCGCAGCACAAC
                                      *.                                .                      

Daphnia_pulex|17047                TTAATACCAGTGAAAATTCCGGATTTATATAAAGTTAAAGAAGTCGACGGAATTGTATAT
Xenopus_tropicalis|1834            CTGATACCTGCCCCCTGCCTGGACCGACTGGGCCTAAAGGAACAT---------TTCCGA
Dasypus_novemcinctus|15056         CTTAACTCTTCAGCCTGTCTGGACAGATTGGGACTCAGGGAGCAC---------GTCAAA
Procavia_capensis|14866            CTCATCTCCTCAGCCTGTGTGGACAGATTGGGNNNNNNNNNNNNN---------NNNNNN
Ornithorhynchus_anatinus|27562     CTCATCTCCTCTGCCTGTTTAGACAGATTAGGGCTGAAGGAGCAC---------GTCAAG
Echinops_telfairi|2271             CTCATCTCCTCAGCCTGCGTGGACAGATTGGGGCTTAAGGAGCAT---------GTCAGA
Microcebus_murinus|5690            CTCATCTCCTCAGCCTGTGTGGACAGATTGGGACTCAAGGAGCAT---------GTCAGA
Spermophilus_tridecemlineatus|2505 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACTCAAGGAGCAT---------GTCAGA
Monodelphis_domestica|24368        CTCATCTCCTCTGCCTGTGTGGACAGACTAGGGCTAAAGGATCAT---------GTTAAA
Macropus_eugenii|16357             CTCATCTCCTCTGCCTGTGTGGACAGACTAGGGCTAAAGGACCAT---------GTTAAG
Sus_scrofa|19730                   CTCATCTCTTCAGCCTGTGTGGACCGACTGGGGCTCAAGGAGCAC---------GTCAGA
Sus_scrofa|19736                   CCTGCTTCTTCAGCCTGTGTGGACCGACTGGGGCTCAAGGAGCAC---------GTCAGA
Rhesus_macaque|13034               CTCATCTCTTCGGCCTGTGTGGACAGATTGGGACTCAAGGAGCTT---------GTCAAA
Rattus_norvegicus|2890             CTCATCTCCTCGGCCTGTGTGGACAGATTGGGACTAAGGGACCAT---------GTCAAA
Mus_musculus|40149                 CTCATCTCCTCAGCCTGTGTGGACAGATTGGGACTAAAGGACCAT---------GTCAAA
Dipodomys_ordii|10643              CTCATCTCCTCAGCCTGTGTGGACAGATTGGGGCTCAAGGAACAT---------GTCAAA
Erinaceus_europaeus|14979          CTCATCTCATCAGCTTGTGTGGACAGGCTGGGACTCAAGGACCAA---------GTCAAG
Choloepus_hoffmanni|13102          CTCATCTCTTCAGCCTGTGTGGACAGATTGGGACTCAAGGAGCAT---------GTCAAA
Sorex_araneus|5452                 CTTATCTCTTCAGCCTGTGTGGACAGACTGGGACTCAAGGAACAT---------GTCAAA
Loxodonta_africana|10680           CTCATCTCCTCAGCCTGTGTGGACAGATTGGGGCTTAAGGAGCAT---------GTCAAA
Ochotona_princeps|5743             CTCATCTCCTCAGCCTGCGTGGACAGATTGGGACTCAAGGAACAT---------GTCCGA
Cavia_porcellus|4856               CTCATATCCTCAGCCTGTGTGGACAGATTGGGACTCAAGGAGTAT---------GTTAAA
Tursiops_truncatus|1175            CTCATCTCTTCAGCCTGTGTGGACAGACTGGGACTCAAGGAGCAT---------GTCAGA
Equus_caballus|25060               CTCATCTCTTCAGCCTGTGTGGATAGACTGGGACTGAAGGAACAT---------GTTAAA
Myotis_lucifugus|14920             CTCATCTCTTCAGCCTGTGTGTATAGACTGGGACTCAAGGAGCAT---------GTCAAA
Pongo_abelii|4980                  CTCATCTCTTTGGCCTGTGTGGACAGATTAGGACTCAAGGAGCAT---------GTCAAA
Homo_sapiens|16897                 CTCATCTCTTTGGCCTGTGTGGACAGATTGGGACTCAAGGAGCAT---------GTCAAA
Callithrix_jacchus|37201           CTCATCTCTTCGGCCTGTGTGGATAGATTGGGACTCAAGGAGCAT---------GTCAAA
Gorilla_gorilla|25241              CTCATCTCTTTGGCCTGTGTGGACAGACTGGGACTCAAGGAGCAT---------GTCAAA
Pan_troglodytes|6422               CTCATCTCTTTGGCCTGTGTGGACAGATTGGGACTCAAGGAGCAT---------GTCAGA
Pteropus_vampyrus|2435             CTCATCTCTTCAGCCTGTGTGGATAGATTGGGACTCAAGGAGCAT---------GTCAGA
Otolemur_garnettii|14599           CTCATCTCTTCAGCCTGTGTGGACAGATTGGGACTCAAGGAACAT---------GTCAGA
Bos_taurus|5943                    CTCATCTCTTCAGCCTGTGTGGACAGACTGGGACTCAAGGAGCAT---------GTCAGA
Canis_familiaris|12357             CTCATCTCTTCAGCCTGTGTGGATAGACTGGGACTCAAGGAGCAT---------GTCAGA
Felis_catus|41335                  CTCATCTCTTCAGCCTGTGTGGATAGACTGGGACTCAAGGAGCAT---------GTCAGA
Tarsius_syrichta|10059             CTCATCTCTTCAGCCTGTGTGGACAGATTGGGACTCAAGGAGCAT---------GTCAAA
Tupaia_belangeri|5033              CTCATCTCCTCAGCTTGTGTGGACAGATTGGGACTCAAGGAGCAT---------GTGAAA
Vicugna_pacos|12023                CTCATCTCTTCAGCCTGTGTGGACAGGCTGGGACTCAAGGAGCAT---------GTCAAA
Gallus_gallus|16456                CTGATGTCAGCCGCCTGCCTGGACCGGCTGGGGTTGAGGGAACGC---------CTGGAA
Anolis_carolinensis|8198           ATCATATCATCTGCCTGTCTGGAAAGATTAGGGCTAAAGGAGCAT---------ATGAAA
Taeniopygia_guttata|11868          CTCATGtcctctgcctgcctggacAGGCTAGGGTTAAAGGAGCAT---------CTCAAA
                                                                     .    .               .    

Daphnia_pulex|17047                GCTGTCAAAAATAAGGAGAATCCATGGATGGTTGCTAGATCACTAACTAGAGTGATGGAT
Xenopus_tropicalis|1834            TCCTACAAGAAAGAGGAGGAGCCCCCCGCCCTCCCGTACAGCGTG---------------
Dasypus_novemcinctus|15056         TCTCACAAGCATGAAGATGAGAAGCTTTCT---CCTACCTGGCTC---------------
Procavia_capensis|14866            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------------
Ornithorhynchus_anatinus|27562     TCCTATAAGCACGATGGGGAGAAGGCCTCCCTGCCCCGGCATCTC---------------
Echinops_telfairi|2271             TCTCACAAGCATGAAGGGGAGAAGCTTGCTCTACCCCGGCATCTC---------------
Microcebus_murinus|5690            TCTCGTAAACATGAAGGAGAAAAGCTTTCTCTACCCCGGCATCTC---------------
Spermophilus_tridecemlineatus|2505 TCTCACAAGCATGAAGGAGAAAAGTTTTCTCTACCCCGACATCTC---------------
Monodelphis_domestica|24368        TCCCACAAACATGATGGGGAAAAGCTCTCCCTGCCCCGGAATCTC---------------
Macropus_eugenii|16357             TCCCACAAACATGATGGGGAGAAGCTCTCCCTGCCCCGGCATCTC---------------
Sus_scrofa|19730                   TCTCACAGGCTCGAGGGAGAGAAGCTCTGTCTCCCCCGGCATCTG---------------
Sus_scrofa|19736                   TCTCACAGGCTCGAGGGAGAGAAGCTCTGTCTCCCCCGGCATCTG---------------
Rhesus_macaque|13034               TCCCACAAGCATGAAGGAGAAAAGCTTTCTCTACCCCGGCATCTC---------------
Rattus_norvegicus|2890             TCCCATAAGCACGAAGGAGAAAAGCTTTCTCTACCCCGGCATCTC---------------
Mus_musculus|40149                 TCTCACAAGCATGAAGGGGAAAAGCTTTCTCTACCACGGCATCTC---------------
Dipodomys_ordii|10643              TCTCATAAGCATGAAGGAGAAAAGCTTTCTCTGCCCCGGCATCTC---------------
Erinaceus_europaeus|14979          TCTCACAAGCATGAAGGCGAGAAACTGTCTCTGCCCCGGCATCTG---------------
Choloepus_hoffmanni|13102          TCCCACAAGCATGAAGGAGAGAAGCTTTCTCTACCCCGGCATCTC---------------
Sorex_araneus|5452                 TCTCATAAGCATGAAGGAGAGAAACTTTCTCTACCCCGACATCTG---------------
Loxodonta_africana|10680           TCTCACAAACATGAAGTAGAGAAGCTTTCTCTACCCCGGCATCTC---------------
Ochotona_princeps|5743             TCTCACAAGCATGAAGGAGAAAAGCTTTCTCTTCCCCGGCATCTC---------------
Cavia_porcellus|4856               TCTCACAAGCATGAAGGAGAAAAGCTTTCTCTCCCCCGACATCTC---------------
Tursiops_truncatus|1175            TCTCACAAGCATGAAGGAGAGAAGCTTTCTCTACCCCGACATCTG---------------
Equus_caballus|25060               TCTCACAAGCATGAAGGAGAGAAGCTTTCTCTACCCCGGCATCTG---------------
Myotis_lucifugus|14920             TCTCACAAGCATGAAGGAGAGAAGCTGTCTCTACCCCGGCATCTG---------------
Pongo_abelii|4980                  TCCCACAAGCATGAAGGAGAAAAGCTTTCTCTACCCCGACATCTC---------------
Homo_sapiens|16897                 TCCCACAAGCATGAAGGAGAAAAGCTTTCTCTACCCCGGCATCTC---------------
Callithrix_jacchus|37201           TCCCACAAGCATGAAGGAGAAAAGCTTTCTCTACCCCGGCATCTC---------------
Gorilla_gorilla|25241              TCCCACAAGCATGAAGGAGAAAAGCTTTCTCTACCCCGGCATCTC---------------
Pan_troglodytes|6422               TCCCACAAGCATGAAGGAGAAAAGCTTTCTCTACCCCGGCATCTC---------------
Pteropus_vampyrus|2435             TCTCACAGGCATGAAGCAGAGAAGCTTTCTCTACCTCGGCATCTG---------------
Otolemur_garnettii|14599           TCTCATAAGCAT------GAAAAGCTTTCTCTACCCCGGCATCTT---------------
Bos_taurus|5943                    TCTCACAAGCATGAAGGAGAGAGGCTTTCTCTACCCCGGCATCTG---------------
Canis_familiaris|12357             TCTCACAAACATGAAGGAGAGAAGCTTTCTCTACCCCGGCATCTG---------------
Felis_catus|41335                  TCTCACAAGCATGAAGGAGAGAAACTTTCTCTACCCCGGCATCTG---------------
Tarsius_syrichta|10059             TCTCACAAGCATGAAGGAGAAAAGCTTTCTCTACCCCGGCACCTC---------------
Tupaia_belangeri|5033              TCTCACAAGCATGAAGGGGAAAAGCTTTCTCTACCCCGGCACCTC---------------
Vicugna_pacos|12023                TCTCATAAGCATGAAGGAGAGAAGCTTTCTCTACCCCGGCATCTC---------------
Gallus_gallus|16456                GTGCTCCCCAGTGAGGAGGAGGAGATCTCGTTGGCACACAGCGAG---------------
Anolis_carolinensis|8198           GCCTACAAGCCTGAGTGTGAGAAGATTTCATCGCCACCTAATATG---------------
Taeniopygia_guttata|11868          GCACTCCCTGCCGAAGAGGAGGTGGTTTCGTTGCCAAACAAGGTG---------------
                                                                                               

Daphnia_pulex|17047                GGATTTTCACTGGTGGAGATTACCAACATGGGTATTGGCCCATGGAAGGTTTGTAAAAAC
Xenopus_tropicalis|1834            ------------------------------------------------------------
Dasypus_novemcinctus|15056         ------------------------------------------------------------
Procavia_capensis|14866            ------------------------------------------------------------
Ornithorhynchus_anatinus|27562     ------------------------------------------------------------
Echinops_telfairi|2271             ------------------------------------------------------------
Microcebus_murinus|5690            ------------------------------------------------------------
Spermophilus_tridecemlineatus|2505 ------------------------------------------------------------
Monodelphis_domestica|24368        ------------------------------------------------------------
Macropus_eugenii|16357             ------------------------------------------------------------
Sus_scrofa|19730                   ------------------------------------------------------------
Sus_scrofa|19736                   ------------------------------------------------------------
Rhesus_macaque|13034               ------------------------------------------------------------
Rattus_norvegicus|2890             ------------------------------------------------------------
Mus_musculus|40149                 ------------------------------------------------------------
Dipodomys_ordii|10643              ------------------------------------------------------------
Erinaceus_europaeus|14979          ------------------------------------------------------------
Choloepus_hoffmanni|13102          ------------------------------------------------------------
Sorex_araneus|5452                 ------------------------------------------------------------
Loxodonta_africana|10680           ------------------------------------------------------------
Ochotona_princeps|5743             ------------------------------------------------------------
Cavia_porcellus|4856               ------------------------------------------------------------
Tursiops_truncatus|1175            ------------------------------------------------------------
Equus_caballus|25060               ------------------------------------------------------------
Myotis_lucifugus|14920             ------------------------------------------------------------
Pongo_abelii|4980                  ------------------------------------------------------------
Homo_sapiens|16897                 ------------------------------------------------------------
Callithrix_jacchus|37201           ------------------------------------------------------------
Gorilla_gorilla|25241              ------------------------------------------------------------
Pan_troglodytes|6422               ------------------------------------------------------------
Pteropus_vampyrus|2435             ------------------------------------------------------------
Otolemur_garnettii|14599           ------------------------------------------------------------
Bos_taurus|5943                    ------------------------------------------------------------
Canis_familiaris|12357             ------------------------------------------------------------
Felis_catus|41335                  ------------------------------------------------------------
Tarsius_syrichta|10059             ------------------------------------------------------------
Tupaia_belangeri|5033              ------------------------------------------------------------
Vicugna_pacos|12023                ------------------------------------------------------------
Gallus_gallus|16456                ------------------------------------------------------------
Anolis_carolinensis|8198           ------------------------------------------------------------
Taeniopygia_guttata|11868          ------------------------------------------------------------
                                                                                               

Daphnia_pulex|17047                CAACAAGTAGGTTGGTTTGAATACGAACCAACTATCGCAAACGCAATTTTATTG---GCC
Xenopus_tropicalis|1834            AAGCCCCTCGGGCAAGTAGAGCGCATGGCGGTGATGTTGGGCAACACTACAGTGGAGTGC
Dasypus_novemcinctus|15056         AAAATAGTGGGCTGGATTGAGCATCTAGTGACCCTGCTGGGCTCCCTTTGCCTTGGCTGC
Procavia_capensis|14866            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|27562     AGAGTTACTGGCCAAATCGAGCATCTGGCCCTCACCCTGGGCTCGCTCCGCCTCGACTGC
Echinops_telfairi|2271             AAGGTCGTGGGCCAGATTGAGCACCTCGTGATTACACTGGGCTCCCTCCGCCTGGACTGC
Microcebus_murinus|5690            AAAGTAGTGGGCCAGATTGAACACCTAGTGATCACACTGGGTTCCCTCCACCTGGACTGC
Spermophilus_tridecemlineatus|2505 AAAGTGGTGGGCCAGATAGAGCACCTAGTGATCACAATGGGCTCCCTGCGCCTGGACTGC
Monodelphis_domestica|24368        AAAGTGGTGGGACAGATTGAACACCTTGCACTTACCTTGGGATCCCTACGCCTGGACTGC
Macropus_eugenii|16357             AAAGTCGTGGGTCAGATTGAACACCTTGCACTTACTTTGGGATCCCTCCGCCTGGACTGC
Sus_scrofa|19730                   AAAGTGATGGGGCAGATTGAGCACCTGGTGATCACCCTGGGCTCCCTCCGCCTGGACTGC
Sus_scrofa|19736                   AAAGTGATGGGGCAGATTGAGCACCTGGTGATCACCCTGGGCTCCCTCCGCCTGGACTGC
Rhesus_macaque|13034               AAAGTAGTGGGCCAGATTGAACACCTAGTGATCACACTGGGCTCTCTCCGCCTGGACTGC
Rattus_norvegicus|2890             AAAGTAGTAGGCCAGATTGAGCACCTACTGATTACAGTGGGCTCTCTCCGCCTGGATTGC
Mus_musculus|40149                 AAAGTAGTTGGCCAGATTGAGCACCTAATGATCACAGTGGGTTCTCTCCGTCTGGATTGC
Dipodomys_ordii|10643              AAAGTAGTGGGCCAGATTGAGCACCTGGTGATCACAGTGGGCTCCCTCCGCCTGGACTTC
Erinaceus_europaeus|14979          AAAGTAGTGGGCCAAATTGAACACCTAGTAATCACACTGGGCTCCTTCCGGCTGGACTGT
Choloepus_hoffmanni|13102          AAAGTTGTGGGCCAGATTGAGCATCTAGTGATCACACTGGGATCCTTCCGCCTGGACAGC
Sorex_araneus|5452                 AAAGTGGTGGGACACATTGAACACTTAGTGATCACACTGGGCTCCCTCCGCCTAGACTGC
Loxodonta_africana|10680           AAAGTAGTGGGCCAGATTGAGCACCTAGTGATCACACTGGGCTCCCTCCGCTTGGACTGT
Ochotona_princeps|5743             AAAGTAGTGGGCCACATTGAGCACCTGGTAATCACACTAGGCTCCCTCCGCCTTGACTGC
Cavia_porcellus|4856               AAAGTAGTGGGTCAGATTGAACATCTAGTGATCACCCTGGGCTCCTTCCGCCTGGACTGC
Tursiops_truncatus|1175            AAAGTAGTGGGCCAGATTGAGCACCTAGTGATCACTCTGGGCTCCCTCCATCTGGACTGC
Equus_caballus|25060               AAAGTGGTGGGCCAGATTGAGCACCTAGCGATCACACTGGGCTCCCTCCGCCTGGACTGT
Myotis_lucifugus|14920             AAAGTAGTGGGGCAGATTGAGCACCTAGTGATCACACTGGGCTCCCTTTGCCTGGACTGC
Pongo_abelii|4980                  AAAGTAGTGGGCCAGATTGAGCACCTAGTGATCACACTGGGCTCCCTCCGCCTGGACTGC
Homo_sapiens|16897                 AAAGTAGTGGGCCAGATTGAGCACCTAGTGATCACACTGGGCTCCCTCCGCCTGGACTGC
Callithrix_jacchus|37201           AAAGTTGTGGGCCAGATTGAGCACCTGGTGATCACACTGGGCTCCCTCCGTCTGGACTGC
Gorilla_gorilla|25241              AAAGTAGTGGGCCAGATTGAGCACCTAGTGATCACACTGGGCTCCCTCCGCCTGGACTGC
Pan_troglodytes|6422               AAAGTAGTGGGCCAGATTGAGCACCTAGTGATCACACTGGGCTCCCTCCGCCTGGACTGC
Pteropus_vampyrus|2435             AAAGTAGTGGGCCAGATTGAGCACCTAGTGATCACATTGGGCTCCCTCCGCCTGGACTGC
Otolemur_garnettii|14599           AAAGTAGTGGGCCAGATTGAGCACCTAGTGATTACACTGGGTTCCCTCCGCCTGGACTGC
Bos_taurus|5943                    AAAGTTGTGGGCCAGATTGAGCACCTGGTGATCACACTGGGCTCCCTCCGCCTGGACTGC
Canis_familiaris|12357             AAAGTAGTGGGCCAGATTGAGCACCTGGTGATCACACTGGGCTCCCTCCGCCTGGACTGT
Felis_catus|41335                  AAAGTAGTGGGCCAGATTGAGCACCTGGTGATCACACTGGGTTCCCTCCGTCTGGACTGT
Tarsius_syrichta|10059             AAAGTAGTGGGCCAGATTGAGCACCTGGTGATCACACTGGGTTCCTTCCGCCTGGACTGC
Tupaia_belangeri|5033              AAAGTAGTGGGCCAGATTGAGCACCTTGTGATCACACTGGGCTCCCTCCGCCTGGACTGC
Vicugna_pacos|12023                AAAGTAGTGGGCCAGATTGAGCACCTAGTGATCACACTGGGCTCCCTCCGCCTAGACTGT
Gallus_gallus|16456                AGGGTGATCGGCCGCATCGACCGCCTGGTGCTGGCGGTGGGAGCGCTCCGCGTGGAGTGC
Anolis_carolinensis|8198           AAAGTGATTGGCTACATAGAGCATCTATCTCTTACCCTGGGCACCCTCCTTGTGGATTGT
Taeniopygia_guttata|11868          AAAGCCATCGGGCAGATTGAGTGTCTGTCCCTCACAGTGGGAGCGGTCCCCGTGGAGTGC
                                            ..     . .                                 .       

Daphnia_pulex|17047                GCAGCGATAGAAGTGGAAGACGTTCCACGTAATGCAAATTGTGGAGTTGGATTAAATGAA
Xenopus_tropicalis|1834            TCAGCCATAGTAATAGATAATAATGACAGAAATTTCTCACTTGGGCTC------------
Dasypus_novemcinctus|15056         CCAGTGGCTGTAACT---------------------------------------------
Procavia_capensis|14866            NNNNNNNNNNNNNNNNAGGACAATGAGAAAAACTTGTCCCTTGGTCTC------------
Ornithorhynchus_anatinus|27562     TCGGCCGCTGTCGTTGACGATAACGAGAAAACCCTGTCTCTGGGATTA------------
Echinops_telfairi|2271             CCAGCAGCTGTGGTT---------------------------------------------
Microcebus_murinus|5690            CCAGCAACTGTGGTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------
Spermophilus_tridecemlineatus|2505 CCAGCAGCTGTGGTTGAGGACAATGAGAAAAACTTGTCTCTTGATCTC------------
Monodelphis_domestica|24368        CCAGCAGCTGTGGTTGAGGACAATGAGAAAAATCTTACTCTTGGGCTC------------
Macropus_eugenii|16357             CCAGCGGCTGTGGTCGAGGACAATGACAAAACTCTCACTCTTGGGCTC------------
Sus_scrofa|19730                   CCAGCAGCTGTGGTTGAGGACAATGAGAAAACCTTGTCTCTTGGTCTC------------
Sus_scrofa|19736                   CCAGCAGCTGTGGTTGAGGACAATGAGAAAACCTTGTCTCTTGGTCTC------------
Rhesus_macaque|13034               CCAGCAGCTGTGgtggagcagagatcgcgccactgcactccagcctgg------------
Rattus_norvegicus|2890             CCAGCAGCTGTGGTTGATGACAATGAAAAAAGCTTGTCACTTGGTCTC------------
Mus_musculus|40149                 CAAGCAGCTGTGGTTGATGATAATGAAAAAAGCTTATCACTTGGTCTC------------
Dipodomys_ordii|10643              CCAGCAGCTGTGGTTGAGGATAATGAAAAAAACTTATCTCTTGGTCTC------------
Erinaceus_europaeus|14979          CCAGCAGCTGTGGTTGAGGACAATGAGAAAAGTTTGTCACTTGGTCTT------------
Choloepus_hoffmanni|13102          CCAGCAGCTGTAATTGATGACAATGAGAAAAACTTGTCCCTTGGTCTC------------
Sorex_araneus|5452                 CCAGCAGTTGTGATTGATGATAATGAGAAAAATTTGTCCCTGGGCCTC------------
Loxodonta_africana|10680           GCAGCAGCTGTGGTTGAGGACAATGAGAAAAACTTGTCCCTTGGTCTC------------
Ochotona_princeps|5743             CCAGCAGCTGTGGTTGAGGACAATGAAAAAAACCTGTCCCTTGGGCTC------------
Cavia_porcellus|4856               CCAGCAGCTGTGGTTGAGGACAATGAGAAAAACTTGTCTCTTGGTCTC------------
Tursiops_truncatus|1175            CCAGCAGCCGTGGTTGAGGACAATGAGAAAAACTTGTCCCTTGGTCTC------------
Equus_caballus|25060               GCAGCAGCTGTGGTTGAGGACAGTGAGAAAAACTTGTCCCTTGGCCTC------------
Myotis_lucifugus|14920             CCAGCAGCAGTGGTTGAGGACAATGAGAAGAACTTATCCCTTGGTCTC------------
Pongo_abelii|4980                  CCAGCAGCTGTGGTTGATGACAATGAGAAAAACTTGTCCCTTGGTCTA------------
Homo_sapiens|16897                 CCAGCAGCTGTGGTTGATGACAATGAGAAAAACTTGTCCCTTGGTCTA------------
Callithrix_jacchus|37201           CCAGCAGCTGTGGTCGATGACAATGAGAAAAACTTGTCCCTTGGTCTG------------
Gorilla_gorilla|25241              CCAGCAGCTGTGGTTGACGACAATGAGAAAAACTTGTCCCTTGGTCTA------------
Pan_troglodytes|6422               CCAGCAGCTGTGGTTGATGACAATGAGAAAAACTTGTCCCTTGGTCTA------------
Pteropus_vampyrus|2435             CCAGCAGCTGTGGTTGAAGACAATGAGAAAAACTTGTCTCTTGGTCTC------------
Otolemur_garnettii|14599           CCAGCAGCTGTGGTC---GACAATGAAAAAAACTTGTCCCTTGGTCTA------------
Bos_taurus|5943                    CCAGCAGCTGTGGTTGAGGATAATGAGAAGAATTTGTCTCTTGGTCTG------------
Canis_familiaris|12357             CCAGCAGCTGTGGTTGAGGACAATGAGAAAAATATATCCCTTGGTCTC------------
Felis_catus|41335                  CCAGCAGCTGTGGTTGAGGACAATGAGAAAAACTTGTCCCTTGGTCTC------------
Tarsius_syrichta|10059             CCAGCAGCTGTGGTTGAGGACAATGAGAAAAACCTGTCCCTTGGTCTC------------
Tupaia_belangeri|5033              CCAGCAGCTGTGGTTGAGGACAATGAGAAAAACTTGTCCCTTGGTCTC------------
Vicugna_pacos|12023                CCAGCAGCTGTGGTTGAGGACAATGAGAAAAACTTGTCCCTTGGTCTC------------
Gallus_gallus|16456                GCAGCGCTCGTGGTGGAAGACAGTGAGAAACCCTTCTCCTTTGGCCTG------------
Anolis_carolinensis|8198           TCTGCAATTGTGACAGAGGATCATGAGAAAAACTTTTCCCTGGGGCTA------------
Taeniopygia_guttata|11868          GCTGCCCTCGTTGTGGaagacaATGACCAACCCTTTTCCTTTGGGCTG------------
                                      .     .                                                  

Daphnia_pulex|17047                GAGTGCACAACCACTCCACGACGACTAATGGCTGAAGAAGAAAAGGCATGCAAAGGAAAT
Xenopus_tropicalis|1834            ------------------------------------------------------------
Dasypus_novemcinctus|15056         ------------------------------------------------------------
Procavia_capensis|14866            ------------------------------------------------------------
Ornithorhynchus_anatinus|27562     ------------------------------------------------------------
Echinops_telfairi|2271             ------------------------------------------------------------
Microcebus_murinus|5690            ------------------------------------------------------------
Spermophilus_tridecemlineatus|2505 ------------------------------------------------------------
Monodelphis_domestica|24368        ------------------------------------------------------------
Macropus_eugenii|16357             ------------------------------------------------------------
Sus_scrofa|19730                   ------------------------------------------------------------
Sus_scrofa|19736                   ------------------------------------------------------------
Rhesus_macaque|13034               ------------------------------------------------------------
Rattus_norvegicus|2890             ------------------------------------------------------------
Mus_musculus|40149                 ------------------------------------------------------------
Dipodomys_ordii|10643              ------------------------------------------------------------
Erinaceus_europaeus|14979          ------------------------------------------------------------
Choloepus_hoffmanni|13102          ------------------------------------------------------------
Sorex_araneus|5452                 ------------------------------------------------------------
Loxodonta_africana|10680           ------------------------------------------------------------
Ochotona_princeps|5743             ------------------------------------------------------------
Cavia_porcellus|4856               ------------------------------------------------------------
Tursiops_truncatus|1175            ------------------------------------------------------------
Equus_caballus|25060               ------------------------------------------------------------
Myotis_lucifugus|14920             ------------------------------------------------------------
Pongo_abelii|4980                  ------------------------------------------------------------
Homo_sapiens|16897                 ------------------------------------------------------------
Callithrix_jacchus|37201           ------------------------------------------------------------
Gorilla_gorilla|25241              ------------------------------------------------------------
Pan_troglodytes|6422               ------------------------------------------------------------
Pteropus_vampyrus|2435             ------------------------------------------------------------
Otolemur_garnettii|14599           ------------------------------------------------------------
Bos_taurus|5943                    ------------------------------------------------------------
Canis_familiaris|12357             ------------------------------------------------------------
Felis_catus|41335                  ------------------------------------------------------------
Tarsius_syrichta|10059             ------------------------------------------------------------
Tupaia_belangeri|5033              ------------------------------------------------------------
Vicugna_pacos|12023                ------------------------------------------------------------
Gallus_gallus|16456                ------------------------------------------------------------
Anolis_carolinensis|8198           ------------------------------------------------------------
Taeniopygia_guttata|11868          ------------------------------------------------------------
                                                                                               

Daphnia_pulex|17047                TCAGCTCATGGTGATTCAAAGGAAGAGAAACCCTCACAAAACCTGCAGGAAGATATTAAA
Xenopus_tropicalis|1834            ------------------------------------------------------------
Dasypus_novemcinctus|15056         ------------------------------------------------------------
Procavia_capensis|14866            ------------------------------------------------------------
Ornithorhynchus_anatinus|27562     ------------------------------------------------------------
Echinops_telfairi|2271             ------------------------------------------------------------
Microcebus_murinus|5690            ------------------------------------------------------------
Spermophilus_tridecemlineatus|2505 ------------------------------------------------------------
Monodelphis_domestica|24368        ------------------------------------------------------------
Macropus_eugenii|16357             ------------------------------------------------------------
Sus_scrofa|19730                   ------------------------------------------------------------
Sus_scrofa|19736                   ------------------------------------------------------------
Rhesus_macaque|13034               ------------------------------------------------------------
Rattus_norvegicus|2890             ------------------------------------------------------------
Mus_musculus|40149                 ------------------------------------------------------------
Dipodomys_ordii|10643              ------------------------------------------------------------
Erinaceus_europaeus|14979          ------------------------------------------------------------
Choloepus_hoffmanni|13102          ------------------------------------------------------------
Sorex_araneus|5452                 ------------------------------------------------------------
Loxodonta_africana|10680           ------------------------------------------------------------
Ochotona_princeps|5743             ------------------------------------------------------------
Cavia_porcellus|4856               ------------------------------------------------------------
Tursiops_truncatus|1175            ------------------------------------------------------------
Equus_caballus|25060               ------------------------------------------------------------
Myotis_lucifugus|14920             ------------------------------------------------------------
Pongo_abelii|4980                  ------------------------------------------------------------
Homo_sapiens|16897                 ------------------------------------------------------------
Callithrix_jacchus|37201           ------------------------------------------------------------
Gorilla_gorilla|25241              ------------------------------------------------------------
Pan_troglodytes|6422               ------------------------------------------------------------
Pteropus_vampyrus|2435             ------------------------------------------------------------
Otolemur_garnettii|14599           ------------------------------------------------------------
Bos_taurus|5943                    ------------------------------------------------------------
Canis_familiaris|12357             ------------------------------------------------------------
Felis_catus|41335                  ------------------------------------------------------------
Tarsius_syrichta|10059             ------------------------------------------------------------
Tupaia_belangeri|5033              ------------------------------------------------------------
Vicugna_pacos|12023                ------------------------------------------------------------
Gallus_gallus|16456                ------------------------------------------------------------
Anolis_carolinensis|8198           ------------------------------------------------------------
Taeniopygia_guttata|11868          ------------------------------------------------------------
                                                                                               

Daphnia_pulex|17047                ATTAAGGGTTCTGGTCCGATGCATTGTAAAGAAAGCAAAAGTGTTCGCTTTCTTATTGAT
Xenopus_tropicalis|1834            ---------------------------CAGACCTTGAAGTCTCTGAAGTGCGTCATTAAC
Dasypus_novemcinctus|15056         ---------------------------------------------------------AAC
Procavia_capensis|14866            ---------------------------CAGACACTGCGATCCCTAAAGTGTATCATAAAT
Ornithorhynchus_anatinus|27562     ---------------------------CAGACACTACGATCCCTGAAGTGCGTCATAAAT
Echinops_telfairi|2271             ------------------------------------------------------------
Microcebus_murinus|5690            ---------------------------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|2505 ---------------------------CAAACTCTCCGATCCCTGAAGTGTATCATAAAT
Monodelphis_domestica|24368        ---------------------------CAGACTCTGCGGTCCTTAAAGTGTATCATAAAC
Macropus_eugenii|16357             ---------------------------CAAACTCTTCGGTCCTTGAAGTGCATCATAAAC
Sus_scrofa|19730                   ---------------------------CAGACTCTCCGATCTCTGAAGTGTGTCATAAAC
Sus_scrofa|19736                   ---------------------------CAGACTCTCCGATCTCTGAAGTGTGTCATAAAC
Rhesus_macaque|13034               ---------------------------gcaacaagagtgcaactccatTGCATCATAAAC
Rattus_norvegicus|2890             ---------------------------CAGACTCTTCGATCCCTGAAGTGTATCATAAAC
Mus_musculus|40149                 ---------------------------CAGACTCTTAGATCCCTGAAGTGCATCATAAAC
Dipodomys_ordii|10643              ---------------------------CAGACACTCCGATCACTGAAGTGTATCATAAAC
Erinaceus_europaeus|14979          ---------------------------CAGACTCTCCGATCACTGAAGTGCATCATAAAC
Choloepus_hoffmanni|13102          ---------------------------CAGACTCTCCGATCCCTGAAGGGCATCATAAAC
Sorex_araneus|5452                 ---------------------------CAGACTCTCCGATCACTCAAGTGCATCATAAAC
Loxodonta_africana|10680           ---------------------------CAGACACTCCGATCCCTGAAGTGTATCATAAAT
Ochotona_princeps|5743             ---------------------------CAAACTCTCCGATCACTGAAGTGCATCATAAAC
Cavia_porcellus|4856               ---------------------------CAGACTCTCCGATCCCTGAAGTGTATCATAAAC
Tursiops_truncatus|1175            ---------------------------CAGACTCTCCGATCCCTGAAGTGCATCATAAAC
Equus_caballus|25060               ---------------------------CAGACGCTCCGATCTCTGAAGTGCATCATAAAC
Myotis_lucifugus|14920             ---------------------------CAGACTCTCCGATCTTTGAAGTGCATCATAAAC
Pongo_abelii|4980                  ---------------------------CAGACTCTCCGATCTCTGAAGTGCATCATAAAC
Homo_sapiens|16897                 ---------------------------CAGACTCTCCGATCTCTGAAGTGCATCATAAAC
Callithrix_jacchus|37201           ---------------------------CAGACTCTCCGATCTCTGAAGTGTATCATAAAC
Gorilla_gorilla|25241              ---------------------------CAGACTCTCCGATCTCTGAAGTGCATCATAAAC
Pan_troglodytes|6422               ---------------------------CAGACTCTCCGATCTCTGAAGTGCATCATAAAC
Pteropus_vampyrus|2435             ---------------------------CAGACTCTCCGATCCCTGAAGTGCATCATAAAC
Otolemur_garnettii|14599           ---------------------------CAGACTCTTCGATCCCTGAAGTGTATCATAAAC
Bos_taurus|5943                    ---------------------------CAGACTCTCCGATCCTTGAAGTGCATCATAAAC
Canis_familiaris|12357             ---------------------------CAGACTCTCCGATCCCTTAAGTGCATCATAAAT
Felis_catus|41335                  ---------------------------CAGACTCTCCGATCCCTTAAGTGCATAATAAAT
Tarsius_syrichta|10059             ---------------------------CAGACTCTCCGATCCCTTAAGTGCATCATAAAC
Tupaia_belangeri|5033              ---------------------------CAGACTCTTCGATCTCTGAAGTGCATCATAAAC
Vicugna_pacos|12023                ---------------------------CAGACTCTCCGATCCCTGAAGTGCATCATAAAC
Gallus_gallus|16456                ---------------------------CAGACACTGAAGTCCCTGAAGTGTGTCATAAAC
Anolis_carolinensis|8198           ---------------------------CAGACCCTGAAGTCTTTGAAGTGTGTGATAAAC
Taeniopygia_guttata|11868          ---------------------------CAGACACTGAAGTCTCTGAAGTGTGTCATAAAC
                                                                                               

Daphnia_pulex|17047                CCAGCCAATGGAAAATGCCAAAGTGGCAGGAAAACCGATAGTTATCCTAATGGTTGTAAA
Xenopus_tropicalis|1834            CTGGAACAGAATCAGATCGAAGTCGGACGG------------------------------
Dasypus_novemcinctus|15056         CTCAATAAGCACGGGCTGACCATGCGGAAT------------------------------
Procavia_capensis|14866            CTGGATAAGCACCGTTTGATCATGGGGAAG------------------------------
Ornithorhynchus_anatinus|27562     CTGGAGAAGCGGCACCTCGTCGTGGGGAAG------------------------------
Echinops_telfairi|2271             ------------------------------------------------------------
Microcebus_murinus|5690            NNNNNNNNNNNNCAGCTGATCATGGGAAAG------------------------------
Spermophilus_tridecemlineatus|2505 TTGGATAAGCACCGGCTGATCATGGGGAAG------------------------------
Monodelphis_domestica|24368        CTGGACAAGCAGCGTCTCATCATGGGGAAG------------------------------
Macropus_eugenii|16357             CTAGACAAGCAGCGTCTCATCATGGGGAAG------------------------------
Sus_scrofa|19730                   TTGGACAAGCACCGGCTGATCGTGGGGAAG------------------------------
Sus_scrofa|19736                   TTGGACAAGCACCGGCTGATCGTGGGGAAG------------------------------
Rhesus_macaque|13034               TTGGATAAACACCGGCTGATCATGGGGAAG------------------------------
Rattus_norvegicus|2890             TTGGACAAGCACCGGCTGATGGTGGGGAAG------------------------------
Mus_musculus|40149                 TTGGACAAGCACCGGCTGATTGTGGGGAAG------------------------------
Dipodomys_ordii|10643              ---GATAAGCACCGGCTGACCGTGGGGAAA------------------------------
Erinaceus_europaeus|14979          TTAGACAAGCACCGGCTGATTATGGGGAAG------------------------------
Choloepus_hoffmanni|13102          CTGGATAAGCACAGGCTGATCATAGGGAAG------------------------------
Sorex_araneus|5452                 TTGGATAAGCACCGGCTGATCATGGGGAAG------------------------------
Loxodonta_africana|10680           CTGGATAAGCACCAGCTGATCATGGGGAAG------------------------------
Ochotona_princeps|5743             TTGGATAATCATCGGCTGATCATGGGGAAG------------------------------
Cavia_porcellus|4856               TTGGATAAGCACCGACTGATCATGGGGAAG------------------------------
Tursiops_truncatus|1175            TTGGATAAGCACCGGCTGATCATGGGGAAG------------------------------
Equus_caballus|25060               TTGGATAAGCACCGGCTGATCATGGGGAAG------------------------------
Myotis_lucifugus|14920             TTGGATAAGCACCAGCTGATCATGGGGAAA------------------------------
Pongo_abelii|4980                  TTGGATAAGCACCGGCTGATCATGGGGAAG------------------------------
Homo_sapiens|16897                 TTGGATAAGCACCGGCTGATCATGGGGAAG------------------------------
Callithrix_jacchus|37201           TTGGATAAGCACCGGCTGATCATGGGGAAG------------------------------
Gorilla_gorilla|25241              TTGGATAAGCACCGGCTGATCATGGGGAAG------------------------------
Pan_troglodytes|6422               TTGGATAAGCACCGGCTGATCATGGGGAAG------------------------------
Pteropus_vampyrus|2435             TTGGATAAACACCGGCTGATCATGGGGAAG------------------------------
Otolemur_garnettii|14599           TTGGATAAGCAGCGGCTGATCATGGGGAAG------------------------------
Bos_taurus|5943                    TTGGATAAGCACCGGCTGATCATGGGAAAG------------------------------
Canis_familiaris|12357             TTGGATAAGCACCGGCTGATCATGGGGAAG------------------------------
Felis_catus|41335                  TTGGATAAGCACCGACTGATCATGGGGAAG------------------------------
Tarsius_syrichta|10059             TTAGATAAGCACCGGCTGATCATGGGGAAG------------------------------
Tupaia_belangeri|5033              TTGGATAAACACCGGCTGATCATGGGGAAG------------------------------
Vicugna_pacos|12023                TTGGATAAGCACCGGCTGATCATGGGGAAG------------------------------
Gallus_gallus|16456                TTGGAGAAGCACCATCTTGTCCTGGGCAAG------------------------------
Anolis_carolinensis|8198           ATGGAGAAGCATCATTTGGTCCTGGGGAAG------------------------------
Taeniopygia_guttata|11868          ATGGAGAAGCACCACCTGGTTCTGGGGCAG------------------------------
                                                                                               

Daphnia_pulex|17047                GGATGTAAATGGCTGAGAAAGAATACAGGTGAAGTACAAGTTCTTGCTACGGAA---GAT
Xenopus_tropicalis|1834            ------------------------------------------------ACAGAA------
Dasypus_novemcinctus|15056         ------------------------------------------------AGAGAA---AAG
Procavia_capensis|14866            ------------------------------------------------ACAGAC---AAA
Ornithorhynchus_anatinus|27562     ------------------------------------------------ACAGAC---CGA
Echinops_telfairi|2271             ------------------------------------------------------------
Microcebus_murinus|5690            ------------------------------------------------GCAGGC---AAG
Spermophilus_tridecemlineatus|2505 ------------------------------------------------TTAAAG---AGG
Monodelphis_domestica|24368        ------------------------------------------------GTAGAG---AAG
Macropus_eugenii|16357             ------------------------------------------------GTAGAG---AAG
Sus_scrofa|19730                   ------------------------------------------------ACAGAC---AAG
Sus_scrofa|19736                   ------------------------------------------------ACAGAC---AAG
Rhesus_macaque|13034               ------------------------------------------------ACAGAC---AAG
Rattus_norvegicus|2890             ------------------------------------------------ACAGAC---AAA
Mus_musculus|40149                 ------------------------------------------------ACAGAC---AAA
Dipodomys_ordii|10643              ------------------------------------------------ACAGAT---AAA
Erinaceus_europaeus|14979          ------------------------------------------------ACAGAG---AAG
Choloepus_hoffmanni|13102          ------------------------------------------------ACAGAC---AAG
Sorex_araneus|5452                 ------------------------------------------------ACAGAC---AAG
Loxodonta_africana|10680           ------------------------------------------------ACAGAC---AAA
Ochotona_princeps|5743             ------------------------------------------------ACAGAC---AAA
Cavia_porcellus|4856               ------------------------------------------------ACTGAC---AAA
Tursiops_truncatus|1175            ------------------------------------------------ACAGAC---AAG
Equus_caballus|25060               ------------------------------------------------ACAGATAAGAAA
Myotis_lucifugus|14920             ------------------------------------------------ACAGAC---AAA
Pongo_abelii|4980                  ------------------------------------------------ACAGAC---AAG
Homo_sapiens|16897                 ------------------------------------------------ACAGAC---AAG
Callithrix_jacchus|37201           ------------------------------------------------ACAGAC---AAG
Gorilla_gorilla|25241              ------------------------------------------------ACAGAC---AAG
Pan_troglodytes|6422               ------------------------------------------------ACAGAC---AAG
Pteropus_vampyrus|2435             ------------------------------------------------ACAGAT---AAG
Otolemur_garnettii|14599           ------------------------------------------------ACAGAC---AAG
Bos_taurus|5943                    ------------------------------------------------ACAGAC---AAG
Canis_familiaris|12357             ------------------------------------------------ACAGAC---AAA
Felis_catus|41335                  ------------------------------------------------ACAGAC---AAG
Tarsius_syrichta|10059             ------------------------------------------------ACAGAC---AAG
Tupaia_belangeri|5033              ------------------------------------------------ACAGAC---AAA
Vicugna_pacos|12023                ------------------------------------------------ACAGAC---AAG
Gallus_gallus|16456                ------------------------------------------------ACGGAG---AGG
Anolis_carolinensis|8198           ------------------------------------------------ACAAAC---AGG
Taeniopygia_guttata|11868          ------------------------------------------------ATGGAC---AGG
                                                                                               

Daphnia_pulex|17047                GTCATGGTCAACAAAGTTGATGAA---ACTAAACTCAACGAAGAT---GAATTGGAGAAA
Xenopus_tropicalis|1834            ---ATCATCCCGTTCATTATCCGA---AACACAGTCAGGGAAGAT---CAGCCGTCGGAG
Dasypus_novemcinctus|15056         GAAGAAATCCCTTGTGTAGAGACA---GTTTCTTTGAATGAAGAC---AACACTTCCGAA
Procavia_capensis|14866            GAAGAAATCCCTTTTGTGGAGACA---GTGTCCTTCAATGAAGAC---------------
Ornithorhynchus_anatinus|27562     GAGGAAATCCCATTTGTGGAGAGCAAGGTCCCCTCGAATGAAGAC---AACACTTCTGAG
Echinops_telfairi|2271             ------------------------------------------------------------
Microcebus_murinus|5690            GAAGAAATCCCTGTG------ACG---TTTTCTTTGAATGAAGAC---AACACTTCAGAA
Spermophilus_tridecemlineatus|2505 GAAGAAATCCCTTTTGTGGAGACA---GTTTCTTTTTATGAAGAC---AACACTTCAGAA
Monodelphis_domestica|24368        GAAGAGATCCCCTTTGTGGAGACT---GTGTCTGGGAGTGAAGAT---AACACGTCAGAG
Macropus_eugenii|16357             GAAGAGATCCCCTTTGTGGAGACT---GTGTCTGGGAGTGAAGAT---AACACATCAGAG
Sus_scrofa|19730                   GAAGGGATCCCTTTTGTGGAGACG---GTTGCCGTGAATGAAGAC---AAG---------
Sus_scrofa|19736                   GAAGGGATCCCTTTTGTGGAGACG---GTTGCCGTGAATGAAGAC---AACACTTCAGAA
Rhesus_macaque|13034               GAAGAAATCCCTTTTGTGGAGACA---GTCTCTTTGAATGAAGAC---AACACTTCAGAA
Rattus_norvegicus|2890             GAAGAAATTCCTTTTGTGGAGACA---GTTTCTGTGAATGATGAC---AACACCTCAGAA
Mus_musculus|40149                 GAAGAAATCCCTTTTGTGGAGACA---GTTTCTGTGAATGACGAC---AACACTTCAGAA
Dipodomys_ordii|10643              GAAGAAATC---TTTGTGGAGACA---ATTTCATTGAATGAAGAC---AACACTTCAGAA
Erinaceus_europaeus|14979          GAAGAAATCCCTTTTGTGGAGACA---GTTTCCTTGAATGAAGAC---AAC---------
Choloepus_hoffmanni|13102          GAAGAAATCCCTTTTGTAGAGCCA---GTTTCCTTGAATGAAGAC---AACACTTCTGAA
Sorex_araneus|5452                 GAAGAAATACCTTTTGTGGAGACA---CTTTCTTTGAATGAAGAC---AACACTTCAGAA
Loxodonta_africana|10680           GAAGAAATCCCTTTTGTGGAGACT---GTTTCCTTGAATGAAGAC---AACACTTCAGAA
Ochotona_princeps|5743             GAAGAAATCCCTTTTGTGGAGACA---GTTACTTTGAATGAAGAC---AACACTTCAGAG
Cavia_porcellus|4856               GAAGAAATCCCTTTTGTGGAGACC---ATTTCCTTGAATGAAGAC---AACACTTCAGAA
Tursiops_truncatus|1175            CAAGAAATCCCTTTTGAGGAGACA---GTTTCCTTGAATGAAGAC---AACACTTCAGAA
Equus_caballus|25060               GAAGAAATCCCTTTTGTGGAGACA---GTTTCCTTGAATGAAGAC---AACACTTCAGAA
Myotis_lucifugus|14920             GAAGAAATCCCTTTTGTGGAGACA---GTTTCTTTGAATGAAGAC---AACACTTCAGAA
Pongo_abelii|4980                  GAAGAAATCCCTTTTGTAGAGACA---GTCTCTTTGAATGAAGAC---AACACTTCAGAA
Homo_sapiens|16897                 GAAGAAATCCCTTTTGTGGAGACA---GTCTCTTTGAATGAAGAC---AAAACTAATTCA
Callithrix_jacchus|37201           GAAGAAATCCCTTTTGTGGAGACA---GTCTTTTTGAATGAAGAC---AACACTTCAGAA
Gorilla_gorilla|25241              GAAGAAATCCCTTTTGTGGAGACA---GTCTCTTTGAATGAAGAC---AACACTTCAGAA
Pan_troglodytes|6422               GAAGAAATCCCTTTTGTGGAGACA---GTCTCTTTGAATGAAGAC---AACACTTCAGAA
Pteropus_vampyrus|2435             GAAGAAATCCCTTTTGTGGAGGCA---GTTTCCTTGAATGAAGAC---AACACTTCAGAA
Otolemur_garnettii|14599           GAAGAAATCCCTTTTGTGGAGACA---TTTTCTTTGAAGGAAGAC---AACACTTCAGAA
Bos_taurus|5943                    GAAGAAATCCCTTTTGTGGAGACA---ATTTCCTTGAATGAAGAT---AACACTTCAGAA
Canis_familiaris|12357             GAAGAAATCCCTTTTGTGGAGACA---GTTTCCTTGAATGAAGAC---AACACTTCAGAA
Felis_catus|41335                  GAAGAAATCCCTTTTGTGGAGACA---GTTTCCTTGAATGAAGAC---AACACTTCAGAA
Tarsius_syrichta|10059             GAAGAAATCCCTTTTGTGGAGACA---GTTTCTTTGAATGAAGAC---AACACTTCAGAA
Tupaia_belangeri|5033              GAAGAAATCCCTTTTGTGGAGACA---GTTTCTTTGAATGATGAC---AATACTTCAGAA
Vicugna_pacos|12023                GAAGAAATCCCTTTTGTGGAGACA---GTTTCCTTGAATGAAGAC---AACACTTCAGAA
Gallus_gallus|16456                GAGGAAATCCCGTTTGTGGACAGC---GTTGGCGCTGGGGCAGGAGAGCACACTTTGGAA
Anolis_carolinensis|8198           GAAGAAATCCCTTTTGCCACTAAC---ACCTCTGCACAAGAAGAG---------------
Taeniopygia_guttata|11868          GAAGAAATCCCGTTTGTG------------------------------------------
                                                                                               

Daphnia_pulex|17047                GAG---
Xenopus_tropicalis|1834            GTGTAA
Dasypus_novemcinctus|15056         GTATAA
Procavia_capensis|14866            ------
Ornithorhynchus_anatinus|27562     GCGTAA
Echinops_telfairi|2271             ------
Microcebus_murinus|5690            GCATAA
Spermophilus_tridecemlineatus|2505 GCATAA
Monodelphis_domestica|24368        GCATAA
Macropus_eugenii|16357             GCATAA
Sus_scrofa|19730                   ------
Sus_scrofa|19736                   GCATAA
Rhesus_macaque|13034               GCATAA
Rattus_norvegicus|2890             GCATAA
Mus_musculus|40149                 GCATAA
Dipodomys_ordii|10643              GCATAA
Erinaceus_europaeus|14979          ------
Choloepus_hoffmanni|13102          GCGTAA
Sorex_araneus|5452                 GCATAA
Loxodonta_africana|10680           GCATAA
Ochotona_princeps|5743             GCATAA
Cavia_porcellus|4856               GCATAA
Tursiops_truncatus|1175            GCATAA
Equus_caballus|25060               GCATAA
Myotis_lucifugus|14920             GCATAA
Pongo_abelii|4980                  GCATAA
Homo_sapiens|16897                 ACT---
Callithrix_jacchus|37201           GCATAA
Gorilla_gorilla|25241              GCATAA
Pan_troglodytes|6422               GCATAA
Pteropus_vampyrus|2435             GCATAA
Otolemur_garnettii|14599           GCATAA
Bos_taurus|5943                    GCCTAA
Canis_familiaris|12357             GCATAA
Felis_catus|41335                  GCATAA
Tarsius_syrichta|10059             GCATAA
Tupaia_belangeri|5033              GCATAA
Vicugna_pacos|12023                GCATAA
Gallus_gallus|16456                GCA---
Anolis_carolinensis|8198           ------
Taeniopygia_guttata|11868          ------
                                         

multiple sequence alignment in CLUSTALW format


Daphnia_pulex|30339                ---QVAAPIPVSSNEGDVNDGKGEGGKLQCARIGVRIGKDKVDAL--VDSCASVSLVSFD
Xenopus_tropicalis|23769           ------------------------------------------------------------
Dasypus_novemcinctus|13306         ------------------------------------------------------------
Procavia_capensis|13907            -----------MFYSGLLTEGGRKETDMREAA-SLRQQRRMKQAV-QFIHKDSADLLPLD
Ornithorhynchus_anatinus|8013      ------------------------------------------------------------
Echinops_telfairi|1803             ------------------------------------------------------------
Microcebus_murinus|4834            ------------------------------------------------------------
Spermophilus_tridecemlineatus|2245 -----------MFYSGLLTEGGRKETEMREAA-SLRQQRRMKQAV-QFIHKDSADLLPLD
Monodelphis_domestica|11591        LNKLSVIPGSATACKGLLTEGGRKEADMREAA-SLRQQRRVKQAV-QFIHKDSADLLPLD
Macropus_eugenii|14917             -----------MFYSGLLTEGGRKEAEMREAA-SLRQQRRMKQAV-QFIHKDSADLLPLD
Sus_scrofa|15446                   -----------MFYSGLLTEGGRKETDMREAA-SLRQQRRMKQAV-QFIHKDSADLLPLD
Sus_scrofa|15452                   -----------MFYSGLLTEGGRKETDMREAA-SLRQQRRMKQAV-QFIHKDSADLLPLD
Rhesus_macaque|15777               -----------MFYSGLLTEGGRKETDMREAA-SLRQQRRMKQAV-QFIHKDSADLLPLD
Rattus_norvegicus|28309            MAQLSVIPGSAAAWTGLLTEGGRKETDMREAA-SLRQQRRMKQAV-QFIHKDSADLLPLD
Mus_musculus|22573                 MAQLSVIPGSAAAWTGLLTEGGRKETDMREAA-SLRQQRRMKQAV-QFIHKDSADLLPLD
Dipodomys_ordii|9993               ------------------------------------------------------------
Erinaceus_europaeus|12316          -----------MFYSGLLTESGRKETDLREAA-SLRQQRRMKQAV-QFIHKDSADLLPLD
Choloepus_hoffmanni|11576          ------------------------------------------------------------
Sorex_araneus|4846                 ------------------------------------------------------------
Loxodonta_africana|10982           MAQLSVIPGSATAWTGLLTEGGRKETDVREAA-SLRQQRRMKQAV-QFIHKDSADLLPLD
Ochotona_princeps|4989             ------------------------------------------------------------
Cavia_porcellus|3786               -----------MFYSGLLTEGVRNETDMREAAVAAGSSICMKQAV-QFI-RDSAALLPLD
Tursiops_truncatus|1113            -----------MFYSGLLTEGGRKETDRREGA-SLRQQRRMKQAV-QFIHKDSADLLPLD
Equus_caballus|7823                -----------MFYSGLLTEGSRKETDM-------RQQRRMKQAV-QFIHKDSADLLPLD
Myotis_lucifugus|13398             ---------------GLPIADTLKEISSWESA-S-RRQHRMKQSG-QFMHKDSADLLPLD
Pongo_abelii|9691                  -----------MFYSGLLTEGGRKETDRREAA-SLRQQRRMKQAV-QFIHKDSADLLPLD
Homo_sapiens|41112                 -----------MFYSGLLTEGGRKETDMREAA-SLRQQRRMKQAV-QFIHKDSADLLPLD
Callithrix_jacchus|28853           -----------MFYSGLLTEGGRKETDMREAA-SLRQQRRMKQAV-QFIHKDSADLLPLD
Gorilla_gorilla|19705              -----------MFYSGLLTEGGRKETDMREAA-SLRQQRRMKQAVQQFIHKDSADLLPLD
Pan_troglodytes|5101               -----------MFYSGLLTEGGRKETDMREAA-SLRQQRRMKQAV-QFIHKDSADLLPLD
Pteropus_vampyrus|2304             -----------MFYSGLLTEGGRKETDMREAA-SLRQQRRMKQAV-QFIHKDSADLLPLD
Otolemur_garnettii|12548           ------------------------------------------------------------
Bos_taurus|11693                   MAQLSVIPGSATSWTGLLTEGGRKETDMREAA-SLRQQRRMKQAV-QFIHKDSADLLPLD
Canis_familiaris|10696             MAQLAVIPGSATAWPGLLREGGRQDSDMREAA-SLRQQRRMKQAV-Q----DSADLLPLD
Felis_catus|7151                   -----------MFYSGLLSEGGRKETDMREAA-SLRQQRRMKQAV-QFIHKDSADLLPLD
Tarsius_syrichta|9223              -----------MFYSGLLTEGGRKEGDMREAA-SLRQQRRMKQAV-QFIHKDSADLLPLD
Tupaia_belangeri|4346              ------------------------------------------------------------
Vicugna_pacos|11169                ------------------------------------------------------------
Gallus_gallus|6076                 PALRELHAGSKMFYSGVLTEPTRKEVEIREAA-SLRQQRRMKQAV-SPFPRGSAEALPPD
Anolis_carolinensis|9532           -----------MFYSGLLTESSRKEVDMREAA-SLRQQRRMKQAV-QFNHKDSADLLPLD
Taeniopygia_guttata|12056          -----------MFYSGILTEPSRKEVELREEA-SLRQQRRMKQAV-QFIHKDSADLLPLD
                                                                                               

Daphnia_pulex|30339                FINKYGLKIKKNVSIKIVSIFGASTKIKGVTIFKVRIGPRTYKCKALVLEESMYPLLLG-
Xenopus_tropicalis|23769           ---------------------------QPHNILQRRL-----------LETNLSKLRTN-
Dasypus_novemcinctus|13306         ---------------------------QPHNIL---F-----------MET--TKIQSS-
Procavia_capensis|13907            GLKK----------------LGSSKDTQPHNILQRRL-----------METNLSKLRSS-
Ornithorhynchus_anatinus|8013      ---------------------------QPHNILQRRL-----------METNLSKLRN--
Echinops_telfairi|1803             ---------------------------PFQNVSQIRP-----------VETGLSKLQST-
Microcebus_murinus|4834            GLKK----------------LGSSKDTQPHNILQRRL-----------METNLSKLRSS-
Spermophilus_tridecemlineatus|2245 GLKK----------------LGSS-DTQPHNILQRRL-----------METNLSKFRSS-
Monodelphis_domestica|11591        GLKK----------------LGSSKDTQPHNILQRRL-----------METNLSKLRNS-
Macropus_eugenii|14917             GLKK----------------LGSSKDTQPHNILQRRL-----------METNLSKLRSS-
Sus_scrofa|15446                   GLKK----------------LGSSKDTQPHNILQRRL-----------LETNLSKLRSS-
Sus_scrofa|15452                   GLKK----------------LGSSKDTQPHNILQRRL-----------LETNLSKLRSS-
Rhesus_macaque|15777               GLKK----------------LGSSKDTQPHNILQRRL-----------METNLSKLRSG-
Rattus_norvegicus|28309            GLKK----------------LGSSKDTQPHNILQRRL-----------METNLSKLRSS-
Mus_musculus|22573                 GLKK----------------LGSSKDTQPHNILQRRL-----------METNLSKLRST-
Dipodomys_ordii|9993               ---------------------------QPHNILQRRL-----------METNLSKLRST-
Erinaceus_europaeus|12316          GLKK----------------LGSSKDTQPHNILQRRL-----------METNLSKLRSS-
Choloepus_hoffmanni|11576          ---------------------------QPHNILQRRL-----------METNLSKLRSS-
Sorex_araneus|4846                 ---------------------------QPHNILQRRL-----------METNLSKLRSS-
Loxodonta_africana|10982           GLKK----------------LGSSKDTQPHNILQRRL-----------METNLSKLRSS-
Ochotona_princeps|4989             ---------------------------QPHNILQRRL-----------METNLSKLRSS-
Cavia_porcellus|3786               G-KK----------------LGSSKDTQPHNILQRRL-----------METNLSKLRSG-
Tursiops_truncatus|1113            GLKK----------------LGSSKDTQPHNILQRRL-----------METNLSKLRSS-
Equus_caballus|7823                GLKK----------------LGSSKDTQPHNILQRRL-----------METNLSKLRSS-
Myotis_lucifugus|13398             GLKK----------------LGSSKDTQPHNILQRRL-----------METNLSKLRSS-
Pongo_abelii|9691                  GLKK----------------LGSSKDTQPHNILQRRL-----------METNLSKLRSG-
Homo_sapiens|41112                 GLKK----------------LGSSKDMQPHNILQRRL-----------METNLSKLRSGP
Callithrix_jacchus|28853           GLKK----------------LGSSKDTQPHNILQRRL-----------METNLSKLRSS-
Gorilla_gorilla|19705              GLKK----------------LGSSKDMQPHNILQRRL-----------METNLSKLRSS-
Pan_troglodytes|5101               GLKK----------------LGSSKDMQPHNILQRRL-----------METNLSKLRSG-
Pteropus_vampyrus|2304             GLKK----------------LGSSKDTQPHNILQRRL-----------METNLSKLRSS-
Otolemur_garnettii|12548           ---------------------------QPHNILQRRL-----------METNLSKLRSS-
Bos_taurus|11693                   GLKK----------------LGSSKDTQPHNILQRRL-----------METNLSKLRSS-
Canis_familiaris|10696             GLQK----------------LGSSQVTQPHNILQRRL-----------METNLSKLRSS-
Felis_catus|7151                   GLKK----------------LGSSKDTQPHNILQRRL-----------METNLSKLRSS-
Tarsius_syrichta|9223              GLKK----------------LGSSKDTQPHNILQRRL-----------METNLSKLRSS-
Tupaia_belangeri|4346              ---------------------------QPHNILQRRL-----------METNLSKLRSS-
Vicugna_pacos|11169                ---------------------------QPHNILQRRL-----------METNLSKLRSS-
Gallus_gallus|6076                 FALL----------------FLCVSLKQPHNILQRRL-----------METNLSKLRGS-
Anolis_carolinensis|9532           GLKK----------------LGTSKDTQPHSILQKRL-----------METNMSKLRHG-
Taeniopygia_guttata|12056          GLKK----------------LGTSKDTQPHNILQKRL-----------METNLSKFRGS-
                                                                 .:                :*     :    

Daphnia_pulex|30339                -LDWLVANKCNLNFDQMVLEFPNGDRKPIMVKKDESRVLSVR----SRLEVILQ-GGERA
Xenopus_tropicalis|23769           RSTWAPKNDVSAQSKKQNQAKCESPRKS---EDDDMIYVWCQ-CAGKDVRAQIDTSCPHS
Dasypus_novemcinctus|13306         GIPWGSK------TNILHQFKSDGLSKG---V--NMILVSCQ-CARKDTKDLVDTGCQYK
Procavia_capensis|13907            RVPWASK------TNRFSQAKSESLKKS---EDDDMILVSCQ-CAGRDVKAVVDTGCQYN
Ornithorhynchus_anatinus|8013      RAPWAPKSEAANKASRGHQGKPEGLKKV---EEEDMILVSCQ-CFGKDLKAVVDTGCQYN
Echinops_telfairi|1803             LVPCASK------TPPLSLAKSESLKKS---EDDDMTLFSCH-CAGKDVKALVDTGCRYN
Microcebus_murinus|4834            RVPWASK------TNKLNQAKSEGLKKS---EDDDMILVSCQ-CAGKDVKALVDTGCQYN
Spermophilus_tridecemlineatus|2245 RVPWASK------TNKFNQAKSEGLKKS---EDDDMILVSCQ-XXXXXXXXXXXXXXXXX
Monodelphis_domestica|11591        RVPWAPK------ANRFNQAKSEGLKKA---EEGDMILVSCQ-CAGKDLKALVDTGCQHN
Macropus_eugenii|14917             RVPWAPK------TNRLNQAKFEGMKKT---EEGDMILVPCQ-CAGKDLK-LVDTGCQHN
Sus_scrofa|15446                   RVPWASK------SSRLSQAKSEGLRKS---EE-DMIWVPCQ-CAGKDVKALVDTGCQYN
Sus_scrofa|15452                   RVPWASK------SSRLSQAKSEGLRKS----EEDMIWVPCQPCLSCDICFLLF-GSSFP
Rhesus_macaque|15777               RVPWASK------TNKLNQAKSEGLKKS---EEDDMILVSCQ-CAGKDVKALVDTGCLYN
Rattus_norvegicus|28309            RVPWASK------TNKFSQTKSEGLKKC---DDDDMILVSCQ-CAGRDVKALVDTGCQHN
Mus_musculus|22573                 RVPWASK------TNKFNQAKSEGLKKC---EDEDMILVSCQ-CAGKDVKALVDTGCQYN
Dipodomys_ordii|9993               RVPWASK------TNKLSQSKSEGLKKS---EDDDMILISCQ-CAGKDVKAVVDTGCQYN
Erinaceus_europaeus|12316          RVPWSSK------TNKLNQSKTEGLKKS---EDDDMILVSCQ-CAGKDVKVLIDTGCQHN
Choloepus_hoffmanni|11576          RVPWASK------TNRFNQSKSEGLKKS---EDDDMILVSCQ-CAGKDVKALVDTGCHYN
Sorex_araneus|4846                 RVPWASK------TNKLNHSKSEGLKKS---EDDDMILVSCQ-CVGKDVKALVDTGCQYN
Loxodonta_africana|10982           RVPWASK------TSRLNQAKSESLKKS---EDDDMILVSCQ-CAGKDMKALVDTGCQYN
Ochotona_princeps|4989             RIPWASK------TNKFSQAKAEGLKKS---EDDDMILVSCQ-CAGKDVKALVDTGCQYN
Cavia_porcellus|3786               RVPWASK------TNKLNQTKSEGLKKS---EEDDMILVSCQ-CAGKDVKALVDTGCQYN
Tursiops_truncatus|1113            RVPWASK------TNKLNHAKSEGLKKS---EVDDMILVSCQ-CAGKDVKALVDTGCQYN
Equus_caballus|7823                RIPWASK------TNKFNQAKSEGLKKS---EDDDMILVSCQ-CAGKDVKALVDTGCQYN
Myotis_lucifugus|13398             RVPWTSK------TNKLNQAKSEGLKKS---EDDDMILVSCQ-CAGKDVKALIDTGCQYN
Pongo_abelii|9691                  RVPWASK------TNKLNQAKSEGLKKS---EEDDMILVSCQ-CAGKDVKAVVDTGCLHN
Homo_sapiens|41112                 RVPWASK------TNKLNQAKSEGLKKS---EEDDMILVSCQ-CAGKDVKALVDTGCLYN
Callithrix_jacchus|28853           RVPWASK------TNKVNQAKSEGLKKS---EEDDMILVSCQ-CAGKDVKALVDTGCLYN
Gorilla_gorilla|19705              RVPWASK------TNKLNQAKSEGLKKS---EEDDMILVSCQ-CAGKDVKALVDTGCLYN
Pan_troglodytes|5101               RVPWASK------TNKLNQAKSEGLKKS---EEDDMILVSCQ-CAGKDVKALVDTGCLYN
Pteropus_vampyrus|2304             RVPWASK------TNKLNQTKSEGLKKS---EDDDMILISCQ-CAGKDVKALVDTGCQYN
Otolemur_garnettii|12548           RVPWASK------TNKLNQAKSEGLKKS---EDDDMILVSCQ-CAGKDMKALVDTGCQYN
Bos_taurus|11693                   RVPWASK------TNKFNQAKSEGLKKS---EDDDMILVSCQ-CAGKDVKALVDTGCQYN
Canis_familiaris|10696             RVPWASK------TNKLNQAKSEGLKKS---DDDDMILVSCQ-CAGKDVKALVDTGCQYN
Felis_catus|7151                   RVPWASK------TNKLNQAKSEGLKKS---DDDDMILVSCQ-CAGKDVKALVDTGCQYN
Tarsius_syrichta|9223              RVPWASK------TNKLNQAKSEGLKKS---EDDDMILVSCQ-CAGKDVKALVDTGCQYN
Tupaia_belangeri|4346              RVPWASK------TNKLNQAKSEGLKKS---EDDDMILVSCQ-CAGKDVKALVDTGCQYN
Vicugna_pacos|11169                RVPWASK------TNKLNQAKSEGLKKS---EDDDLILVSCQ-CAGKDVKALVDTGCQYN
Gallus_gallus|6076                 RGSWASKSDAPAQSNRLNQAKLGSSRSV---EDEELLVVSCQ-CAGKELKAVVDTGSQHN
Anolis_carolinensis|9532           RGTSSQKNDLPAQTNKLNQMKLDCPKKT---EQDDLILVCCQ-CAGKELQVVVDTGCQRN
Taeniopygia_guttata|12056          RGSWAPKGDLSSQTNKLNQTKLGSSGKT---QDEELIVVSCQ-CAGKELKAVVDTGSQHN
                                                             .       :   .  :                  

Daphnia_pulex|30339                LIPVKIPDLYKVKEVDGIVYAVKNKENPWMVARSLTRVMDGFSLVEITNMGIGPWKVCKN
Xenopus_tropicalis|23769           LIPAPCLDRLGLKEH---FRSYKKEEEPPALPYSV-------------------------
Dasypus_novemcinctus|13306         LNSSACLDRLGLREH---VKSHKHEDEKLS-PTWL-------------------------
Procavia_capensis|13907            LISSACVDRLGXXXX---XXXXXXXXXXXXXXXXX-------------------------
Ornithorhynchus_anatinus|8013      LISSACLDRLGLKEH---VKSYKHDGEKASLPRHL-------------------------
Echinops_telfairi|1803             LISSACVDRLGLKEH---VRSHKHEGEKLALPRHL-------------------------
Microcebus_murinus|4834            LISSACVDRLGLKEH---VRSRKHEGEKLSLPRHL-------------------------
Spermophilus_tridecemlineatus|2245 XXXXXXXXXXXLKEH---VRSHKHEGEKFSLPRHL-------------------------
Monodelphis_domestica|11591        LISSACVDRLGLKDH---VKSHKHDGEKLSLPRNL-------------------------
Macropus_eugenii|14917             LISSACVDRLGLKDH---VKSHKHDGEKLSLPRHL-------------------------
Sus_scrofa|15446                   LISSACVDRLGLKEH---VRSHRLEGEKLCLPRHL-------------------------
Sus_scrofa|15452                   PASSACVDRLGLKEH---VRSHRLEGEKLCLPRHL-------------------------
Rhesus_macaque|15777               LISSACVDRLGLKEL---VKSHKHEGEKLSLPRHL-------------------------
Rattus_norvegicus|28309            LISSACVDRLGLRDH---VKSHKHEGEKLSLPRHL-------------------------
Mus_musculus|22573                 LISSACVDRLGLKDH---VKSHKHEGEKLSLPRHL-------------------------
Dipodomys_ordii|9993               LISSACVDRLGLKEH---VKSHKHEGEKLSLPRHL-------------------------
Erinaceus_europaeus|12316          LISSACVDRLGLKDQ---VKSHKHEGEKLSLPRHL-------------------------
Choloepus_hoffmanni|11576          LISSACVDRLGLKEH---VKSHKHEGEKLSLPRHL-------------------------
Sorex_araneus|4846                 LISSACVDRLGLKEH---VKSHKHEGEKLSLPRHL-------------------------
Loxodonta_africana|10982           LISSACVDRLGLKEH---VKSHKHEVEKLSLPRHL-------------------------
Ochotona_princeps|4989             LISSACVDRLGLKEH---VRSHKHEGEKLSLPRHL-------------------------
Cavia_porcellus|3786               LISSACVDRLGLKEY---VKSHKHEGEKLSLPRHL-------------------------
Tursiops_truncatus|1113            LISSACVDRLGLKEH---VRSHKHEGEKLSLPRHL-------------------------
Equus_caballus|7823                LISSACVDRLGLKEH---VKSHKHEGEKLSLPRHL-------------------------
Myotis_lucifugus|13398             LISSACVYRLGLKEH---VKSHKHEGEKLSLPRHL-------------------------
Pongo_abelii|9691                  LISLACVDRLGLKEH---VKSHKHEGEKLSLPRHL-------------------------
Homo_sapiens|41112                 LISLACVDRLGLKEH---VKSHKHEGEKLSLPRHL-------------------------
Callithrix_jacchus|28853           LISSACVDRLGLKEH---VKSHKHEGEKLSLPRHL-------------------------
Gorilla_gorilla|19705              LISLACVDRLGLKEH---VKSHKHEGEKLSLPRHL-------------------------
Pan_troglodytes|5101               LISLACVDRLGLKEH---VRSHKHEGEKLSLPRHL-------------------------
Pteropus_vampyrus|2304             LISSACVDRLGLKEH---VRSHRHEAEKLSLPRHL-------------------------
Otolemur_garnettii|12548           LISSACVDRLGLKEH---VRSHKH--EKLSLPRHL-------------------------
Bos_taurus|11693                   LISSACVDRLGLKEH---VRSHKHEGERLSLPRHL-------------------------
Canis_familiaris|10696             LISSACVDRLGLKEH---VRSHKHEGEKLSLPRHL-------------------------
Felis_catus|7151                   LISSACVDRLGLKEH---VRSHKHEGEKLSLPRHL-------------------------
Tarsius_syrichta|9223              LISSACVDRLGLKEH---VKSHKHEGEKLSLPRHL-------------------------
Tupaia_belangeri|4346              LISSACVDRLGLKEH---VKSHKHEGEKLSLPRHL-------------------------
Vicugna_pacos|11169                LISSACVDRLGLKEH---VKSHKHEGEKLSLPRHL-------------------------
Gallus_gallus|6076                 LMSAACLDRLGLRER---LEVLPSEEEEISLAHSE-------------------------
Anolis_carolinensis|9532           IISSACLERLGLKEH---MKAYKPECEKISSPPNM-------------------------
Taeniopygia_guttata|12056          LMSSACLDRLGLKEH---LKALPAEEEVVSLPNKV-------------------------
                                                                                               

Daphnia_pulex|30339                QQVGWFEYEPTIANAILL-AAAIEVEDVPRNANCGVGLNEECTTTPRRLMAEEEKACKGN
Xenopus_tropicalis|23769           KPLGQVERMAVMLGNTTVECSAIVIDNNDRNFSLGL------------------------
Dasypus_novemcinctus|13306         KIVGWIEHLVTLLGSLCLGCPVAVT-----------------------------------
Procavia_capensis|13907            XXXXXXXXXXXXXXXXXXXXXXXXXXDNEKNLSLGL------------------------
Ornithorhynchus_anatinus|8013      RVTGQIEHLALTLGSLRLDCSAAVVDDNEKTLSLGL------------------------
Echinops_telfairi|1803             KVVGQIEHLVITLGSLRLDCPAAVV-----------------------------------
Microcebus_murinus|4834            KVVGQIEHLVITLGSLHLDCPATVVXXXXXXXXXXX------------------------
Spermophilus_tridecemlineatus|2245 KVVGQIEHLVITMGSLRLDCPAAVVEDNEKNLSLDL------------------------
Monodelphis_domestica|11591        KVVGQIEHLALTLGSLRLDCPAAVVEDNEKNLTLGL------------------------
Macropus_eugenii|14917             KVVGQIEHLALTLGSLRLDCPAAVVEDNDKTLTLGL------------------------
Sus_scrofa|15446                   KVMGQIEHLVITLGSLRLDCPAAVVEDNEKTLSLGL------------------------
Sus_scrofa|15452                   KVMGQIEHLVITLGSLRLDCPAAVVEDNEKTLSLGL------------------------
Rhesus_macaque|15777               KVVGQIEHLVITLGSLRLDCPAAVVEQRSRHCTPAW------------------------
Rattus_norvegicus|28309            KVVGQIEHLLITVGSLRLDCPAAVVDDNEKSLSLGL------------------------
Mus_musculus|22573                 KVVGQIEHLMITVGSLRLDCQAAVVDDNEKSLSLGL------------------------
Dipodomys_ordii|9993               KVVGQIEHLVITVGSLRLDFPAAVVEDNEKNLSLGL------------------------
Erinaceus_europaeus|12316          KVVGQIEHLVITLGSFRLDCPAAVVEDNEKSLSLGL------------------------
Choloepus_hoffmanni|11576          KVVGQIEHLVITLGSFRLDSPAAVIDDNEKNLSLGL------------------------
Sorex_araneus|4846                 KVVGHIEHLVITLGSLRLDCPAVVIDDNEKNLSLGL------------------------
Loxodonta_africana|10982           KVVGQIEHLVITLGSLRLDCAAAVVEDNEKNLSLGL------------------------
Ochotona_princeps|4989             KVVGHIEHLVITLGSLRLDCPAAVVEDNEKNLSLGL------------------------
Cavia_porcellus|3786               KVVGQIEHLVITLGSFRLDCPAAVVEDNEKNLSLGL------------------------
Tursiops_truncatus|1113            KVVGQIEHLVITLGSLHLDCPAAVVEDNEKNLSLGL------------------------
Equus_caballus|7823                KVVGQIEHLAITLGSLRLDCAAAVVEDSEKNLSLGL------------------------
Myotis_lucifugus|13398             KVVGQIEHLVITLGSLCLDCPAAVVEDNEKNLSLGL------------------------
Pongo_abelii|9691                  KVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGL------------------------
Homo_sapiens|41112                 KVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGL------------------------
Callithrix_jacchus|28853           KVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGL------------------------
Gorilla_gorilla|19705              KVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGL------------------------
Pan_troglodytes|5101               KVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGL------------------------
Pteropus_vampyrus|2304             KVVGQIEHLVITLGSLRLDCPAAVVEDNEKNLSLGL------------------------
Otolemur_garnettii|12548           KVVGQIEHLVITLGSLRLDCPAAVV-DNEKNLSLGL------------------------
Bos_taurus|11693                   KVVGQIEHLVITLGSLRLDCPAAVVEDNEKNLSLGL------------------------
Canis_familiaris|10696             KVVGQIEHLVITLGSLRLDCPAAVVEDNEKNISLGL------------------------
Felis_catus|7151                   KVVGQIEHLVITLGSLRLDCPAAVVEDNEKNLSLGL------------------------
Tarsius_syrichta|9223              KVVGQIEHLVITLGSFRLDCPAAVVEDNEKNLSLGL------------------------
Tupaia_belangeri|4346              KVVGQIEHLVITLGSLRLDCPAAVVEDNEKNLSLGL------------------------
Vicugna_pacos|11169                KVVGQIEHLVITLGSLRLDCPAAVVEDNEKNLSLGL------------------------
Gallus_gallus|6076                 RVIGRIDRLVLAVGALRVECAALVVEDSEKPFSFGL------------------------
Anolis_carolinensis|9532           KVIGYIEHLSLTLGTLLVDCSAIVTEDHEKNFSLGL------------------------
Taeniopygia_guttata|12056          KAIGQIECLSLTVGAVPVECAALVVEDNDQPFSFGL------------------------
                                                                                               

Daphnia_pulex|30339                SAHGDSKEEKPSQNLQEDIKIKGSGPMHCKESKSVRFLIDPANGKCQSGRKTDSYPNGCK
Xenopus_tropicalis|23769           -----------------------------QTLKSLKCVINLEQNQIEVGR----------
Dasypus_novemcinctus|13306         ---------------------------------------NLNKHGLTMRN----------
Procavia_capensis|13907            -----------------------------QTLRSLKCIINLDKHRLIMGK----------
Ornithorhynchus_anatinus|8013      -----------------------------QTLRSLKCVINLEKRHLVVGK----------
Echinops_telfairi|1803             ------------------------------------------------------------
Microcebus_murinus|4834            -----------------------------XXXXXXXXXXXXXXXQLIMGK----------
Spermophilus_tridecemlineatus|2245 -----------------------------QTLRSLKCIINLDKHRLIMGK----------
Monodelphis_domestica|11591        -----------------------------QTLRSLKCIINLDKQRLIMGK----------
Macropus_eugenii|14917             -----------------------------QTLRSLKCIINLDKQRLIMGK----------
Sus_scrofa|15446                   -----------------------------QTLRSLKCVINLDKHRLIVGK----------
Sus_scrofa|15452                   -----------------------------QTLRSLKCVINLDKHRLIVGK----------
Rhesus_macaque|15777               -----------------------------ATRVQLHCIINLDKHRLIMGK----------
Rattus_norvegicus|28309            -----------------------------QTLRSLKCIINLDKHRLMVGK----------
Mus_musculus|22573                 -----------------------------QTLRSLKCIINLDKHRLIVGK----------
Dipodomys_ordii|9993               -----------------------------QTLRSLKCIIN-DKHRLTVGK----------
Erinaceus_europaeus|12316          -----------------------------QTLRSLKCIINLDKHRLIMGK----------
Choloepus_hoffmanni|11576          -----------------------------QTLRSLKGIINLDKHRLIIGK----------
Sorex_araneus|4846                 -----------------------------QTLRSLKCIINLDKHRLIMGK----------
Loxodonta_africana|10982           -----------------------------QTLRSLKCIINLDKHQLIMGK----------
Ochotona_princeps|4989             -----------------------------QTLRSLKCIINLDNHRLIMGK----------
Cavia_porcellus|3786               -----------------------------QTLRSLKCIINLDKHRLIMGK----------
Tursiops_truncatus|1113            -----------------------------QTLRSLKCIINLDKHRLIMGK----------
Equus_caballus|7823                -----------------------------QTLRSLKCIINLDKHRLIMGK----------
Myotis_lucifugus|13398             -----------------------------QTLRSLKCIINLDKHQLIMGK----------
Pongo_abelii|9691                  -----------------------------QTLRSLKCIINLDKHRLIMGK----------
Homo_sapiens|41112                 -----------------------------QTLRSLKCIINLDKHRLIMGK----------
Callithrix_jacchus|28853           -----------------------------QTLRSLKCIINLDKHRLIMGK----------
Gorilla_gorilla|19705              -----------------------------QTLRSLKCIINLDKHRLIMGK----------
Pan_troglodytes|5101               -----------------------------QTLRSLKCIINLDKHRLIMGK----------
Pteropus_vampyrus|2304             -----------------------------QTLRSLKCIINLDKHRLIMGK----------
Otolemur_garnettii|12548           -----------------------------QTLRSLKCIINLDKQRLIMGK----------
Bos_taurus|11693                   -----------------------------QTLRSLKCIINLDKHRLIMGK----------
Canis_familiaris|10696             -----------------------------QTLRSLKCIINLDKHRLIMGK----------
Felis_catus|7151                   -----------------------------QTLRSLKCIINLDKHRLIMGK----------
Tarsius_syrichta|9223              -----------------------------QTLRSLKCIINLDKHRLIMGK----------
Tupaia_belangeri|4346              -----------------------------QTLRSLKCIINLDKHRLIMGK----------
Vicugna_pacos|11169                -----------------------------QTLRSLKCIINLDKHRLIMGK----------
Gallus_gallus|6076                 -----------------------------QTLKSLKCVINLEKHHLVLGK----------
Anolis_carolinensis|9532           -----------------------------QTLKSLKCVINMEKHHLVLGK----------
Taeniopygia_guttata|12056          -----------------------------QTLKSLKCVINMEKHHLVLGQ----------
                                                                                               

Daphnia_pulex|30339                GCKWLRKNTGEVQVLATE-DVMVNKVDE-TKLNED-ELEKE
Xenopus_tropicalis|23769           ----------------TE---IIPFIIR-NTVRED-QPSEV
Dasypus_novemcinctus|13306         ----------------RE-KEEIPCVET-VSLNED-NTSEV
Procavia_capensis|13907            ----------------TD-KEEIPFVET-VSFNED------
Ornithorhynchus_anatinus|8013      ----------------TD-REEIPFVESKVPSNED-NTSEA
Echinops_telfairi|1803             -----------------------------------------
Microcebus_murinus|4834            ----------------AG-KEEIPV--T-FSLNED-NTSEA
Spermophilus_tridecemlineatus|2245 ----------------LK-REEIPFVET-VSFYED-NTSEA
Monodelphis_domestica|11591        ----------------VE-KEEIPFVET-VSGSED-NTSEA
Macropus_eugenii|14917             ----------------VE-KEEIPFVET-VSGSED-NTSEA
Sus_scrofa|15446                   ----------------TD-KEGIPFVET-VAVNED-K----
Sus_scrofa|15452                   ----------------TD-KEGIPFVET-VAVNED-NTSEA
Rhesus_macaque|15777               ----------------TD-KEEIPFVET-VSLNED-NTSEA
Rattus_norvegicus|28309            ----------------TD-KEEIPFVET-VSVNDD-NTSEA
Mus_musculus|22573                 ----------------TD-KEEIPFVET-VSVNDD-NTSEA
Dipodomys_ordii|9993               ----------------TD-KEEI-FVET-ISLNED-NTSEA
Erinaceus_europaeus|12316          ----------------TE-KEEIPFVET-VSLNED-N----
Choloepus_hoffmanni|11576          ----------------TD-KEEIPFVEP-VSLNED-NTSEA
Sorex_araneus|4846                 ----------------TD-KEEIPFVET-LSLNED-NTSEA
Loxodonta_africana|10982           ----------------TD-KEEIPFVET-VSLNED-NTSEA
Ochotona_princeps|4989             ----------------TD-KEEIPFVET-VTLNED-NTSEA
Cavia_porcellus|3786               ----------------TD-KEEIPFVET-ISLNED-NTSEA
Tursiops_truncatus|1113            ----------------TD-KQEIPFEET-VSLNED-NTSEA
Equus_caballus|7823                ----------------TDKKEEIPFVET-VSLNED-NTSEA
Myotis_lucifugus|13398             ----------------TD-KEEIPFVET-VSLNED-NTSEA
Pongo_abelii|9691                  ----------------TD-KEEIPFVET-VSLNED-NTSEA
Homo_sapiens|41112                 ----------------TD-KEEIPFVET-VSLNED-KTNST
Callithrix_jacchus|28853           ----------------TD-KEEIPFVET-VFLNED-NTSEA
Gorilla_gorilla|19705              ----------------TD-KEEIPFVET-VSLNED-NTSEA
Pan_troglodytes|5101               ----------------TD-KEEIPFVET-VSLNED-NTSEA
Pteropus_vampyrus|2304             ----------------TD-KEEIPFVEA-VSLNED-NTSEA
Otolemur_garnettii|12548           ----------------TD-KEEIPFVET-FSLKED-NTSEA
Bos_taurus|11693                   ----------------TD-KEEIPFVET-ISLNED-NTSEA
Canis_familiaris|10696             ----------------TD-KEEIPFVET-VSLNED-NTSEA
Felis_catus|7151                   ----------------TD-KEEIPFVET-VSLNED-NTSEA
Tarsius_syrichta|9223              ----------------TD-KEEIPFVET-VSLNED-NTSEA
Tupaia_belangeri|4346              ----------------TD-KEEIPFVET-VSLNDD-NTSEA
Vicugna_pacos|11169                ----------------TD-KEEIPFVET-VSLNED-NTSEA
Gallus_gallus|6076                 ----------------TE-REEIPFVDS-VGAGAGEHTLEA
Anolis_carolinensis|9532           ----------------TN-REEIPFATN-TSAQEE------
Taeniopygia_guttata|12056          ----------------MD-REEIPFV---------------