Orthologs Set ID: EOG4006DC


Orthology Database
OrthoDB4
Gene Symbol(s)
NDUFS3

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Anolis carolinensis 2777 1242, 1392, 1518, 1638
Apis mellifera 34131 1039, 1144, 1392, 1638
Bombyx mori 1472 685
Bombyx mori 4173
Bos taurus 6586 889, 1144, 1242, 1392, 1518, 1638
Branchiostoma floridae 18878 1266, 1392, 1518, 1638
Caenorhabditis elegans 1745 772, 895, 1011, 1144, 1314, 1505
Callithrix jacchus 41072 889, 1144, 1242, 1392, 1518, 1638
Canis familiaris 8459 883, 1144, 1242, 1392, 1518, 1638
Cavia porcellus 21637 889, 1144, 1242, 1392, 1518, 1638
Choloepus hoffmanni 1658 889, 1144, 1242, 1392, 1518, 1638
Culex quinquefasciatus 5100 61, 641
Danio rerio 29215 697, 1144, 1242, 1392, 1518, 1638
Daphnia pulex 25769 1392, 1505, 1638
Dasypus novemcinctus 7086 889, 1144, 1242, 1392, 1518, 1521, 1638
Dipodomys ordii 10698 889, 1144, 1242, 1392, 1518, 1638
Drosophila melanogaster 9698 697, 1144
Drosophila persimilis 10001 697, 1144
Drosophila sechellia 15374 697, 1144
Drosophila simulans 7898 697, 1144
Echinops telfairi 14665 654, 663, 889, 1144, 1242, 1392, 1518, 1638
Equus caballus 5167 889, 1144, 1242, 1392, 1518, 1638
Erinaceus europaeus 8157 1242, 1392, 1518, 1638
Felis catus 42678 889, 1144, 1242, 1392, 1518, 1638
Gallus gallus 16773 1144, 1242, 1392, 1518, 1638
Gasterosteus aculeatus 2706 1144, 1242, 1392, 1518, 1638
Homo sapiens 17579 889, 1144, 1242, 1392, 1518, 1638
Ixodes scapularis 10240
Linepithema humile 12923 1039, 1144, 1392, 1638
Loxodonta africana 10391 889, 1144, 1242, 1392, 1518, 1638
Macropus eugenii 12713 1242, 1392, 1518, 1638
Microcebus murinus 1163 889, 1144, 1242, 1392, 1518, 1638
Monodelphis domestica 24637 1144, 1242, 1392, 1518, 1638
Mus musculus 22981 889, 1144, 1242, 1392, 1518, 1638
Myotis lucifugus 16876 1518, 1533, 1558, 1590, 1601, 1609, 1638, 1827
Nasonia vitripennis 16429 1039, 1144, 1392, 1638
Nematostella vectensis 3047 1638
Ochotona princeps 5383 648, 660, 889, 1144, 1242, 1392, 1518, 1638
Ornithorhynchus anatinus 16840 1036, 1144, 1242, 1392, 1518, 1638
Oryctolagus cuniculus 1824 889, 1144, 1242, 1392, 1518, 1638
Oryzias latipes 24786 1242, 1392, 1518, 1638
Otolemur garnettii 12074 889, 1144, 1242, 1392, 1518, 1638
Pan troglodytes 6811 889, 1144, 1242, 1392, 1518, 1638
Pediculus humanus 9612 1189, 1685
Pogonomyrmex barbatus 8503 700, 1144, 1392, 1638
Pongo abelii 4686 889, 1144, 1242, 1392, 1518, 1638
Procavia capensis 9423 660, 663, 889, 1144, 1242, 1392, 1518, 1638
Pteropus vampyrus 17693 654, 663, 889, 1144, 1242, 1392, 1518, 1638
Rattus norvegicus 22470 889, 1144, 1242, 1392, 1518, 1638
Rhesus macaque 12579 889, 1144, 1242, 1392, 1518, 1638
Sorex araneus 7405 889, 1144, 1194, 1221, 1238, 1242, 1392, 1518, 1638
Spermophilus tridecemlineatus 623 657, 660, 889, 1144, 1242, 1392, 1518, 1638
Sus scrofa 9854 889, 1144, 1242, 1392, 1518, 1638
Taeniopygia guttata 12021 1242, 1392, 1518, 1638
Taeniopygia guttata 12022 1242, 1392, 1518
Tarsius syrichta 7730 889, 1144, 1242, 1392, 1518
Tetraodon nigroviridis 14433 697, 1144, 1242, 1392, 1518, 1638
Tupaia belangeri 6420 889, 1144, 1242, 1392, 1518
Tursiops truncatus 13883 647, 663, 889, 1144, 1242, 1392, 1518, 1638
Vicugna pacos 1330 645, 663, 669, 691, 889, 1144, 1202, 1242, 1245, 1260, 1278, 1295, 1305, 1340, 1392, 1518, 1614, 1635, 1638
Xenopus tropicalis 4093 1144, 1242, 1392, 1518, 1638

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 2777 ENSACAT00000001982 100555578 ENSACAG00000001966 ndufs3 anoCar1
Apis mellifera 34131 GB15355-PA apiMel3
Bombyx mori 4173 BGIBMGA014483-TA v2.0
Bombyx mori 1472 BGIBMGA003447-TA v2.0
Bos taurus 6586 ENSBTAT00000024600 287327 ENSBTAG00000018483 NDUFS3 bosTau4
Branchiostoma floridae 18878 gw.349.101.1 braFlo1
Caenorhabditis elegans 1745 T10E9.7a, NM_059480 172363 WBGene00020417 nuo-2 ce6
Callithrix jacchus 41072 ENSCJAT00000039680 100393702 ENSCJAG00000020194 NDUFS3 calJac3
Canis familiaris 8459 ENSCAFT00000013355 475978 ENSCAFG00000008411 NDUFS3 canFam2
Cavia porcellus 21637 ENSCPOT00000006205 100730807 ENSCPOG00000006141 NDUFS3 cavPor3
Choloepus hoffmanni 1658 ENSCHOT00000001658 ENSCHOG00000001654 NDUFS3 choHof1
Culex quinquefasciatus 5100 CPIJ013503-RA 6046558 CPIJ013503 CpipJ1
Danio rerio 29215 ENSDART00000015682, NM_001017755 550451 ENSDARG00000015385 ndufs3 danRer6
Daphnia pulex 25769 fgenesh1_pg.C_scaffold_171000013 1.1
Dasypus novemcinctus 7086 ENSDNOT00000009543 101439844 ENSDNOG00000009548 NDUFS3 dasNov2
Dipodomys ordii 10698 ENSDORT00000015594 ENSDORG00000015594 Ndufs3 dipOrd1
Drosophila melanogaster 9698 FBtr0073113, NM_139518 38378 FBgn0266582 NDUFS3 dm3
Drosophila persimilis 10001 FBtr0186365 6600606 FBgn0158345 GL20750 droPer1
Drosophila sechellia 15374 FBtr0197065 6610570 FBgn0169009 GM14080 droSec1
Drosophila simulans 7898 FBtr0213264 6736574 FBgn0185069 GD13354 droSim1
Echinops telfairi 14665 ENSETET00000014273 ENSETEG00000014273 NDUFS3 TENREC
Equus caballus 5167 ENSECAT00000014195 100058223 ENSECAG00000013454 NDUFS3 equCab2
Erinaceus europaeus 8157 ENSEEUT00000007336 ENSEEUG00000007356 NDUFS3 eriEur1
Felis catus 42678 ENSFCAT00000009506 101096914 ENSFCAG00000009504 NDUFS3 felCat3
Gallus gallus 16773 ENSGALT00000013121 423179 ENSGALG00000008084 NDUFS3 galGal3
Gasterosteus aculeatus 2706 ENSGACT00000023018 ENSGACG00000017384 ndufs3 gasAcu1
Homo sapiens 17579 ENST00000263774 4722 ENSG00000213619 NDUFS3 hg19,GRCh37
Ixodes scapularis 10240 ISCW012366-RA ISCW012366 IscaW1
Linepithema humile 12923 LH10950-RA 1.2
Loxodonta africana 10391 ENSLAFT00000017939 100671569 ENSLAFG00000017939 NDUFS3 loxAfr3
Macropus eugenii 12713 ENSMEUT00000012706 ENSMEUG00000012678 NDUFS3 Meug_1.0
Microcebus murinus 1163 ENSMICT00000001088 ENSMICG00000001089 NDUFS3 micMur1
Monodelphis domestica 24637 ENSMODT00000025289 100016907 ENSMODG00000019916 NDUFS3 monDom5
Mus musculus 22981 ENSMUST00000005647 68349 ENSMUSG00000005510 Ndufs3 mm9
Myotis lucifugus 16876 ENSMLUT00000016648 102417405 ENSMLUG00000016649 NDUFS3 myoLuc1
Nasonia vitripennis 16429 NV14622-RA 1.2
Nematostella vectensis 3047 e_gw.250.40.1 Nemve1
Ochotona princeps 5383 ENSOPRT00000003295 ENSOPRG00000003296 NDUFS3 OchPri2.0
Ornithorhynchus anatinus 16840 ENSOANT00000012583 ENSOANG00000007900 NDUFS3 ornAna1
Oryctolagus cuniculus 1824 ENSOCUT00000006353 100355349 ENSOCUG00000006359 NDUFS3 oryCun2.0
Oryzias latipes 24786 ENSORLT00000022941 101158672 ENSORLG00000018322 ndufs3 oryLat2
Otolemur garnettii 12074 ENSOGAT00000011609 100941289 ENSOGAG00000011606 NDUFS3 otoGar1
Pan troglodytes 6811 ENSPTRT00000006726 451175 ENSPTRG00000003571 NDUFS3 panTro2
Pediculus humanus 9612 PHUM564490-RA 8234782 PHUM564490 PhumU1
Pogonomyrmex barbatus 8503 PB16675-RA 1.2
Pongo abelii 4686 ENSPPYT00000003930 100446873 ENSPPYG00000003299 LOC100446873 ponAbe2
Procavia capensis 9423 ENSPCAT00000009353 ENSPCAG00000009367 NDUFS3 proCap1
Pteropus vampyrus 17693 ENSPVAT00000007344 ENSPVAG00000007344 NDUFS3 pteVam1
Rattus norvegicus 22470 ENSRNOT00000012425, NM_001106489 295923 ENSRNOG00000009155 Ndufs3 rn4
Rhesus macaque 12579 ENSMMUT00000006095 713040 ENSMMUG00000004286 rheMac2
Sorex araneus 7405 ENSSART00000007258 ENSSARG00000007267 NDUFS3 sorAra1
Spermophilus tridecemlineatus 623 ENSSTOT00000000623 101972781 ENSSTOG00000000622 Ndufs3 speTri1
Sus scrofa 9854 ENSSSCT00000014449 100510948 ENSSSCG00000013229 NDUFS3 susScr2
Taeniopygia guttata 12021 ENSTGUT00000010789 100228726 ENSTGUG00000010343 taeGut1
Taeniopygia guttata 12022 ENSTGUT00000010793 ENSTGUG00000010357 taeGut1
Tarsius syrichta 7730 ENSTSYT00000002398 103253931 ENSTSYG00000002403 NDUFS3 tarSyr1
Tetraodon nigroviridis 14433 ENSTNIT00000022202 ENSTNIG00000018784 ndufs3 tetNig2
Tupaia belangeri 6420 ENSTBET00000006421 ENSTBEG00000006433 NDUFS3 tupBel1
Tursiops truncatus 13883 ENSTTRT00000014163 ENSTTRG00000014164 NDUFS3 turTru1
Vicugna pacos 1330 ENSVPAT00000005257 ENSVPAG00000005257 NDUFS3 vicPac1
Xenopus tropicalis 4093 ENSXETT00000043132 394690 ENSXETG00000019932 ndufs3 xenTro2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 1892 ENSACAP00000001936 100555578 ENSACAG00000001966 ndufs3 anoCar1
Apis mellifera 5353 GB15355 apiMel3
Bombyx mori 3447 BGIBMGA003447-PA v2.0
Bombyx mori 14483 BGIBMGA014483-PA v2.0
Bos taurus 18487 ENSBTAP00000024600 287327 ENSBTAG00000018483 NDUFS3 bosTau4
Branchiostoma floridae 2681 gw.349.101.1 braFlo1
Caenorhabditis elegans 205 T10E9.7a 172363 WBGene00020417 nuo-2 ce6
Callithrix jacchus 32538 ENSCJAP00000037564 100393702 ENSCJAG00000020194 NDUFS3 calJac3
Canis familiaris 2176 ENSCAFP00000012358 475978 ENSCAFG00000008411 NDUFS3 canFam2
Cavia porcellus 17077 ENSCPOP00000005538 100730807 ENSCPOG00000006141 NDUFS3 cavPor3
Choloepus hoffmanni 1462 ENSCHOP00000001461 ENSCHOG00000001654 NDUFS3 choHof1
Culex quinquefasciatus 12439 CPIJ013503 CpipJ1
Danio rerio 14187 ENSDARP00000013902 550451 ENSDARG00000015385 ndufs3 danRer6
Daphnia pulex 18127 JGI_V11_115970 1.1
Dasypus novemcinctus 6260 ENSDNOP00000007398 101439844 ENSDNOG00000009548 NDUFS3 dasNov2
Dipodomys ordii 10039 ENSDORP00000014677 ENSDORG00000015594 Ndufs3 dipOrd1
Drosophila melanogaster 8805 FBpp0072975 38378 FBgn0266582 NDUFS3 dm3
Drosophila persimilis 10433 FBpp0184857 6600606 FBgn0158345 GL20750 droPer1
Drosophila sechellia 4031 FBpp0195557 6610570 FBgn0169009 GM14080 droSec1
Drosophila simulans 3658 FBpp0211756 6736574 FBgn0185069 GD13354 droSim1
Echinops telfairi 11568 ENSETEP00000011584 ENSETEG00000014273 NDUFS3 TENREC
Equus caballus 11243 ENSECAP00000011329 100058223 ENSECAG00000013454 NDUFS3 equCab2
Erinaceus europaeus 6715 ENSEEUP00000006694 ENSEEUG00000007356 NDUFS3 eriEur1
Felis catus 8584 ENSFCAP00000008814 101096914 ENSFCAG00000009504 NDUFS3 felCat3
Gallus gallus 10804 ENSGALP00000013106 423179 ENSGALG00000008084 NDUFS3 galGal3
Gasterosteus aculeatus 22600 ENSGACP00000022975 ENSGACG00000017384 ndufs3 gasAcu1
Homo sapiens 28957 ENSP00000263774 4722 ENSG00000213619 NDUFS3 hg19,GRCh37
Ixodes scapularis 10246 ISCW012366-PA ISCW012366 IscaW1
Linepithema humile 2849 LH10950-PA 1.2
Loxodonta africana 1277 ENSLAFP00000015038 100671569 ENSLAFG00000017939 NDUFS3 loxAfr3
Macropus eugenii 11563 ENSMEUP00000011553 ENSMEUG00000012678 NDUFS3 Meug_1.0
Microcebus murinus 992 ENSMICP00000000992 ENSMICG00000001089 NDUFS3 micMur1
Monodelphis domestica 13747 ENSMODP00000024848 100016907 ENSMODG00000019916 NDUFS3 monDom5
Mus musculus 21669 ENSMUSP00000005647 68349 ENSMUSG00000005510 Ndufs3 mm9
Myotis lucifugus 15173 ENSMLUP00000015171 102417405 ENSMLUG00000016649 NDUFS3 myoLuc1
Nasonia vitripennis 4550 NV14622-PA 1.2
Nematostella vectensis 10942 e_gw.250.40.1 Nemve1
Ochotona princeps 4670 ENSOPRP00000003024 ENSOPRG00000003296 NDUFS3 OchPri2.0
Ornithorhynchus anatinus 12662 ENSOANP00000012581 ENSOANG00000007900 NDUFS3 ornAna1
Oryctolagus cuniculus 14124 ENSOCUP00000005496 100355349 ENSOCUG00000006359 NDUFS3 oryCun2.0
Oryzias latipes 22114 ENSORLP00000022940 101158672 ENSORLG00000018322 ndufs3 oryLat2
Otolemur garnettii 10384 ENSOGAP00000010385 100941289 ENSOGAG00000011606 NDUFS3 otoGar1
Pan troglodytes 11867 ENSPTRP00000006209 451175 ENSPTRG00000003571 NDUFS3 panTro2
Pediculus humanus 9437 PHUM564490-PA 8234782 PHUM564490 PhumU1
Pogonomyrmex barbatus 6675 PB16675-PA 1.2
Pongo abelii 9808 ENSPPYP00000003783 100446873 ENSPPYG00000003299 LOC100446873 ponAbe2
Procavia capensis 8819 ENSPCAP00000008728 ENSPCAG00000009367 NDUFS3 proCap1
Pteropus vampyrus 16675 ENSPVAP00000006930 ENSPVAG00000007344 NDUFS3 pteVam1
Rattus norvegicus 13219 ENSRNOP00000012425 295923 ENSRNOG00000009155 Ndufs3 rn4
Rhesus macaque 14962 ENSMMUP00000005738 713040 ENSMMUG00000004286 rheMac2
Sorex araneus 6585 ENSSARP00000006579 ENSSARG00000007267 NDUFS3 sorAra1
Spermophilus tridecemlineatus 567 ENSSTOP00000000568 101972781 ENSSTOG00000000622 Ndufs3 speTri1
Sus scrofa 14003 ENSSSCP00000014057 100510948 ENSSSCG00000013229 NDUFS3 susScr2
Taeniopygia guttata 14152 ENSTGUP00000010676 100228726 ENSTGUG00000010343 taeGut1
Taeniopygia guttata 14165 ENSTGUP00000010680 ENSTGUG00000010357 taeGut1
Tarsius syrichta 7080 ENSTSYP00000002204 103253931 ENSTSYG00000002403 NDUFS3 tarSyr1
Tetraodon nigroviridis 13814 ENSTNIP00000021966 ENSTNIG00000018784 ndufs3 tetNig2
Tupaia belangeri 5543 ENSTBEP00000005531 ENSTBEG00000006433 NDUFS3 tupBel1
Tursiops truncatus 13134 ENSTTRP00000013432 ENSTTRG00000014164 NDUFS3 turTru1
Vicugna pacos 1241 ENSVPAP00000004881 ENSVPAG00000005257 NDUFS3 vicPac1
Xenopus tropicalis 4505 ENSXETP00000043132 394690 ENSXETG00000019932 ndufs3 xenTro2

multiple sequence alignment in CLUSTALW format


Bombyx_mori|1472                  ------------------------------------------------------------
Caenorhabditis_elegans|1745       ------------------------------------------------------------
Apis_mellifera|34131              ------------------------------------------------------------
Pediculus_humanus|9612            ------------------------------------------------------------
Echinops_telfairi|14665           ------------------------------------------------------------
Branchiostoma_floridae|18878      ------------------------------------------------------------
Choloepus_hoffmanni|1658          ------------------------------------------------------------
Dipodomys_ordii|10698             ------------------------------------------------------------
Ochotona_princeps|5383            ------------------------------------------------------------
Tursiops_truncatus|13883          ------------------------------------------------------------
Danio_rerio|29215                 ------------------------------------------------------------
Tetraodon_nigroviridis|14433      ------------------------------------------------------------
Gasterosteus_aculeatus|2706       ------------------------------------------------------------
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           ------------------------------------------------------------
Sorex_araneus|7405                ------------------------------------------------------------
Otolemur_garnettii|12074          ------------------------------------------------------------
Dasypus_novemcinctus|7086         ------------------------------------------------------------
Tupaia_belangeri|6420             ------------------------------------------------------------
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             ------------------------------------------------------------
Cavia_porcellus|21637             ------------------------------------------------------------
Vicugna_pacos|1330                ------------------------------------------------------------
Anolis_carolinensis|2777          ------------------------------------------------------------
Gallus_gallus|16773               ------------------------------------------------------------
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         ------------------------------------------------------------
Monodelphis_domestica|24637       ------------------------------------------------------------
Macropus_eugenii|12713            ------------------------------------------------------------
Ornithorhynchus_anatinus|16840    ------------------------------------------------------------
Microcebus_murinus|1163           ------------------------------------------------------------
Mus_musculus|22981                ------------------------------------------------------------
Rattus_norvegicus|22470           ------------------------------------------------------------
Callithrix_jacchus|41072          ------------------------------------------------------------
Procavia_capensis|9423            ------------------------------------------------------------
Rhesus_macaque|12579              ------------------------------------------------------------
Pongo_abelii|4686                 ------------------------------------------------------------
Homo_sapiens|17579                ------------------------------------------------------------
Pan_troglodytes|6811              ------------------------------------------------------------
Oryctolagus_cuniculus|1824        ------------------------------------------------------------
Loxodonta_africana|10391          ------------------------------------------------------------
Sus_scrofa|9854                   ------------------------------------------------------------
Bos_taurus|6586                   ------------------------------------------------------------
Pteropus_vampyrus|17693           ------------------------------------------------------------
Equus_caballus|5167               ------------------------------------------------------------
Felis_catus|42678                 ------------------------------------------------------------
Canis_familiaris|8459             ------------------------------------------------------------
Spermophilus_tridecemlineatus|623 ------------------------------------------------------------
Erinaceus_europaeus|8157          ------------------------------------------------------------
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           ------------------------------------------------------------
Linepithema_humile|12923          ------------------------------------------------------------
Pogonomyrmex_barbatus|8503        ------------------------------------------------------------
Nasonia_vitripennis|16429         ------------------------------------------------------------
Drosophila_persimilis|10001       ------------------------------------------------------------
Drosophila_melanogaster|9698      ------------------------------------------------------------
Drosophila_sechellia|15374        ------------------------------------------------------------
Drosophila_simulans|7898          ------------------------------------------------------------
Bombyx_mori|4173                  ------------------------------------------------------------
Culex_quinquefasciatus|5100       ATGGCCTCGATCCTGCGCTCGCTGGCCACGGTGGCCCGCAGCGGCGTCCTCGCCGGAAAT
Daphnia_pulex|25769               ------------------------------------------------------------
                                                                                              

Bombyx_mori|1472                  ------------------------------------------------------------
Caenorhabditis_elegans|1745       ------------------------------------------------------------
Apis_mellifera|34131              ------------------------------------------------------------
Pediculus_humanus|9612            ------------------------------------------------------------
Echinops_telfairi|14665           ------------------------------------------------------------
Branchiostoma_floridae|18878      ------------------------------------------------------------
Choloepus_hoffmanni|1658          ------------------------------------------------------------
Dipodomys_ordii|10698             ------------------------------------------------------------
Ochotona_princeps|5383            ------------------------------------------------------------
Tursiops_truncatus|13883          ------------------------------------------------------------
Danio_rerio|29215                 ------------------------------------------------------------
Tetraodon_nigroviridis|14433      ------------------------------------------------------------
Gasterosteus_aculeatus|2706       ------------------------------------------------------------
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           ------------------------------------------------------------
Sorex_araneus|7405                ------------------------------------------------------------
Otolemur_garnettii|12074          ------------------------------------------------------------
Dasypus_novemcinctus|7086         ------------------------------------------------------------
Tupaia_belangeri|6420             ------------------------------------------------------------
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             ------------------------------------------------------------
Cavia_porcellus|21637             ------------------------------------------------------------
Vicugna_pacos|1330                ------------------------------------------------------------
Anolis_carolinensis|2777          ------------------------------------------------------------
Gallus_gallus|16773               ------------------------------------------------------------
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         ------------------------------------------------------------
Monodelphis_domestica|24637       ------------------------------------------------------------
Macropus_eugenii|12713            ------------------------------------------------------------
Ornithorhynchus_anatinus|16840    ------------------------------------------------------------
Microcebus_murinus|1163           ------------------------------------------------------------
Mus_musculus|22981                ------------------------------------------------------------
Rattus_norvegicus|22470           ------------------------------------------------------------
Callithrix_jacchus|41072          ------------------------------------------------------------
Procavia_capensis|9423            ------------------------------------------------------------
Rhesus_macaque|12579              ------------------------------------------------------------
Pongo_abelii|4686                 ------------------------------------------------------------
Homo_sapiens|17579                ------------------------------------------------------------
Pan_troglodytes|6811              ------------------------------------------------------------
Oryctolagus_cuniculus|1824        ------------------------------------------------------------
Loxodonta_africana|10391          ------------------------------------------------------------
Sus_scrofa|9854                   ------------------------------------------------------------
Bos_taurus|6586                   ------------------------------------------------------------
Pteropus_vampyrus|17693           ------------------------------------------------------------
Equus_caballus|5167               ------------------------------------------------------------
Felis_catus|42678                 ------------------------------------------------------------
Canis_familiaris|8459             ------------------------------------------------------------
Spermophilus_tridecemlineatus|623 ------------------------------------------------------------
Erinaceus_europaeus|8157          ------------------------------------------------------------
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           ------------------------------------------------------------
Linepithema_humile|12923          ------------------------------------------------------------
Pogonomyrmex_barbatus|8503        ------------------------------------------------------------
Nasonia_vitripennis|16429         ------------------------------------------------------------
Drosophila_persimilis|10001       ------------------------------------------------------------
Drosophila_melanogaster|9698      ------------------------------------------------------------
Drosophila_sechellia|15374        ------------------------------------------------------------
Drosophila_simulans|7898          ------------------------------------------------------------
Bombyx_mori|4173                  ------------------------------------------------------------
Culex_quinquefasciatus|5100       GCAACTGTCCGCAAGCCGGATGCTGCCGCTCGTGCCGATTTGTCCGACTTTGGAAAGTAC
Daphnia_pulex|25769               ------------------------------------------------------------
                                                                                              

Bombyx_mori|1472                  ------------------------------------------------------------
Caenorhabditis_elegans|1745       ------------------------------------------------------------
Apis_mellifera|34131              ------------------------------------------------------------
Pediculus_humanus|9612            ------------------------------------------------------------
Echinops_telfairi|14665           ------------------------------------------------------------
Branchiostoma_floridae|18878      ------------------------------------------------------------
Choloepus_hoffmanni|1658          ------------------------------------------------------------
Dipodomys_ordii|10698             ------------------------------------------------------------
Ochotona_princeps|5383            ------------------------------------------------------------
Tursiops_truncatus|13883          ------------------------------------------------------------
Danio_rerio|29215                 ------------------------------------------------------------
Tetraodon_nigroviridis|14433      ------------------------------------------------------------
Gasterosteus_aculeatus|2706       ------------------------------------------------------------
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           ------------------------------------------------------------
Sorex_araneus|7405                ------------------------------------------------------------
Otolemur_garnettii|12074          ------------------------------------------------------------
Dasypus_novemcinctus|7086         ------------------------------------------------------------
Tupaia_belangeri|6420             ------------------------------------------------------------
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             ------------------------------------------------------------
Cavia_porcellus|21637             ------------------------------------------------------------
Vicugna_pacos|1330                ------------------------------------------------------------
Anolis_carolinensis|2777          ------------------------------------------------------------
Gallus_gallus|16773               ------------------------------------------------------------
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         ------------------------------------------------------------
Monodelphis_domestica|24637       ------------------------------------------------------------
Macropus_eugenii|12713            ------------------------------------------------------------
Ornithorhynchus_anatinus|16840    ------------------------------------------------------------
Microcebus_murinus|1163           ------------------------------------------------------------
Mus_musculus|22981                ------------------------------------------------------------
Rattus_norvegicus|22470           ------------------------------------------------------------
Callithrix_jacchus|41072          ------------------------------------------------------------
Procavia_capensis|9423            ------------------------------------------------------------
Rhesus_macaque|12579              ------------------------------------------------------------
Pongo_abelii|4686                 ------------------------------------------------------------
Homo_sapiens|17579                ------------------------------------------------------------
Pan_troglodytes|6811              ------------------------------------------------------------
Oryctolagus_cuniculus|1824        ------------------------------------------------------------
Loxodonta_africana|10391          ------------------------------------------------------------
Sus_scrofa|9854                   ------------------------------------------------------------
Bos_taurus|6586                   ------------------------------------------------------------
Pteropus_vampyrus|17693           ------------------------------------------------------------
Equus_caballus|5167               ------------------------------------------------------------
Felis_catus|42678                 ------------------------------------------------------------
Canis_familiaris|8459             ------------------------------------------------------------
Spermophilus_tridecemlineatus|623 ------------------------------------------------------------
Erinaceus_europaeus|8157          ------------------------------------------------------------
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           ------------------------------------------------------------
Linepithema_humile|12923          ------------------------------------------------------------
Pogonomyrmex_barbatus|8503        ------------------------------------------------------------
Nasonia_vitripennis|16429         ------------------------------------------------------------
Drosophila_persimilis|10001       ------------------------------------------------------------
Drosophila_melanogaster|9698      ------------------------------------------------------------
Drosophila_sechellia|15374        ------------------------------------------------------------
Drosophila_simulans|7898          ------------------------------------------------------------
Bombyx_mori|4173                  ------------------------------------------------------------
Culex_quinquefasciatus|5100       GTCGCCGAGTGTATGCCCAAGTACGTCCAGAAGGTGCAGCTCACTTCGGGCGATGAGCTG
Daphnia_pulex|25769               ------------------------------------------------------------
                                                                                              

Bombyx_mori|1472                  ------------------------------------------------------------
Caenorhabditis_elegans|1745       ------------------------------------------------------------
Apis_mellifera|34131              ------------------------------------------------------------
Pediculus_humanus|9612            ------------------------------------------------------------
Echinops_telfairi|14665           ------------------------------------------------------------
Branchiostoma_floridae|18878      ------------------------------------------------------------
Choloepus_hoffmanni|1658          ------------------------------------------------------------
Dipodomys_ordii|10698             ------------------------------------------------------------
Ochotona_princeps|5383            ------------------------------------------------------------
Tursiops_truncatus|13883          ------------------------------------------------------------
Danio_rerio|29215                 ------------------------------------------------------------
Tetraodon_nigroviridis|14433      ------------------------------------------------------------
Gasterosteus_aculeatus|2706       ------------------------------------------------------------
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           ------------------------------------------------------------
Sorex_araneus|7405                ------------------------------------------------------------
Otolemur_garnettii|12074          ------------------------------------------------------------
Dasypus_novemcinctus|7086         ------------------------------------------------------------
Tupaia_belangeri|6420             ------------------------------------------------------------
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             ------------------------------------------------------------
Cavia_porcellus|21637             ------------------------------------------------------------
Vicugna_pacos|1330                ------------------------------------------------------------
Anolis_carolinensis|2777          ------------------------------------------------------------
Gallus_gallus|16773               ------------------------------------------------------------
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         ------------------------------------------------------------
Monodelphis_domestica|24637       ------------------------------------------------------------
Macropus_eugenii|12713            ------------------------------------------------------------
Ornithorhynchus_anatinus|16840    ------------------------------------------------------------
Microcebus_murinus|1163           ------------------------------------------------------------
Mus_musculus|22981                ------------------------------------------------------------
Rattus_norvegicus|22470           ------------------------------------------------------------
Callithrix_jacchus|41072          ------------------------------------------------------------
Procavia_capensis|9423            ------------------------------------------------------------
Rhesus_macaque|12579              ------------------------------------------------------------
Pongo_abelii|4686                 ------------------------------------------------------------
Homo_sapiens|17579                ------------------------------------------------------------
Pan_troglodytes|6811              ------------------------------------------------------------
Oryctolagus_cuniculus|1824        ------------------------------------------------------------
Loxodonta_africana|10391          ------------------------------------------------------------
Sus_scrofa|9854                   ------------------------------------------------------------
Bos_taurus|6586                   ------------------------------------------------------------
Pteropus_vampyrus|17693           ------------------------------------------------------------
Equus_caballus|5167               ------------------------------------------------------------
Felis_catus|42678                 ------------------------------------------------------------
Canis_familiaris|8459             ------------------------------------------------------------
Spermophilus_tridecemlineatus|623 ------------------------------------------------------------
Erinaceus_europaeus|8157          ------------------------------------------------------------
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           ------------------------------------------------------------
Linepithema_humile|12923          ------------------------------------------------------------
Pogonomyrmex_barbatus|8503        ------------------------------------------------------------
Nasonia_vitripennis|16429         ------------------------------------------------------------
Drosophila_persimilis|10001       ------------------------------------------------------------
Drosophila_melanogaster|9698      ------------------------------------------------------------
Drosophila_sechellia|15374        ------------------------------------------------------------
Drosophila_simulans|7898          ------------------------------------------------------------
Bombyx_mori|4173                  ------------------------------------------------------------
Culex_quinquefasciatus|5100       GAGGTGCTGATTGCCCCGGAGGGCGTCGTGCCGGTGTTGCAGTTCCTGAAGGATCACCAC
Daphnia_pulex|25769               ------------------------------------------------------------
                                                                                              

Bombyx_mori|1472                  ------------------------------------------------------------
Caenorhabditis_elegans|1745       ------------------------------------------------------------
Apis_mellifera|34131              ------------------------------------------------------------
Pediculus_humanus|9612            ------------------------------------------------------------
Echinops_telfairi|14665           ------------------------------------------------------------
Branchiostoma_floridae|18878      ------------------------------------------------------------
Choloepus_hoffmanni|1658          ------------------------------------------------------------
Dipodomys_ordii|10698             ------------------------------------------------------------
Ochotona_princeps|5383            ------------------------------------------------------------
Tursiops_truncatus|13883          ------------------------------------------------------------
Danio_rerio|29215                 ------------------------------------------------------------
Tetraodon_nigroviridis|14433      ------------------------------------------------------------
Gasterosteus_aculeatus|2706       ------------------------------------------------------------
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           ------------------------------------------------------------
Sorex_araneus|7405                ------------------------------------------------------------
Otolemur_garnettii|12074          ------------------------------------------------------------
Dasypus_novemcinctus|7086         ------------------------------------------------------------
Tupaia_belangeri|6420             ------------------------------------------------------------
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             ------------------------------------------------------------
Cavia_porcellus|21637             ------------------------------------------------------------
Vicugna_pacos|1330                ------------------------------------------------------------
Anolis_carolinensis|2777          ------------------------------------------------------------
Gallus_gallus|16773               ------------------------------------------------------------
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         ------------------------------------------------------------
Monodelphis_domestica|24637       ------------------------------------------------------------
Macropus_eugenii|12713            ------------------------------------------------------------
Ornithorhynchus_anatinus|16840    ------------------------------------------------------------
Microcebus_murinus|1163           ------------------------------------------------------------
Mus_musculus|22981                ------------------------------------------------------------
Rattus_norvegicus|22470           ------------------------------------------------------------
Callithrix_jacchus|41072          ------------------------------------------------------------
Procavia_capensis|9423            ------------------------------------------------------------
Rhesus_macaque|12579              ------------------------------------------------------------
Pongo_abelii|4686                 ------------------------------------------------------------
Homo_sapiens|17579                ------------------------------------------------------------
Pan_troglodytes|6811              ------------------------------------------------------------
Oryctolagus_cuniculus|1824        ------------------------------------------------------------
Loxodonta_africana|10391          ------------------------------------------------------------
Sus_scrofa|9854                   ------------------------------------------------------------
Bos_taurus|6586                   ------------------------------------------------------------
Pteropus_vampyrus|17693           ------------------------------------------------------------
Equus_caballus|5167               ------------------------------------------------------------
Felis_catus|42678                 ------------------------------------------------------------
Canis_familiaris|8459             ------------------------------------------------------------
Spermophilus_tridecemlineatus|623 ------------------------------------------------------------
Erinaceus_europaeus|8157          ------------------------------------------------------------
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           ------------------------------------------------------------
Linepithema_humile|12923          ------------------------------------------------------------
Pogonomyrmex_barbatus|8503        ------------------------------------------------------------
Nasonia_vitripennis|16429         ------------------------------------------------------------
Drosophila_persimilis|10001       ------------------------------------------------------------
Drosophila_melanogaster|9698      ------------------------------------------------------------
Drosophila_sechellia|15374        ------------------------------------------------------------
Drosophila_simulans|7898          ------------------------------------------------------------
Bombyx_mori|4173                  ------------------------------------------------------------
Culex_quinquefasciatus|5100       CAGGCGCAGTTCGCAAATCTGGTCGACATTGCCGGGATGGACGTTCCGAGCCGTCAGTAC
Daphnia_pulex|25769               ------------------------------------------------------------
                                                                                              

Bombyx_mori|1472                  ------------------------------------------------------------
Caenorhabditis_elegans|1745       ------------------------------------------------------------
Apis_mellifera|34131              ------------------------------------------------------------
Pediculus_humanus|9612            ------------------------------------------------------------
Echinops_telfairi|14665           ------------------------------------------------------------
Branchiostoma_floridae|18878      ------------------------------------------------------------
Choloepus_hoffmanni|1658          ------------------------------------------------------------
Dipodomys_ordii|10698             ------------------------------------------------------------
Ochotona_princeps|5383            ------------------------------------------------------------
Tursiops_truncatus|13883          ------------------------------------------------------------
Danio_rerio|29215                 ------------------------------------------------------------
Tetraodon_nigroviridis|14433      ------------------------------------------------------------
Gasterosteus_aculeatus|2706       ------------------------------------------------------------
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           ------------------------------------------------------------
Sorex_araneus|7405                ------------------------------------------------------------
Otolemur_garnettii|12074          ------------------------------------------------------------
Dasypus_novemcinctus|7086         ------------------------------------------------------------
Tupaia_belangeri|6420             ------------------------------------------------------------
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             ------------------------------------------------------------
Cavia_porcellus|21637             ------------------------------------------------------------
Vicugna_pacos|1330                ------------------------------------------------------------
Anolis_carolinensis|2777          ------------------------------------------------------------
Gallus_gallus|16773               ------------------------------------------------------------
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         ------------------------------------------------------------
Monodelphis_domestica|24637       ------------------------------------------------------------
Macropus_eugenii|12713            ------------------------------------------------------------
Ornithorhynchus_anatinus|16840    ------------------------------------------------------------
Microcebus_murinus|1163           ------------------------------------------------------------
Mus_musculus|22981                ------------------------------------------------------------
Rattus_norvegicus|22470           ------------------------------------------------------------
Callithrix_jacchus|41072          ------------------------------------------------------------
Procavia_capensis|9423            ------------------------------------------------------------
Rhesus_macaque|12579              ------------------------------------------------------------
Pongo_abelii|4686                 ------------------------------------------------------------
Homo_sapiens|17579                ------------------------------------------------------------
Pan_troglodytes|6811              ------------------------------------------------------------
Oryctolagus_cuniculus|1824        ------------------------------------------------------------
Loxodonta_africana|10391          ------------------------------------------------------------
Sus_scrofa|9854                   ------------------------------------------------------------
Bos_taurus|6586                   ------------------------------------------------------------
Pteropus_vampyrus|17693           ------------------------------------------------------------
Equus_caballus|5167               ------------------------------------------------------------
Felis_catus|42678                 ------------------------------------------------------------
Canis_familiaris|8459             ------------------------------------------------------------
Spermophilus_tridecemlineatus|623 ------------------------------------------------------------
Erinaceus_europaeus|8157          ------------------------------------------------------------
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           ------------------------------------------------------------
Linepithema_humile|12923          ------------------------------------------------------------
Pogonomyrmex_barbatus|8503        ------------------------------------------------------------
Nasonia_vitripennis|16429         ------------------------------------------------------------
Drosophila_persimilis|10001       ------------------------------------------------------------
Drosophila_melanogaster|9698      ------------------------------------------------------------
Drosophila_sechellia|15374        ------------------------------------------------------------
Drosophila_simulans|7898          ------------------------------------------------------------
Bombyx_mori|4173                  ------------------------------------------------------------
Culex_quinquefasciatus|5100       CGGTTCGAGGTCATCTACAACATCCTGTCGCTGCGGTACAACTCGCGGATCCGCGTCAAG
Daphnia_pulex|25769               ------------------------------------------------------------
                                                                                              

Bombyx_mori|1472                  ------------------------------------------------------------
Caenorhabditis_elegans|1745       ------------------------------------------------------------
Apis_mellifera|34131              ------------------------------------------------------------
Pediculus_humanus|9612            ------------------------------------------------------------
Echinops_telfairi|14665           ------------------------------------------------------------
Branchiostoma_floridae|18878      ------------------------------------------------------------
Choloepus_hoffmanni|1658          ------------------------------------------------------------
Dipodomys_ordii|10698             ------------------------------------------------------------
Ochotona_princeps|5383            ------------------------------------------------------------
Tursiops_truncatus|13883          ------------------------------------------------------------
Danio_rerio|29215                 ------------------------------------------------------------
Tetraodon_nigroviridis|14433      ------------------------------------------------------------
Gasterosteus_aculeatus|2706       ------------------------------------------------------------
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           ------------------------------------------------------------
Sorex_araneus|7405                ------------------------------------------------------------
Otolemur_garnettii|12074          ------------------------------------------------------------
Dasypus_novemcinctus|7086         ------------------------------------------------------------
Tupaia_belangeri|6420             ------------------------------------------------------------
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             ------------------------------------------------------------
Cavia_porcellus|21637             ------------------------------------------------------------
Vicugna_pacos|1330                ------------------------------------------------------------
Anolis_carolinensis|2777          ------------------------------------------------------------
Gallus_gallus|16773               ------------------------------------------------------------
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         ------------------------------------------------------------
Monodelphis_domestica|24637       ------------------------------------------------------------
Macropus_eugenii|12713            ------------------------------------------------------------
Ornithorhynchus_anatinus|16840    ------------------------------------------------------------
Microcebus_murinus|1163           ------------------------------------------------------------
Mus_musculus|22981                ------------------------------------------------------------
Rattus_norvegicus|22470           ------------------------------------------------------------
Callithrix_jacchus|41072          ------------------------------------------------------------
Procavia_capensis|9423            ------------------------------------------------------------
Rhesus_macaque|12579              ------------------------------------------------------------
Pongo_abelii|4686                 ------------------------------------------------------------
Homo_sapiens|17579                ------------------------------------------------------------
Pan_troglodytes|6811              ------------------------------------------------------------
Oryctolagus_cuniculus|1824        ------------------------------------------------------------
Loxodonta_africana|10391          ------------------------------------------------------------
Sus_scrofa|9854                   ------------------------------------------------------------
Bos_taurus|6586                   ------------------------------------------------------------
Pteropus_vampyrus|17693           ------------------------------------------------------------
Equus_caballus|5167               ------------------------------------------------------------
Felis_catus|42678                 ------------------------------------------------------------
Canis_familiaris|8459             ------------------------------------------------------------
Spermophilus_tridecemlineatus|623 ------------------------------------------------------------
Erinaceus_europaeus|8157          ------------------------------------------------------------
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           ------------------------------------------------------------
Linepithema_humile|12923          ------------------------------------------------------------
Pogonomyrmex_barbatus|8503        ------------------------------------------------------------
Nasonia_vitripennis|16429         ------------------------------------------------------------
Drosophila_persimilis|10001       ------------------------------------------------------------
Drosophila_melanogaster|9698      ------------------------------------------------------------
Drosophila_sechellia|15374        ------------------------------------------------------------
Drosophila_simulans|7898          ------------------------------------------------------------
Bombyx_mori|4173                  ------------------------------------------------------------
Culex_quinquefasciatus|5100       ACCTACACCGACGAGCTGACCCCGATCGATTCGTGCAACGAGGTGTTCAAGGCCGCCAAT
Daphnia_pulex|25769               ------------------------------------------------------------
                                                                                              

Bombyx_mori|1472                  ------------------------------------------------------------
Caenorhabditis_elegans|1745       ------------------------------------------------------------
Apis_mellifera|34131              ------------------------------------------------------------
Pediculus_humanus|9612            ------------------------------------------------------------
Echinops_telfairi|14665           ------------------------------------------------------------
Branchiostoma_floridae|18878      ------------------------------------------------------------
Choloepus_hoffmanni|1658          ------------------------------------------------------------
Dipodomys_ordii|10698             ------------------------------------------------------------
Ochotona_princeps|5383            ------------------------------------------------------------
Tursiops_truncatus|13883          ------------------------------------------------------------
Danio_rerio|29215                 ------------------------------------------------------------
Tetraodon_nigroviridis|14433      ------------------------------------------------------------
Gasterosteus_aculeatus|2706       ------------------------------------------------------------
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           ------------------------------------------------------------
Sorex_araneus|7405                ------------------------------------------------------------
Otolemur_garnettii|12074          ------------------------------------------------------------
Dasypus_novemcinctus|7086         ------------------------------------------------------------
Tupaia_belangeri|6420             ------------------------------------------------------------
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             ------------------------------------------------------------
Cavia_porcellus|21637             ------------------------------------------------------------
Vicugna_pacos|1330                ------------------------------------------------------------
Anolis_carolinensis|2777          ------------------------------------------------------------
Gallus_gallus|16773               ------------------------------------------------------------
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         ------------------------------------------------------------
Monodelphis_domestica|24637       ------------------------------------------------------------
Macropus_eugenii|12713            ------------------------------------------------------------
Ornithorhynchus_anatinus|16840    ------------------------------------------------------------
Microcebus_murinus|1163           ------------------------------------------------------------
Mus_musculus|22981                ------------------------------------------------------------
Rattus_norvegicus|22470           ------------------------------------------------------------
Callithrix_jacchus|41072          ------------------------------------------------------------
Procavia_capensis|9423            ------------------------------------------------------------
Rhesus_macaque|12579              ------------------------------------------------------------
Pongo_abelii|4686                 ------------------------------------------------------------
Homo_sapiens|17579                ------------------------------------------------------------
Pan_troglodytes|6811              ------------------------------------------------------------
Oryctolagus_cuniculus|1824        ------------------------------------------------------------
Loxodonta_africana|10391          ------------------------------------------------------------
Sus_scrofa|9854                   ------------------------------------------------------------
Bos_taurus|6586                   ------------------------------------------------------------
Pteropus_vampyrus|17693           ------------------------------------------------------------
Equus_caballus|5167               ------------------------------------------------------------
Felis_catus|42678                 ------------------------------------------------------------
Canis_familiaris|8459             ------------------------------------------------------------
Spermophilus_tridecemlineatus|623 ------------------------------------------------------------
Erinaceus_europaeus|8157          ------------------------------------------------------------
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           ------------------------------------------------------------
Linepithema_humile|12923          ------------------------------------------------------------
Pogonomyrmex_barbatus|8503        ------------------------------------------------------------
Nasonia_vitripennis|16429         ------------------------------------------------------------
Drosophila_persimilis|10001       ------------------------------------------------------------
Drosophila_melanogaster|9698      ------------------------------------------------------------
Drosophila_sechellia|15374        ------------------------------------------------------------
Drosophila_simulans|7898          ------------------------------------------------------------
Bombyx_mori|4173                  ------------------------------------------------------------
Culex_quinquefasciatus|5100       TGGTACGAGCGCGAAATCTGGGACATGTACGGTGTGTTCTTCGCGAACCACCCGGACCTG
Daphnia_pulex|25769               ------------------------------------------------------------
                                                                                              

Bombyx_mori|1472                  ------------------------------------------------------------
Caenorhabditis_elegans|1745       ---ATGGACAGCGAAATTTTAAATTATCCAATCCATCGATTCCTCGACTCGTCACTTCTC
Apis_mellifera|34131              ------------------------------------------------------------
Pediculus_humanus|9612            ------------------------------------------------------------
Echinops_telfairi|14665           ------------------------------------------------------------
Branchiostoma_floridae|18878      ------------------------------------------------------------
Choloepus_hoffmanni|1658          ------------------------------------------------------------
Dipodomys_ordii|10698             ------------------------------------------------------------
Ochotona_princeps|5383            ------------------------------------------------------------
Tursiops_truncatus|13883          ------------------------------------------------------------
Danio_rerio|29215                 ------------------------------------------------------------
Tetraodon_nigroviridis|14433      ------------------------------------------------------------
Gasterosteus_aculeatus|2706       ------------------------------------------------------------
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           ------------------------------------------------------------
Sorex_araneus|7405                ------------------------------------------------------------
Otolemur_garnettii|12074          ------------------------------------------------------------
Dasypus_novemcinctus|7086         ------------------------------------------------------------
Tupaia_belangeri|6420             ------------------------------------------------------------
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             ------------------------------------------------------------
Cavia_porcellus|21637             ------------------------------------------------------------
Vicugna_pacos|1330                ------------------------------------------------------------
Anolis_carolinensis|2777          ------------------------------------------------------------
Gallus_gallus|16773               ------------------------------------------------------------
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         ------------------------------------------------------------
Monodelphis_domestica|24637       ------------------------------------------------------------
Macropus_eugenii|12713            ------------------------------------------------------------
Ornithorhynchus_anatinus|16840    ------------------------------------------------------------
Microcebus_murinus|1163           ------------------------------------------------------------
Mus_musculus|22981                ------------------------------------------------------------
Rattus_norvegicus|22470           ------------------------------------------------------------
Callithrix_jacchus|41072          ------------------------------------------------------------
Procavia_capensis|9423            ------------------------------------------------------------
Rhesus_macaque|12579              ------------------------------------------------------------
Pongo_abelii|4686                 ------------------------------------------------------------
Homo_sapiens|17579                ------------------------------------------------------------
Pan_troglodytes|6811              ------------------------------------------------------------
Oryctolagus_cuniculus|1824        ------------------------------------------------------------
Loxodonta_africana|10391          ------------------------------------------------------------
Sus_scrofa|9854                   ------------------------------------------------------------
Bos_taurus|6586                   ------------------------------------------------------------
Pteropus_vampyrus|17693           ------------------------------------------------------------
Equus_caballus|5167               ------------------------------------------------------------
Felis_catus|42678                 ------------------------------------------------------------
Canis_familiaris|8459             ------------------------------------------------------------
Spermophilus_tridecemlineatus|623 ------------------------------------------------------------
Erinaceus_europaeus|8157          ------------------------------------------------------------
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           ------------------------------------------------------------
Linepithema_humile|12923          ------------------------------------------------------------
Pogonomyrmex_barbatus|8503        ------------------------------------------------------------
Nasonia_vitripennis|16429         ------------------------------------------------------------
Drosophila_persimilis|10001       ------------------------------------------------------------
Drosophila_melanogaster|9698      ------------------------------------------------------------
Drosophila_sechellia|15374        ------------------------------------------------------------
Drosophila_simulans|7898          ------------------------------------------------------------
Bombyx_mori|4173                  ------------------------------------------------------------
Culex_quinquefasciatus|5100       CGTCGCATCCTGACCGATTACGGGTTTGAGGGACACCCGCAGCGCCGTGACTTCCCGCTG
Daphnia_pulex|25769               ------------------------------------------------------------
                                                                                              

Bombyx_mori|1472                  ------------------------------------------------------------
Caenorhabditis_elegans|1745       GGTCAGTTCATTGGGCCCGAAGGAAGCAACATCTACAAAATTGAAAAATATAACAAAGTT
Apis_mellifera|34131              ------------------------------------------------------------
Pediculus_humanus|9612            ------------------------------------------------------------
Echinops_telfairi|14665           ------------------------------------------------------------
Branchiostoma_floridae|18878      ------------------------------------------------------------
Choloepus_hoffmanni|1658          ------------------------------------------------------------
Dipodomys_ordii|10698             ------------------------------------------------------------
Ochotona_princeps|5383            ------------------------------------------------------------
Tursiops_truncatus|13883          ------------------------------------------------------------
Danio_rerio|29215                 ------------------------------------------------------------
Tetraodon_nigroviridis|14433      ------------------------------------------------------------
Gasterosteus_aculeatus|2706       ------------------------------------------------------------
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           ------------------------------------------------------------
Sorex_araneus|7405                ------------------------------------------------------------
Otolemur_garnettii|12074          ------------------------------------------------------------
Dasypus_novemcinctus|7086         ------------------------------------------------------------
Tupaia_belangeri|6420             ------------------------------------------------------------
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             ------------------------------------------------------------
Cavia_porcellus|21637             ------------------------------------------------------------
Vicugna_pacos|1330                ------------------------------------------------------------
Anolis_carolinensis|2777          ------------------------------------------------------------
Gallus_gallus|16773               ------------------------------------------------------------
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         ------------------------------------------------------------
Monodelphis_domestica|24637       ------------------------------------------------------------
Macropus_eugenii|12713            ------------------------------------------------------------
Ornithorhynchus_anatinus|16840    ------------------------------------------------------------
Microcebus_murinus|1163           ------------------------------------------------------------
Mus_musculus|22981                ------------------------------------------------------------
Rattus_norvegicus|22470           ------------------------------------------------------------
Callithrix_jacchus|41072          ------------------------------------------------------------
Procavia_capensis|9423            ------------------------------------------------------------
Rhesus_macaque|12579              ------------------------------------------------------------
Pongo_abelii|4686                 ------------------------------------------------------------
Homo_sapiens|17579                ------------------------------------------------------------
Pan_troglodytes|6811              ------------------------------------------------------------
Oryctolagus_cuniculus|1824        ------------------------------------------------------------
Loxodonta_africana|10391          ------------------------------------------------------------
Sus_scrofa|9854                   ------------------------------------------------------------
Bos_taurus|6586                   ------------------------------------------------------------
Pteropus_vampyrus|17693           ------------------------------------------------------------
Equus_caballus|5167               ------------------------------------------------------------
Felis_catus|42678                 ------------------------------------------------------------
Canis_familiaris|8459             ------------------------------------------------------------
Spermophilus_tridecemlineatus|623 ------------------------------------------------------------
Erinaceus_europaeus|8157          ------------------------------------------------------------
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           ------------------------------------------------------------
Linepithema_humile|12923          ------------------------------------------------------------
Pogonomyrmex_barbatus|8503        ------------------------------------------------------------
Nasonia_vitripennis|16429         ------------------------------------------------------------
Drosophila_persimilis|10001       ------------------------------------------------------------
Drosophila_melanogaster|9698      ------------------------------------------------------------
Drosophila_sechellia|15374        ------------------------------------------------------------
Drosophila_simulans|7898          ------------------------------------------------------------
Bombyx_mori|4173                  ------------------------------------------------------------
Culex_quinquefasciatus|5100       ACCGGGTACGTCGAGCTGCGGTACGACGACGAGAAGAAACGCGTCGTGTGCGAGCCGCTC
Daphnia_pulex|25769               ------------------------------------------------------------
                                                                                              

Bombyx_mori|1472                  ------------------------------------ATGTCGAAACTTCCACACGGAAAC
Caenorhabditis_elegans|1745       GCATTGGATATTTGGAAGAATGACGAAGAAAATTCAAATGTTCGTATTACTGGTCCGTAT
Apis_mellifera|34131              ---------------------------------------ATGTCATCTTTATTAAAAAAT
Pediculus_humanus|9612            ---------------------------------------ATGGCGTCTATGATTCGAGGT
Echinops_telfairi|14665           ---------------------------------------ATGGCGGCGGCGGCGGCGGGG
Branchiostoma_floridae|18878      ------------------------------------------------------------
Choloepus_hoffmanni|1658          ---------------------------------ATGGCGGCGGCGGCGGCGGTGTGGGGC
Dipodomys_ordii|10698             ------------------------------------ATGGCGGCCGCCGCGGCCGTGGTC
Ochotona_princeps|5383            ------------------------------------------ATGGCTGGGCTGGCCGGG
Tursiops_truncatus|13883          ---------------------------ATGGCGGCGGCGGCGGCGGCCAGCGGCTCGGAG
Danio_rerio|29215                 ------------------------------------ATGGCGGCCTCCTTGGTCAGATTT
Tetraodon_nigroviridis|14433      ------------------------------------ATGGCGGCCTCACTGGTGCGGTTT
Gasterosteus_aculeatus|2706       ------------------------------------------------------------
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           ------------------------------------------------------------
Sorex_araneus|7405                ---------------------------------------ATGGCGGCGGCGGCGAGAGGC
Otolemur_garnettii|12074          ------------------------------------ATGGCGGCGACGGCAGCCAGGGTC
Dasypus_novemcinctus|7086         ---------------------------------ATGGCGACGGCGGCGGCGACTAGGGGC
Tupaia_belangeri|6420             ------------------------------------ATGGCGGCTGCTGCAGCCAGGGTC
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             ------------------------------------ATGGCGCTGCCGGCCGCCAGAGCC
Cavia_porcellus|21637             ---------------------------CCGGGAAAAATGGCGGCCGCTGCGGCCAGGGTC
Vicugna_pacos|1330                ---------------------------------------ATGACATCAGCGGTTAAGGGC
Anolis_carolinensis|2777          ------------------------------------------------------------
Gallus_gallus|16773               ---------------------------------------GCGGCGGCGGTGCAGACCCGG
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         ------------------------------------------------------------
Monodelphis_domestica|24637       ---------------------------------------CTAGGGGCAGCAGGGGCGCGA
Macropus_eugenii|12713            ------------------------------------------------------------
Ornithorhynchus_anatinus|16840    ---------------------------------------GTCATGGCGGCGGCCGGCGGC
Microcebus_murinus|1163           ------------------------------------ATGGCGGCGACGGCGGCCAGGGTC
Mus_musculus|22981                ------------------------------------ATGGCGGCGGCTGCAGCCAGGGTC
Rattus_norvegicus|22470           ------------------------------------ATGGCGTCTGCTGCAGCCAGGGTC
Callithrix_jacchus|41072          ------------------------------------ATGGCGACGTTGGCAACCCGATTT
Procavia_capensis|9423            ---------------------------------------------ATGGCTGCGGCGAGG
Rhesus_macaque|12579              ---------------------------------ATGGCGGCGGCAGCGACAGCTAGGCTG
Pongo_abelii|4686                 ---------------------------------------GCGGCGGCGGTAGCCAGGCTG
Homo_sapiens|17579                ---------------------------------ATGGCGGCGGCGGCGGTAGCCAGGCTG
Pan_troglodytes|6811              ---------------------------------ATGGCGGCGGCGGCGGTAGCCAGGCTG
Oryctolagus_cuniculus|1824        ---------------------------CCGGGCAACATGGCGGCAGTGGCGGCCAGGGGC
Loxodonta_africana|10391          ---------------------------------------AACATGGCGGCGGCGAGGGGC
Sus_scrofa|9854                   ---------------------------------ATGGCGGCGGCGGCGGCTGCAAGGGGC
Bos_taurus|6586                   ------------------------ATggcggcggcggcggtggcggcggcggcTCGGGGT
Pteropus_vampyrus|17693           ---------------------------------------ATGGCGGCGGTAGCGGAGGGG
Equus_caballus|5167               ------------------------------GAGAACATGGCGGCGGCGGCGGCTAGGGGC
Felis_catus|42678                 ------------------------------ATGGCCGCGACGGCGGCTGCTGCGAGGGGC
Canis_familiaris|8459             ---------------------------------AGCATGGCGGCGGCGGCGGCCAGGGGC
Spermophilus_tridecemlineatus|623 ------------------------------------------ATGGCAGCCGTGGCGAGG
Erinaceus_europaeus|8157          ------------------------------------------------------------
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           ------------------------------------------ATGTCACTTCTTTTCGGC
Linepithema_humile|12923          ---------------------------------------ATGACTTCGATATTGAGAAAT
Pogonomyrmex_barbatus|8503        ---------------------------------------ATGACATCAATATTGAGAAAC
Nasonia_vitripennis|16429         ------------------------------------ATGGCCTTTGCCATGAAAAATGTT
Drosophila_persimilis|10001       ---------------------------------ATGGCAGCCATAATTAGGACTCTGGGT
Drosophila_melanogaster|9698      ---------------------------------ATGGCGGCCTTAATCAGGAATCTGGGT
Drosophila_sechellia|15374        ---------------------------------ATGGCGGCCTTAATCAGGAATCTGGGT
Drosophila_simulans|7898          ---------------------------------ATGGCGGCCTTAATCAGGAATCTGGGT
Bombyx_mori|4173                  ------------------------ATGTCCTTCTTCTTAAAACGCACTATTGGTGCGGGA
Culex_quinquefasciatus|5100       GAGTTGGCCCAGGAGTTCCGCAAGTTTGACCTGTCGGCGCCAGAATCTGCGGAGCAGTTT
Daphnia_pulex|25769               ------------------------------------------------------------
                                                                                              

Bombyx_mori|1472                  TTCTCCGAACGGAGAGTAAAGCCTTATGACGGCAAACAATCTGTA---------------
Caenorhabditis_elegans|1745       TGGAATCTGAAATCTGCTCTGAATGATGTGCTGGAACTGGTCTCGACTATCAGAAATAAA
Apis_mellifera|34131              TATTGGAAA---------CTCATGAGAAATCTTCCTGTTACAAGC---------------
Pediculus_humanus|9612            GTTTTAAGAAAT------------------------------------------------
Echinops_telfairi|14665           CTGTGGCGAGGC------CTCGTGGGGGCCACGGCGCTGGCCCGG---------------
Branchiostoma_floridae|18878      ------------------------------------------------------------
Choloepus_hoffmanni|1658          TGGTGGCGGGGG------CTCGCCGGAGCCACGGCGCTAGCCCGT---------------
Dipodomys_ordii|10698             TGGAGGCGCGGG------CTGGCGGGGGCCGCAGCTGTGGCCAGG---------------
Ochotona_princeps|5383            TGTTGGCGCGGG------TTGCTGGGGGCCGCGACGCTGGCCAGG---------------
Tursiops_truncatus|13883          CTGTGGCTGGGG------CTCGTGGGGTCCGCTGCGCTGGCCAGA---------------
Danio_rerio|29215                 GTCCGCAGCGGA------TTTGGCAGAAGCTTAAACGTTGCCAGA---------------
Tetraodon_nigroviridis|14433      GTCCGCGGGGGT------CTTGGAAGGAGTATTAACGTTGCAAGA---------------
Gasterosteus_aculeatus|2706       ------------------------------------------------------------
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           ---------------------------GCATGTGCTTTCCGCTCT---------------
Sorex_araneus|7405                TGGTGGCGCGGC------CTGGCGGGGGCCGTGGCGCTGAGCCGG---------------
Otolemur_garnettii|12074          TGGTGGCGCGGG------CTTGTGGGCTCCGCGGCGCTGGCCAGG---------------
Dasypus_novemcinctus|7086         TGGTGGCGGGGG------CTCGCGGGAGCCGCGGCGCTGGCCCGG---------------
Tupaia_belangeri|6420             TGGCTGCGCGGG------CTCGTGGGAGCCGCGGCGCTGGCCAGG---------------
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             TGTTGGCGCAGG------TTCGTGGGGTCCGCGGCGCTGGCCCGG---------------
Cavia_porcellus|21637             TGGTGGCGAGGG------CTCGTGGGGGCCAGAGCGGTGGCCGGG---------------
Vicugna_pacos|1330                TGGGGCGCCAAG---------------GTCCAAGAGCTGGCTAAG---------------
Anolis_carolinensis|2777          ------------------------------------------------------------
Gallus_gallus|16773               CTGGCGGGGGGC------------------------------------------------
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         ------------------------------------------------------------
Monodelphis_domestica|24637       GCGGGGCGGGGA------GTGACCGGGGCCGCCTCGGGCCTCCCT---------------
Macropus_eugenii|12713            ------------------------------------------------------------
Ornithorhynchus_anatinus|16840    CTGCTCCGGGGAGGGGGCCTGCTGAGGGGATCCGGCCTGCTGAGG---------------
Microcebus_murinus|1163           TGGTGGCGCAGG------CTTGCGGGGGCCGCGGCGCTGGCCAGG---------------
Mus_musculus|22981                TGGTGTCGTGGG------CTCTTGGGGGCCGCTTCCGTAGGCAGG---------------
Rattus_norvegicus|22470           TGGTGCCGTGGG------CTCTTGGGGGCTGCTTCCGTAGCCAGG---------------
Callithrix_jacchus|41072          TGGTGGCGCGGG------ATCGTGGGGGCCGCGGCGCTGACCAGA---------------
Procavia_capensis|9423            CTGTGGAGGGGG------CTGTTGGGCGCCGCGGCAATGGCCCGG---------------
Rhesus_macaque|12579              TGGTGGCGTGGA------ATCGTGGGGGCCGCGGCGCTGACGAGG---------------
Pongo_abelii|4686                 TGGTGGCGCGGG------ATCTTGGGGGCCTCGGCGCTGACCAGG---------------
Homo_sapiens|17579                TGGTGGCGCGGG------ATCTTGGGGGCCTCGGCGCTGACCAGG---------------
Pan_troglodytes|6811              TGGTGGCGCGGG------ATCTTGGGGGCCTCGGCGCTGACCAGG---------------
Oryctolagus_cuniculus|1824        TGGTGGCGCGGT------CTCGTGAGGGCCGCCACGCTGGCCAGG---------------
Loxodonta_africana|10391          TGGTGGCGGTTG------CTTGTGGGGACCGCGGCAATAGCCCGG---------------
Sus_scrofa|9854                   TGTTGGCGGGGG------CTCGTGGGGCCCGCGGCGGTGGCTAGG---------------
Bos_taurus|6586                   TGTTGGCAGAGG------CTCGTGGGGTCCGCGGCGCCGGCCATA---------------
Pteropus_vampyrus|17693           CTGTGGCGGGGG------TTCGTGGGAGCCGTGGCGCTGCCCAGG---------------
Equus_caballus|5167               TGGTGGCGGGGG------CTCGTGGGGACCGTGGCGCTGGCCAGG---------------
Felis_catus|42678                 TGGTGGCGGGGT------CTCGTAGGGTCCGTGGCGTTGGCCAGG---------------
Canis_familiaris|8459             TGGTGGCAGGGG------ATCAAGGGGTCCGTGGCGCTGGCCAGG---------------
Spermophilus_tridecemlineatus|623 TGGTGGCGGGGA------CTCTTGGAGGCTTCAGCGGTGGTCAGG---------------
Erinaceus_europaeus|8157          ------------------------------------------------------------
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           AAAGTACGGCAACTCGCGAGGCTCGGCGGCGCCTACAGCCACCGA---------------
Linepithema_humile|12923          TGTTGGAGA---------TTGCCACGAAATCTGCCAATCGCTGTG---------------
Pogonomyrmex_barbatus|8503        TGTTGGAGACTATCGCGTTTACCAGTGGCTACACCGAAATGTTAT---------------
Nasonia_vitripennis|16429         TTCACGGCGATCAAGTCGTTGACGCGGGCGGCTCCGGTG---------------------
Drosophila_persimilis|10001       GCCAGAGCTGCTGTCGCCGTTTTGGCGACCAAGCATGTTCTGCCC---------------
Drosophila_melanogaster|9698      GCCCGTGCCGCAGTCGCCGCTCTGTCGGCCAAACATGTGGTGCCC---------------
Drosophila_sechellia|15374        GCCCGTACCGCAGTCGCCGTTCTGTCGGCCAAACATGTGGTGCCC---------------
Drosophila_simulans|7898          GCCCGTGCCGCAGTCGCCGTTCTGTCGGCCAAACATGTGGTGCCC---------------
Bombyx_mori|4173                  AACGGCGTCGGACGAGCTATTTTAAACAGTACCAAAATA---------------------
Culex_quinquefasciatus|5100       TACTTTTTGTGTCGCAAACTATTCGGGATGGCCTCGATCCTGCGCTCGCTGGCCACGGTG
Daphnia_pulex|25769               ------------------------------------------------------------
                                                                                              

Bombyx_mori|1472                  ------------------------------------------------------------
Caenorhabditis_elegans|1745       AATCAACGTTATAAATTCGAAATGCCGTCCAAAGACATTGGATTCCTCATTGGCAAGAAC
Apis_mellifera|34131              ------------------------------------------------------------
Pediculus_humanus|9612            ------------------------------------------------------------
Echinops_telfairi|14665           ------------------------------------------------------------
Branchiostoma_floridae|18878      ------------------------------------------------------------
Choloepus_hoffmanni|1658          ------------------------------------------------------------
Dipodomys_ordii|10698             ------------------------------------------------------------
Ochotona_princeps|5383            ------------------------------------------------------------
Tursiops_truncatus|13883          ------------------------------------------------------------
Danio_rerio|29215                 ------------------------------------------------------------
Tetraodon_nigroviridis|14433      ------------------------------------------------------------
Gasterosteus_aculeatus|2706       ------------------------------------------------------------
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           ------------------------------------------------------------
Sorex_araneus|7405                ------------------------------------------------------------
Otolemur_garnettii|12074          ------------------------------------------------------------
Dasypus_novemcinctus|7086         ------------------------------------------------------------
Tupaia_belangeri|6420             ------------------------------------------------------------
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             ------------------------------------------------------------
Cavia_porcellus|21637             ------------------------------------------------------------
Vicugna_pacos|1330                ------------------------------------------------------------
Anolis_carolinensis|2777          ------------------------------------------------------------
Gallus_gallus|16773               ------------------------------------------------------------
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         ------------------------------------------------------------
Monodelphis_domestica|24637       ------------------------------------------------------------
Macropus_eugenii|12713            ------------------------------------------------------------
Ornithorhynchus_anatinus|16840    ------------------------------------------------------------
Microcebus_murinus|1163           ------------------------------------------------------------
Mus_musculus|22981                ------------------------------------------------------------
Rattus_norvegicus|22470           ------------------------------------------------------------
Callithrix_jacchus|41072          ------------------------------------------------------------
Procavia_capensis|9423            ------------------------------------------------------------
Rhesus_macaque|12579              ------------------------------------------------------------
Pongo_abelii|4686                 ------------------------------------------------------------
Homo_sapiens|17579                ------------------------------------------------------------
Pan_troglodytes|6811              ------------------------------------------------------------
Oryctolagus_cuniculus|1824        ------------------------------------------------------------
Loxodonta_africana|10391          ------------------------------------------------------------
Sus_scrofa|9854                   ------------------------------------------------------------
Bos_taurus|6586                   ------------------------------------------------------------
Pteropus_vampyrus|17693           ------------------------------------------------------------
Equus_caballus|5167               ------------------------------------------------------------
Felis_catus|42678                 ------------------------------------------------------------
Canis_familiaris|8459             ------------------------------------------------------------
Spermophilus_tridecemlineatus|623 ------------------------------------------------------------
Erinaceus_europaeus|8157          ------------------------------------------------------------
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           ------------------------------------------------------------
Linepithema_humile|12923          ------------------------------------------------------------
Pogonomyrmex_barbatus|8503        ------------------------------------------------------------
Nasonia_vitripennis|16429         ------------------------------------------------------------
Drosophila_persimilis|10001       ------------------------------------------------------------
Drosophila_melanogaster|9698      ------------------------------------------------------------
Drosophila_sechellia|15374        ------------------------------------------------------------
Drosophila_simulans|7898          ------------------------------------------------------------
Bombyx_mori|4173                  ------------------------------------------------------------
Culex_quinquefasciatus|5100       GCCCGCAGCGGCGTCCTCGCC---------------------------------------
Daphnia_pulex|25769               ------------------------------------------------------------
                                                                                              

Bombyx_mori|1472                  ------------------------------------------------------------
Caenorhabditis_elegans|1745       GGCGCCAAAATCAACGAAATTAAACTGAGTTCTAATGTTGATGTTCATTTCGAGCGAAAC
Apis_mellifera|34131              ------------------------------------------------------------
Pediculus_humanus|9612            ------------------------------------------------------------
Echinops_telfairi|14665           ------------------------------------------------------------
Branchiostoma_floridae|18878      ------------------------------------------------------------
Choloepus_hoffmanni|1658          ------------------------------------------------------------
Dipodomys_ordii|10698             ------------------------------------------------------------
Ochotona_princeps|5383            ------------------------------------------------------------
Tursiops_truncatus|13883          ------------------------------------------------------------
Danio_rerio|29215                 ------------------------------------------------------------
Tetraodon_nigroviridis|14433      ------------------------------------------------------------
Gasterosteus_aculeatus|2706       ------------------------------------------------------------
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           ------------------------------------------------------------
Sorex_araneus|7405                ------------------------------------------------------------
Otolemur_garnettii|12074          ------------------------------------------------------------
Dasypus_novemcinctus|7086         ------------------------------------------------------------
Tupaia_belangeri|6420             ------------------------------------------------------------
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             ------------------------------------------------------------
Cavia_porcellus|21637             ------------------------------------------------------------
Vicugna_pacos|1330                ------------------------------------------------------------
Anolis_carolinensis|2777          ------------------------------------------------------------
Gallus_gallus|16773               ------------------------------------------------------------
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         ------------------------------------------------------------
Monodelphis_domestica|24637       ------------------------------------------------------------
Macropus_eugenii|12713            ------------------------------------------------------------
Ornithorhynchus_anatinus|16840    ------------------------------------------------------------
Microcebus_murinus|1163           ------------------------------------------------------------
Mus_musculus|22981                ------------------------------------------------------------
Rattus_norvegicus|22470           ------------------------------------------------------------
Callithrix_jacchus|41072          ------------------------------------------------------------
Procavia_capensis|9423            ------------------------------------------------------------
Rhesus_macaque|12579              ------------------------------------------------------------
Pongo_abelii|4686                 ------------------------------------------------------------
Homo_sapiens|17579                ------------------------------------------------------------
Pan_troglodytes|6811              ------------------------------------------------------------
Oryctolagus_cuniculus|1824        ------------------------------------------------------------
Loxodonta_africana|10391          ------------------------------------------------------------
Sus_scrofa|9854                   ------------------------------------------------------------
Bos_taurus|6586                   ------------------------------------------------------------
Pteropus_vampyrus|17693           ------------------------------------------------------------
Equus_caballus|5167               ------------------------------------------------------------
Felis_catus|42678                 ------------------------------------------------------------
Canis_familiaris|8459             ------------------------------------------------------------
Spermophilus_tridecemlineatus|623 ------------------------------------------------------------
Erinaceus_europaeus|8157          ------------------------------------------------------------
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           ------------------------------------------------------------
Linepithema_humile|12923          ------------------------------------------------------------
Pogonomyrmex_barbatus|8503        ------------------------------------------------------------
Nasonia_vitripennis|16429         ------------------------------------------------------------
Drosophila_persimilis|10001       ------------------------------------------------------------
Drosophila_melanogaster|9698      ------------------------------------------------------------
Drosophila_sechellia|15374        ------------------------------------------------------------
Drosophila_simulans|7898          ------------------------------------------------------------
Bombyx_mori|4173                  ------------------------------------------------------------
Culex_quinquefasciatus|5100       ------------------------------------------------------------
Daphnia_pulex|25769               ------------------------------------------------------------
                                                                                              

Bombyx_mori|1472                  ------------------------------------------------CAAATTGGCAAT
Caenorhabditis_elegans|1745       AACGAGAATAGAGATAATGGAGAAACAGATGGAAGAGTTGTTGTATCAGTCACAGGAAAC
Apis_mellifera|34131              ------------------------------------------------------------
Pediculus_humanus|9612            ------------------------------------------------------------
Echinops_telfairi|14665           ------------------------------------------------GGGGCCCGGCGA
Branchiostoma_floridae|18878      ------------------------------------------------------------
Choloepus_hoffmanni|1658          ------------------------------------------------GGGGCCGGGCGA
Dipodomys_ordii|10698             ------------------------------------------------GGGGCTGGACGA
Ochotona_princeps|5383            ------------------------------------------------GGGACAGGGCGA
Tursiops_truncatus|13883          ------------------------------------------------GTGGCCTGGAGA
Danio_rerio|29215                 ------------------------------------------------------------
Tetraodon_nigroviridis|14433      ------------------------------------------------------------
Gasterosteus_aculeatus|2706       ------------------------------------------------------------
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           ------------------------------------------------------------
Sorex_araneus|7405                ------------------------------------------------GTGGCCCGGCGA
Otolemur_garnettii|12074          ------------------------------------------------GGAGTTGGGCGA
Dasypus_novemcinctus|7086         ------------------------------------------------GGGGCCGGGCGA
Tupaia_belangeri|6420             ------------------------------------------------GGGGCCGGGCGA
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             ------------------------------------------------GGGACTGGGCGA
Cavia_porcellus|21637             ------------------------------------------------GGGGCTGGGCGA
Vicugna_pacos|1330                ------------------------------------------------GNNNNNNNNNNN
Anolis_carolinensis|2777          ------------------------------------------------------------
Gallus_gallus|16773               ------------------------------------------------------------
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         ------------------------------------------------------------
Monodelphis_domestica|24637       ------------------------------------------------CAAGCTGCGTCT
Macropus_eugenii|12713            ------------------------------------------------------------
Ornithorhynchus_anatinus|16840    ------------------------------------------------GGCGGAGGCCTG
Microcebus_murinus|1163           ------------------------------------------------GGAGCTGGGCGA
Mus_musculus|22981                ------------------------------------------------GGGGCTGGGCGA
Rattus_norvegicus|22470           ------------------------------------------------GGGGCTGGGCGA
Callithrix_jacchus|41072          ------------------------------------------------GGGGCTGGGCGA
Procavia_capensis|9423            ------------------------------------------------GGAGCCAGGCCA
Rhesus_macaque|12579              ------------------------------------------------GGGGCTGGGCGA
Pongo_abelii|4686                 ------------------------------------------------GGGGCTGGGCGA
Homo_sapiens|17579                ------------------------------------------------GGGACTGGGCGA
Pan_troglodytes|6811              ------------------------------------------------GGGACTGGGCGA
Oryctolagus_cuniculus|1824        ------------------------------------------------GGGACCGGGCGA
Loxodonta_africana|10391          ------------------------------------------------GGAGCCGGGCGA
Sus_scrofa|9854                   ------------------------------------------------GTGTCCGGGCGA
Bos_taurus|6586                   ------------------------------------------------GTGGCCGGGAGA
Pteropus_vampyrus|17693           ------------------------------------------------GTGGCGAGGAGA
Equus_caballus|5167               ------------------------------------------------GCGGCCAGGCGA
Felis_catus|42678                 ------------------------------------------------GTGGCGGGGCGA
Canis_familiaris|8459             ------------------------------------------GTGCAAGTGGCCGGGCGA
Spermophilus_tridecemlineatus|623 ------------------------------------------------GGGGCTGGACGA
Erinaceus_europaeus|8157          ------------------------------------------------------------
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           ------------------------------------------------------------
Linepithema_humile|12923          ------------------------------------------------------------
Pogonomyrmex_barbatus|8503        ------------------------------------------------GCTGTCGCATCT
Nasonia_vitripennis|16429         ------------------------------------------------------------
Drosophila_persimilis|10001       ------------------------------------------------GCTGCTGGC---
Drosophila_melanogaster|9698      ------------------------------------------------GCTGCTGGA---
Drosophila_sechellia|15374        ------------------------------------------------GCTGCTGGA---
Drosophila_simulans|7898          ------------------------------------------------GCTGCTGGA---
Bombyx_mori|4173                  ------------------------------------------------------------
Culex_quinquefasciatus|5100       ------------------------------------------------GGAAATGGGTTG
Daphnia_pulex|25769               ------------------------------------------------------------
                                                                                              

Bombyx_mori|1472                  ------------------------------------------------------------
Caenorhabditis_elegans|1745       TATCAACAAATTCTCATCGGATTGCGCTTAATCTACGATAGATTAACTTCGAAAGGACAA
Apis_mellifera|34131              ------------------------------------------------------------
Pediculus_humanus|9612            ------------------------------------------------------------
Echinops_telfairi|14665           ------------------------------------------------------------
Branchiostoma_floridae|18878      ------------------------------------------------------------
Choloepus_hoffmanni|1658          ------------------------------------------------------------
Dipodomys_ordii|10698             ------------------------------------------------------------
Ochotona_princeps|5383            ------------------------------------------------------------
Tursiops_truncatus|13883          ------------------------------------------------------------
Danio_rerio|29215                 ------------------------------------------------------------
Tetraodon_nigroviridis|14433      ------------------------------------------------------------
Gasterosteus_aculeatus|2706       ------------------------------------------------------------
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           ------------------------------------------------------------
Sorex_araneus|7405                ------------------------------------------------------------
Otolemur_garnettii|12074          ------------------------------------------------------------
Dasypus_novemcinctus|7086         ------------------------------------------------------------
Tupaia_belangeri|6420             ------------------------------------------------------------
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             ------------------------------------------------------------
Cavia_porcellus|21637             ------------------------------------------------------------
Vicugna_pacos|1330                ------------------------------------------------------------
Anolis_carolinensis|2777          ------------------------------------------------------------
Gallus_gallus|16773               ------------------------------------------------------------
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         ------------------------------------------------------------
Monodelphis_domestica|24637       GTGGTTGTAGGG------------------------------------------------
Macropus_eugenii|12713            ------------------------------------------------------------
Ornithorhynchus_anatinus|16840    ------------------------------------------------------------
Microcebus_murinus|1163           ------------------------------------------------------------
Mus_musculus|22981                ------------------------------------------------------------
Rattus_norvegicus|22470           ------------------------------------------------------------
Callithrix_jacchus|41072          ------------------------------------------------------------
Procavia_capensis|9423            ------------------------------------------------------------
Rhesus_macaque|12579              ------------------------------------------------------------
Pongo_abelii|4686                 ------------------------------------------------------------
Homo_sapiens|17579                ------------------------------------------------------------
Pan_troglodytes|6811              ------------------------------------------------------------
Oryctolagus_cuniculus|1824        ------------------------------------------------------------
Loxodonta_africana|10391          ------------------------------------------------------------
Sus_scrofa|9854                   ------------------------------------------------------------
Bos_taurus|6586                   ------------------------------------------------------------
Pteropus_vampyrus|17693           ------------------------------------------------------------
Equus_caballus|5167               ------------------------------------------------------------
Felis_catus|42678                 ------------------------------------------------------------
Canis_familiaris|8459             ------------------------------------------------------------
Spermophilus_tridecemlineatus|623 ------------------------------------------------------------
Erinaceus_europaeus|8157          ------------------------------------------------------------
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           ------------------------------------------------------------
Linepithema_humile|12923          ------------------------------------------------------------
Pogonomyrmex_barbatus|8503        ------------------------------------------------------------
Nasonia_vitripennis|16429         ------------------------------------------------------------
Drosophila_persimilis|10001       ------------------------------------------------------------
Drosophila_melanogaster|9698      ------------------------------------------------------------
Drosophila_sechellia|15374        ------------------------------------------------------------
Drosophila_simulans|7898          ------------------------------------------------------------
Bombyx_mori|4173                  ------------------------------------------------------------
Culex_quinquefasciatus|5100       GCT---------------------------------------------------------
Daphnia_pulex|25769               ------------------------------------------------------------
                                                                                              

Bombyx_mori|1472                  ------------------------------------------------------------
Caenorhabditis_elegans|1745       AAAACTCTATATGAAGATCCTCGCACACGCCAATTCGCTGAATCTCTTATGAAAATGTTG
Apis_mellifera|34131              ------------------------------------------------------------
Pediculus_humanus|9612            ------------------------------------------------------------
Echinops_telfairi|14665           ------------------------------------------------------------
Branchiostoma_floridae|18878      ------------------------------------------------------------
Choloepus_hoffmanni|1658          ------------------------------------------------------------
Dipodomys_ordii|10698             ------------------------------------------------------------
Ochotona_princeps|5383            ------------------------------------------------------------
Tursiops_truncatus|13883          ------------------------------------------------------------
Danio_rerio|29215                 ------------------------------------------------------------
Tetraodon_nigroviridis|14433      ------------------------------------------------------------
Gasterosteus_aculeatus|2706       ------------------------------------------------------------
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           ------------------------------------------------------------
Sorex_araneus|7405                ------------------------------------------------------------
Otolemur_garnettii|12074          ------------------------------------------------------------
Dasypus_novemcinctus|7086         ------------------------------------------------------------
Tupaia_belangeri|6420             ------------------------------------------------------------
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             ------------------------------------------------------------
Cavia_porcellus|21637             ------------------------------------------------------------
Vicugna_pacos|1330                ------------------------------------------------------------
Anolis_carolinensis|2777          ------------------------------------------------------------
Gallus_gallus|16773               ------------------------------------------------------------
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         ------------------------------------------------------------
Monodelphis_domestica|24637       ------------------------------------------------------------
Macropus_eugenii|12713            ------------------------------------------------------------
Ornithorhynchus_anatinus|16840    ------------------------------------------------------------
Microcebus_murinus|1163           ------------------------------------------------------------
Mus_musculus|22981                ------------------------------------------------------------
Rattus_norvegicus|22470           ------------------------------------------------------------
Callithrix_jacchus|41072          ------------------------------------------------------------
Procavia_capensis|9423            ------------------------------------------------------------
Rhesus_macaque|12579              ------------------------------------------------------------
Pongo_abelii|4686                 ------------------------------------------------------------
Homo_sapiens|17579                ------------------------------------------------------------
Pan_troglodytes|6811              ------------------------------------------------------------
Oryctolagus_cuniculus|1824        ------------------------------------------------------------
Loxodonta_africana|10391          ------------------------------------------------------------
Sus_scrofa|9854                   ------------------------------------------------------------
Bos_taurus|6586                   ------------------------------------------------------------
Pteropus_vampyrus|17693           ------------------------------------------------------------
Equus_caballus|5167               ------------------------------------------------------------
Felis_catus|42678                 ------------------------------------------------------------
Canis_familiaris|8459             ------------------------------------------------------------
Spermophilus_tridecemlineatus|623 ------------------------------------------------------------
Erinaceus_europaeus|8157          ------------------------------------------------------------
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           ------------------------------------------------------------
Linepithema_humile|12923          ------------------------------------------------------------
Pogonomyrmex_barbatus|8503        ------------------------------------------------------------
Nasonia_vitripennis|16429         ------------------------------------------------------------
Drosophila_persimilis|10001       ------------------------------------------------------------
Drosophila_melanogaster|9698      ------------------------------------------------------------
Drosophila_sechellia|15374        ------------------------------------------------------------
Drosophila_simulans|7898          ------------------------------------------------------------
Bombyx_mori|4173                  ------------------------------------------------------------
Culex_quinquefasciatus|5100       ------------------------------------------------------------
Daphnia_pulex|25769               ------------------------------------------------------------
                                                                                              

Bombyx_mori|1472                  ------------CCGTTTTGTCTG------AAG---------------------------
Caenorhabditis_elegans|1745       GGTAGTGTGATCCGTCAGGCAGTT------TCCCGGCAAATTGTCCGAAATTCGCCAATT
Apis_mellifera|34131              ------------CCAAAATGTTATCCAAAACTTCTTCCTCTGACAAGAATGAATACT---
Pediculus_humanus|9612            ------------------------------ATTAAACCTTTTACGCAAAATAAAAAA---
Echinops_telfairi|14665           ------------CCCTCCGCACTG------TCGCTGCCT---GTGAGGACAGCGAGC---
Branchiostoma_floridae|18878      ------------------------------------------------------------
Choloepus_hoffmanni|1658          ------------CCCTCGGCGCTG------TTCCTACCG---GTGAGGAGGGAGAGC---
Dipodomys_ordii|10698             ------------CCCTCGGTGCTG------CTGCAGCGG---GTGAGGCGGGAGAGC---
Ochotona_princeps|5383            ------------CCTTCGGTGCGG------TTGCTGCCG---GTGAGGAAGCAGGGC---
Tursiops_truncatus|13883          ------------CCCTTGGTGCTG------TTGCTGCCG---GTGAGGAGGGAAAGC---
Danio_rerio|29215                 ------------CAGAGCGCTGCG------ATT---------GTCCAGACGAGATCA---
Tetraodon_nigroviridis|14433      ------------TCTTCGCGTGTC------CTGCAGCAGCACCAGAGACTGCAGAGT---
Gasterosteus_aculeatus|2706       ---------------------GTC------CTCCAGCAGCAGAAGAGGCTGCAGGGC---
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           ---------------------------------CTTCCACAAGTCCGACTGGAGGGC---
Sorex_araneus|7405                ------------CCCTCGGCGCTG------CTGCTGCCG---GTGCGGAAGGAGAGC---
Otolemur_garnettii|12074          ------------CCCTGGGCACTG------TTGGTGCCA---GTGAGGAGGGAGAGC---
Dasypus_novemcinctus|7086         ------------CCCTCCGCGCTG------TTGCTGCCG---GTGAGGAGGGAGAGC---
Tupaia_belangeri|6420             ------------CCCTCGGTGCTG------CTGCTGCCG---GTGAGGAAGGAGAGC---
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             ------------CCCTCGATACTC------TTGCTGCCC---GTGAGGAGGGAGAGC---
Cavia_porcellus|21637             ------------CCCTCGGCGTTG------TTGCAGTGG---GTGAGGACGGAGAGC---
Vicugna_pacos|1330                ------------NNNNNNNNNNNN------NNNNNNNNN---NNNNNNNNNNNNNNN---
Anolis_carolinensis|2777          ------------------------------------------------------------
Gallus_gallus|16773               ------------------------------------------------------------
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         ------------------------------------------------------------
Monodelphis_domestica|24637       ------------GCGGCATGCGCTGGGGTCCTGCTACCG---GTGAGAAAGGAGAGC---
Macropus_eugenii|12713            ------------------------------------------------------------
Ornithorhynchus_anatinus|16840    ------------CCGAGTGCCGTG------CTGCTCTCC---ACCCGGGGGAGGACC---
Microcebus_murinus|1163           ------------CCCTGGGTGCTG---------TTGCCG---GTGAGGAGGGAGAGC---
Mus_musculus|22981                ------------CCCTCCGTGCTG------TGGCAGCAC---GTAAGAAGGGAGAGC---
Rattus_norvegicus|22470           ------------CCCTCAGTGCTG------TTGCAGCAGCGTGTGAGAAGGGAGAGC---
Callithrix_jacchus|41072          ------------CCCTTGGTTCTG---------CTGCCG---GTGAGGCGTGAGAGT---
Procavia_capensis|9423            ------------CCCTCGGCGCTG---------TTGCCT---GTGAGGAGGGAGAGC---
Rhesus_macaque|12579              ------------CCCTCAGTTCTG------TTGCTGCCG---GTGAGGCGGGAGAGC---
Pongo_abelii|4686                 ------------CCCTCGGTTCTG------TTGCTGCCG---GTGAGGCGGGAGAGC---
Homo_sapiens|17579                ------------CCCTCCGTTCTG------TTGCTGCCG---GTGAGGCGGGAGAGC---
Pan_troglodytes|6811              ------------CCCTCCGTTCTG------TTGCTGCCG---GTGAGGCGGGAGAGC---
Oryctolagus_cuniculus|1824        ------------CCCTCGGTGCTG------TTGCTGCCG---GTGAGGAAGGAGAGC---
Loxodonta_africana|10391          ------------CCCTCGGCGTTA------TTGCTGCCC---GTGAGAAGGGAGAGC---
Sus_scrofa|9854                   ------------CCCTCGGTGCTT------TTGCTGCCT---GTGAGGAAGGAAAGC---
Bos_taurus|6586                   ------------CCCTCGGTGCTG------TTGCTGCCC---GTGAGGCGGGAAAGC---
Pteropus_vampyrus|17693           ------------CCCTCGGTGTTG------TTGCTGCCG---ATGAGGAGGGAAAGC---
Equus_caballus|5167               ------------CCCTCGGTGCTG------TTGCTGCCA---GTGAGGACGGAAAGC---
Felis_catus|42678                 ------------CCCTCGGTGCTG------TTGCTGCCG---GTGAGGAGGGAAAGC---
Canis_familiaris|8459             ------------CCCTCGGTGCTG------CTGCTGCCG---GCGAGGAGGGAAAGC---
Spermophilus_tridecemlineatus|623 ------------CCGTCGGTGCTG------CTGCAGCGG---GTGAGGAGAGAGAGC---
Erinaceus_europaeus|8157          ------------------------------------------------------------
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           ------------GCCCCGTCCCTG------ACGCAGAGCTTCGCCCGCCGTGAAAGC---
Linepithema_humile|12923          ------------CCGAAAAGTTATGCT---GTCGCTTCATCAGTACGATGTAACACC---
Pogonomyrmex_barbatus|8503        ------------CTATCATCTGTAAGGTATAATACCACAACTACTAGTGACAAAAGC---
Nasonia_vitripennis|16429         ------------CCTCAGCGTTATATTTCTGCTTGTTCTGCATTGAGAAATTCATCT---
Drosophila_persimilis|10001       ------------ACAGCTGCTCTT------CGTTTCGCCAGCACGGCGCCCGTTGAC---
Drosophila_melanogaster|9698      ------------TCCACTGCTCTT------CGGATGGCCAGTACAACGCCAGTGGAG---
Drosophila_sechellia|15374        ------------TCCGCTGCTCTT------CGGATGGCCAGCACAACTCCAGTGGAG---
Drosophila_simulans|7898          ------------TCCGCTGCTCTT------CGGATGGCCAGCACAACTCCAGTGGAG---
Bombyx_mori|4173                  ------------CCTGGTGTCCAG------CGCGTAGCGACAAAATCTACCGAAAAA---
Culex_quinquefasciatus|5100       ------------CGTTCCGCCACG------GTCCCGGCGCTGATCCGCTGCAAGTCG---
Daphnia_pulex|25769               ------------------------------------------------------------
                                                                                              

Bombyx_mori|1472                  ---------------------------------------------CCCGTTGAATGCGAG
Caenorhabditis_elegans|1745       TCCACCACCGCTGCTGTTGCCCAGACCAACCAGACTGGCGATAAGAAAGAATCTCCAAAA
Apis_mellifera|34131              ------------------------------------ACAGAAACTGAAAAAACAGAAACG
Pediculus_humanus|9612            ---------------------------------------------ATATTTTCCGATGTA
Echinops_telfairi|14665           ---------------------------------------------GGCCAGGCCGACACG
Branchiostoma_floridae|18878      ------------------------------------------------------------
Choloepus_hoffmanni|1658          ---------------------------------------------GCCGCGGCCCACATG
Dipodomys_ordii|10698             ---------------------------------------------GCCGCGGCCGACGCG
Ochotona_princeps|5383            ---------------------------------------------GCCGCGGCCGACACG
Tursiops_truncatus|13883          ---------------------------------------------GCCGCGGCAGACACG
Danio_rerio|29215                 ---------------------------------------------ACAACAACTGAGAGC
Tetraodon_nigroviridis|14433      ---------------------------------------------TCTGCAGCTGACAAT
Gasterosteus_aculeatus|2706       ---------------------------------------------TCCATCACCGAAACC
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           ---------------------------------------------ACGACCACAGAGACA
Sorex_araneus|7405                ---------------------------------------------GCCGCGGCCGACTCG
Otolemur_garnettii|12074          ---------------------------------------------GCCGCGGCCGAAACG
Dasypus_novemcinctus|7086         ---------------------------------------------GCCGCGGCCGACACG
Tupaia_belangeri|6420             ---------------------------------------------GCCGCGGCCGACACG
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             ---------------------------------------------GCCGCGGCCAACGCG
Cavia_porcellus|21637             ---------------------------------------------GCCGCGGCCGACTCG
Vicugna_pacos|1330                ---------------------------------------------NNNNNNNNNNNNNNN
Anolis_carolinensis|2777          ------------------------------------------------------------
Gallus_gallus|16773               ---------------------------------------------TCGGCCACGGAGACG
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         ------------------------------------------------------------
Monodelphis_domestica|24637       ---------------------------------------AGCCCGGCGGCCGGAAGCCAG
Macropus_eugenii|12713            ------------------------------------------------------------
Ornithorhynchus_anatinus|16840    ---------------------------------------------TCTGCGGCCGACAAG
Microcebus_murinus|1163           ---------------------------------------------GCCGCGGCCGACACG
Mus_musculus|22981                ---------------------------------------------GCGGCGGCTGACAAG
Rattus_norvegicus|22470           ---------------------------------------------GCGGCGGCTGACAAG
Callithrix_jacchus|41072          ---------------------------------------------GCCGGGGCCGACACG
Procavia_capensis|9423            ---------------------------------------------GCCACGGCAGACACG
Rhesus_macaque|12579              ---------------------------------------------GCCGGGGCCGACACG
Pongo_abelii|4686                 ---------------------------------------------GCAGGGGCCGACACG
Homo_sapiens|17579                ---------------------------------------------GCCGGGGCCGACACG
Pan_troglodytes|6811              ---------------------------------------------GCCGGGGCCGACACG
Oryctolagus_cuniculus|1824        ---------------------------------------------GCCGCGGCCGACACG
Loxodonta_africana|10391          ---------------------------------------------GCCGCGGCCGACACG
Sus_scrofa|9854                   ---------------------------------------------GCTGCGGCCGACACG
Bos_taurus|6586                   ---------------------------------------------TCTGCGGCCGACACG
Pteropus_vampyrus|17693           ---------------------------------------------ACTGCGGCCGACACG
Equus_caballus|5167               ---------------------------------------------GCTGCAGCTGACACG
Felis_catus|42678                 ---------------------------------------------GTCGCGGCAGACACG
Canis_familiaris|8459             ---------------------------------------------GCCGCGGCCGACACG
Spermophilus_tridecemlineatus|623 ---------------------------------------------GCCTCGGCCGACACG
Erinaceus_europaeus|8157          ------------------------------------------------------------
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           ------------------------------ACCCAAGCGACCCCGACGGCCGAGGAAACT
Linepithema_humile|12923          ------------------------ACCACAGTCAACGAGGAAACTGAAAAAACCGAGACT
Pogonomyrmex_barbatus|8503        ---------------------------------------------GAAAAAATCGAAACT
Nasonia_vitripennis|16429         ------------------------------GGAAAGTCTACTGAAGCTCCTAAGGATACT
Drosophila_persimilis|10001       ---------------------------------------------GCCAAAAAACCAGAG
Drosophila_melanogaster|9698      ---------------------------------------------CCTAAGAAGGCGGAT
Drosophila_sechellia|15374        ---------------------------------------------CCCAAGAAGGCGGAT
Drosophila_simulans|7898          ---------------------------------------------CCCAAGAAGGCGGAT
Bombyx_mori|4173                  ------------------------------------------ACCCCAGTACAAGAGACA
Culex_quinquefasciatus|5100       ------------------------------------------GAGGCGGCTGCGGAATCC
Daphnia_pulex|25769               ------------------------------------------------------------
                                                                                              

Bombyx_mori|1472                  AATCATACGCTCAGGAAACACGACAATTTGAGACGTCAACGACTTTACGAGTTCGGCCTG
Caenorhabditis_elegans|1745       AAACCAACTATCTGGAAAATCGACGAACACAAACGTGAACGGTTGGCTAATTTTGGAAAG
Apis_mellifera|34131              CGACCAACAATACGTAAAATT---CAAACTGATTTGGAAACTATAAAAGATTTGGGTTTA
Pediculus_humanus|9612            CGAAAATATTGTCAGAAGGTTACCGAA------AATGGTAAAACAACACATTTTGGAAAA
Echinops_telfairi|14665           CGCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Branchiostoma_floridae|18878      ------ACCATACGGCCCCAGGATGAAGTGATGAGAAACCAGCTGACAGTGTTTGGGGAG
Choloepus_hoffmanni|1658          CACCCCACTGTCAGATCACGGAATGATGTGGCCCACAAGCAGCTCTCAGCTTTTGGAGAA
Dipodomys_ordii|10698             CGCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|5383            CGCCCCACTGTCAGACCCCGGAATGATGTGGCTCACAAGCAGCTGTCAGCTTTTGGGGAG
Tursiops_truncatus|13883          CGCCCCACTGTCAGACCACAGAATGATGTGGCCCACAAGCAGCTCTCAGCTTTTGGAGAG
Danio_rerio|29215                 AGGCCTACTGTAAGGCCCAAGGATCCAGTCACCCACTCCCAGCTTTCAGAGTTTGGAGAA
Tetraodon_nigroviridis|14433      CAGCCCACCGTCAGGCCCAAAGATGCTGTGGCTCATAACCAGCTGGCAGCTTTTGGCGAA
Gasterosteus_aculeatus|2706       AGACCCACCGTCAGGCCCAAGGATGCCGTCACTCACAGCCAGCTGGCAGCGTTTGGGGAG
Oryzias_latipes|24786             ------------------------------------------------------------
Xenopus_tropicalis|4093           AGACCTACGGTGAGGCCACAAGATAAAGTGCAGTTGAACCAACTTTCAGCCTTTGGCGAG
Sorex_araneus|7405                CGCCCCACCGTCAGACCACGGGATGATGTCACCAACAAGCAGCTCTCAGCTTTT---GAA
Otolemur_garnettii|12074          CGCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dasypus_novemcinctus|7086         CGCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|6420             CGCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             CGCCCCACTGTCAGACCACAGAATGATATGGCCCATAAGCAGCTCTCAGCCTTCGGAGAG
Cavia_porcellus|21637             CGCCCCACTGTTAGGCCGAAAGATGCGGTGACCCATAAGCAGCTCTCAGCTTTTGGCGAG
Vicugna_pacos|1330                NNNNCCACTGTCAGACCACGGAATGATGTGGTCCACAAGCAGCTCTCAGCTTTTGGAGAG
Anolis_carolinensis|2777          ------ACTGTTAGGCCAAAGGATGAAGTAACTCTAAAACAGCTGTCTGCCTTTGGAGAA
Gallus_gallus|16773               CGCCCTACTGTCAGACCGAAAAATGAAGTAGAACAGAAGCAGCTCTGTGCGTTTGGGGAG
Taeniopygia_guttata|12022         ------ACTGTCAGACCAAAAAATGAAGTAGAACAGAAGCAGCTATGTGCTTTTGGGGAG
Taeniopygia_guttata|12021         ------ACTGTCAGACCAAAAAATGAAGTAGAACAGAAGCAGCTATGTGCTTTTGGGGAG
Monodelphis_domestica|24637       CACCCCACAGTTAGACAATGGGATGAGGTGACCCATAAGCAGCTCTCTGCTTTTGGAGAA
Macropus_eugenii|12713            ------ACAGTTAAACAGTGGGATGAAGTGACCCATAAGCAACTTTCTGCTTTTGGAGAA
Ornithorhynchus_anatinus|16840    AGGCCTACCGTCCGATCCCAGGATAACGTAGTCCACAAGCAGCTCTCTGCTTTCGGCGAG
Microcebus_murinus|1163           CGCCCCACTGTCAGACCACAGAATGATGTGGCCCGCAAACAACTCTCAGCTTTTGGAGAA
Mus_musculus|22981                CGCCCCACTGTCAGACCCCGGAGTGATGTGACCCACAAGCAGCTCTCAGCATTTGGAGAG
Rattus_norvegicus|22470           CGCCCCACTGTCAGACCCTCGAGTGATGTAACCCACAAGCGGCTCTCAGCATTTGGAGAG
Callithrix_jacchus|41072          CGCCCCACTGTCAGACCACGGAATGATGCGGCCCACAAGCAGCTCTCAGCTTTTGGAGAG
Procavia_capensis|9423            CGCCCCACTGTCAGACCACGGAATGATGTGGCCCACAAGGAGCTCTCAGCTTTTGGAGAG
Rhesus_macaque|12579              CGCCCCACTGTCAGACCACGGAATGATGTGGCCCACAAGCAGCTCTCAGCTTTTGGAGAG
Pongo_abelii|4686                 CGCCCCACTGTCAGACCACGGAATGATGTGGCCCACCAGCAGCTCTCAGCTTTTGGAGAG
Homo_sapiens|17579                CGCCCCACTGTCAGACCACGGAATGATGTGGCCCACAAGCAGCTCTCAGCTTTTGGAGAG
Pan_troglodytes|6811              CGCCCCACTGTCAGACCACGGAATGATGTGGCCCACAAGCAGCTCTCAGCTTTTGGAGAG
Oryctolagus_cuniculus|1824        CGCCCCACTGTCAGACCACGGAATGACGTGGCCCACAAGCAACTCTCAGCTTTCGGGGAA
Loxodonta_africana|10391          CGCCCCACTGTCAGACCACGGAATGATGTGGCCCACAAGCAGCTCTCAGCTTTTGGAGAG
Sus_scrofa|9854                   CGCCCCACTATCAGACCACGGAATGATGTGGTCCACAAGCAGCTCTCAGCTTTTGGACAG
Bos_taurus|6586                   CGCCCCACTGTCAGACCACGGAATGCTGTGGCCCACAAGCAGCTCTCAGCTTTTGGAGAG
Pteropus_vampyrus|17693           CGCCCCACTGTCAGACCACGGAATGATGTGGCCCACAAACAGCTCTCAGCTTTTGGAGAG
Equus_caballus|5167               CGCCCCACTGTCAGACCGCGGAATGACGTGGCCCACAAGCAGCTCTCGGCTTTTGGAGAG
Felis_catus|42678                 CGCCCCACTGTCCGACCACGGAATGATGTGGCCCACAAGCAGCTCTCAGCTTTTGGAGAG
Canis_familiaris|8459             CGCCCCACTGTCAGACCACGGAATGATGTGGCCCACAAGCAGCTTTCAGCTTTTGGAGAG
Spermophilus_tridecemlineatus|623 CGCCCCACAGTCAGACCACAGAACGATGTGGTCCACAAACAGCTCTCAGCTTTTGGAGAG
Erinaceus_europaeus|8157          ------ACTGTCAGACTACGGGATGATGTAACCCACAAGCAACTCTCAGCTTTTGGAGAG
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           CGACCGGCGGTACGCAAACCTCAAGTCGTCCAGCGCCAGAAGCTCGAAGACTTCGGTCGC
Linepithema_humile|12923          CGTCCTACGGTACGTAAGCCCAGTCATGTTGATGTGAAGCGTTTGAGAAATTTCGGTTCC
Pogonomyrmex_barbatus|8503        CGTCCCACAATACGGAAACCCAGTCATGTTGACATCGATCATTTGATACAGTTCGGTCGT
Nasonia_vitripennis|16429         AGACCAACTGTCCGCAAGATTGACCAGGAAAAAGTAGCCCAATTAAAAGATTTTGGACAA
Drosophila_persimilis|10001       AAACCCACTGTGCGAAAGCCGGATGCAGCCGGTCGCACCAGTCTCTCCGATTTCGGACGC
Drosophila_melanogaster|9698      AAGCCCACTGTCCGCCAGCCGGACGCAGTCGCTCGCTCGCATCTCTCCGATTTCGGGCGC
Drosophila_sechellia|15374        AAGCCCACTGTCCGCCAGCCGGACGCAGTCGCTCGCTCGCACCTCTCCGATTTCGGGCGC
Drosophila_simulans|7898          AAGCCCACTGTCCGCCAGCCGGACGCAGTCGCTCGCTCGCACCTCTCCGATTTCGGGCGC
Bombyx_mori|4173                  CGACCAACTGTAGCCAAATTAGATCCACTGCAAAAGGCGCAGCTCGTCGACTTCGGCAAA
Culex_quinquefasciatus|5100       AGACCAACTGTCCGCAAGCCGGATGCTGCCGCTCGTGCCGATTTGTCCGACTTTGGAAAG
Daphnia_pulex|25769               ---------------------------------------------ATGGACTTTGGTTTA
                                                                                              

Bombyx_mori|1472                  TACGTTGCCGCTTGTTTACCGAAATACGTCCAGAAGGTGCAGATGCAATTCAACGATCAA
Caenorhabditis_elegans|1745       TATGCAGCCGAGTGCCTGCCAAAGTTTGTGCAAAAAGTGCAATTTGCAGCCGGAGACGAG
Apis_mellifera|34131              TATATTGCTGCATGTTTACCAAAGTATGTGCAAAAAACTCAGATTGTTGCTGGTGATGAA
Pediculus_humanus|9612            TATGTAAGTGAATGTTTACCCAAATATGTTCAAATGATTCAAATGACATCTCAAGGAGAA
Echinops_telfairi|14665           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Branchiostoma_floridae|18878      TATGTGGCCGAATGTCTCCCCAAGTACGTGCAGACAGTCCAGGTTACCAGCCAAAATGAA
Choloepus_hoffmanni|1658          TATGTGGCTGAAATCTTGCCCAAGTATGTCCAACAAGTTCAGGTATCCTGCTTCAATGAA
Dipodomys_ordii|10698             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTGACCTGCTTCAATGAG
Ochotona_princeps|5383            TATGTGGCTGAAATCCTGCCCAAATACGTCCAGCATGTTCAGGTGTCCTGCTTCAATGAG
Tursiops_truncatus|13883          TATGTGGCTGAAATCCTGCCCAAGTATGTCCAACAAGTTCAGGTGTCCTGCTTCAATGAG
Danio_rerio|29215                 TACGTCGCAGAGATTCTCCCCAAATATGTGCAGCAAGTTCAGGTGACCTGCTTTAATGAG
Tetraodon_nigroviridis|14433      TACGTGTCTGAAATGATGCCAAAATACGTCCAGCAGGTCCAGGTGACCTGCTACAACGAG
Gasterosteus_aculeatus|2706       TACGTGGCTGAGATGATGCCCAAATACGTCCAGCAGGTCCAGGTGACCTGTTACAACGAG
Oryzias_latipes|24786             ------------ATGATGCCCAAGTACGTCCAGCAGGTTCAGGTGACCTGCTTCAATGAG
Xenopus_tropicalis|4093           TATGTAGCGGAGATCCTCCCCAAGTATGTGCAGCAAGTTCAGGTGACCTGTAATGGAGAG
Sorex_araneus|7405                TACGTGGCCGAAATCCTGCCC---TATGTCCAGCATGTNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|12074          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTATCTTGCTTCAATGAG
Dasypus_novemcinctus|7086         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTGTCCTGCTTCAATGAA
Tupaia_belangeri|6420             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTGTCCTGCTTCAATGAG
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             TATGTGGCTGAAATCCTGCCCAAGTATGTCCAACAAGTTCAGGTGTCCTGCTTCAATGAG
Cavia_porcellus|21637             TATGTGGCTGAAATCCTGCCCAAGTATGTCCAGCAAGTTCAGGTGACTTGCTTCAATGAG
Vicugna_pacos|1330                TATGTGGCTGAAATCCTGNNNNNNNNNNNNNNNNNNNNNNNNGTG---TGCTTCAATGAG
Anolis_carolinensis|2777          TATGTGGCTGAAATTCTGCCCAAGTATGTTCAACAAGTGCAGGTGACATGTTTCAATGAG
Gallus_gallus|16773               TATGTGGCTGAGATCCTGCCCAAGTATATCCAGCAAGTACAGGTGACCTGTTTCAATGAG
Taeniopygia_guttata|12022         TACGTGGCTGAGATTCTACCCAAGTATATCCAGCAAGTACAGGTGACCTGTTTCAATGAG
Taeniopygia_guttata|12021         TACGTGGCTGAGATTCTGCCCAAGTATATCCAGCAAGTACAGGTGACCTGTTTCAATGAG
Monodelphis_domestica|24637       TATGTGGCTGAGATCCTACCCAAATATGTCCAGCAAGTTCAGGTATCTTACTTCAATGAA
Macropus_eugenii|12713            TATGTGGCTGAGATCCTGCCCAAATACGTCCAGCAAGTTCAGGTGTCATGCTTCAACGAA
Ornithorhynchus_anatinus|16840    TACGTCGCCGAGATTCTCCCAAAATACGTCCAGCAAGTTCAGGTATCTTGCTTCAATGAG
Microcebus_murinus|1163           TATGTGGCTGAAATCCTGCCCAAGTATGTCCAACAAGTTCAGGTGTGCTTCTTCAATGAG
Mus_musculus|22981                TATGTGGCTGAAATCTTACCCAAGTATGTCCAACAAGTTCAGGTGTCCTGCCTTGATGAG
Rattus_norvegicus|22470           TATGTGGCTGAAATCTTACCTAAGTATGTCCAACAAGTTCAGGTGACCTGCTTTGATGAG
Callithrix_jacchus|41072          TATGTGGCTGAAATCCTGCCCAAGTATGTCCAGCAAGTTCAGGTGTCCTTATTCGATGAA
Procavia_capensis|9423            TATGTGGCTGAAATCCTGCCCAAGTATGTCCAACAAGTTCAGGTGTCTTGCTTCAATGAA
Rhesus_macaque|12579              TATGTGGCTGAAATCTTGCCCAAGTATGTCCAACAAGTTCAGGTGTCCTGCTTCAATGAG
Pongo_abelii|4686                 TATGTGGCTGAAATCTTGCCCAAGTATGTCCAACAAGTTCAGGTGTCCTGCTTCAATGAG
Homo_sapiens|17579                TATGTGGCTGAAATCTTGCCCAAGTATGTCCAACAAGTTCAGGTGTCCTGCTTCAATGAG
Pan_troglodytes|6811              TATGTGGCTGAAATCTTGCCCAAGTATGTCCAACAAGTTCAGGTGTCCTGCTTCAATGAG
Oryctolagus_cuniculus|1824        TATGTGGCTGAAATCCTGCCCAAGTATGTCCAGCACGTTCAGGTGTCCTGCTTCGATGAG
Loxodonta_africana|10391          TATGTAGCTGAAATCCTGCCCAAGTATGTCCAACAAGTTCAGGTGTCCTGCTTCAATGAA
Sus_scrofa|9854                   TATGTGGCCGAAATCCTGCCCAAGTATGTCCAGCAAGTTCAGGTGTCCTGCTTCAATGAG
Bos_taurus|6586                   TATGTGGCTGAAATCCTGCCCAAATATGTCCAGCAAGTTCAGGTGTCTTGCTTCAATGAG
Pteropus_vampyrus|17693           TATGTGGCTGAAATCCTGCCCAAGTATGTCCAACAAGTTCAGGTGTCCTGCTTCAATGAG
Equus_caballus|5167               TATGTGGCTGAAATCCTGCCCAAGTATGTCCAACAAGTTCAGGTGTCCTGCTTCAATGAG
Felis_catus|42678                 TATGTGGCTGAAATCCTGCCCAAGTATGTCCAACAAGTTCAGGTGTCTTGCTTCAATGAG
Canis_familiaris|8459             TATGTGGCTGAAATCCTGCCCAAGTATGTCCAACAAGTTCAGGTGTCTTGCTTCAATGAG
Spermophilus_tridecemlineatus|623 TATGTAGCTGAAATCCTGCCCAAGTATGTCCAACAAGTTCAGGTGACCTGCTTCAATGAG
Erinaceus_europaeus|8157          TATGTGGCTGAAATCCTGCCCAAATATGTCCAACAAGTTCAGGTGACATGCTTCAGTGAG
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           TACGTGGCGGAATGCCTCCCGAAATACGTGCAGAAGGTCCAGATCACCCAAGGCGACGAG
Linepithema_humile|12923          TATATTGAGGATTGTCTACCAAAGTACATACAACAAGTACAGCTGACTGCTGGTGATGAG
Pogonomyrmex_barbatus|8503        TACATTAATGAGTGTCTACCCAAATATATACAACAAGTGCAGCTGGCTGCTTGCGATGAG
Nasonia_vitripennis|16429         TATGTAGCTGAATGTCTGCCAAAATACGTTCAAAAAGTTCAAATTGAAGCGGGTGATGAG
Drosophila_persimilis|10001       TACGTTGCCGAGTGCTTGCCCAAGTACGTGCAGAAGGTTCAGCTGACCGCCGGCGATGAG
Drosophila_melanogaster|9698      TATGTGGCCGAGTGCCTGCCCAAGTACGTGCAGAAGGTGCAGCTGACCGCCGGCGATGAG
Drosophila_sechellia|15374        TATGTGGCCGAGTGCTTGCCCAAGTACGTGCAGAAGGTGCAGCTGACCGCCGGCGATGAG
Drosophila_simulans|7898          TATGTGGCCGAGTGCTTGCCTAAGTACGTGCAGAAGGTGCAGCTGACCGCCGGCGATGAG
Bombyx_mori|4173                  TATGTAGCTGACTGTCTACCCAAGTATGTGCAGAAAGTACAGCTGACTGCCGGCAACGAA
Culex_quinquefasciatus|5100       TACGTCGCCGAGTGTATGCCCAAGTACGTCCAGAAGGTGCAGCTCACTTCGGGCGATGAG
Daphnia_pulex|25769               TATGTGGCAGAGTGTATGCCAAAGTATGTGCAGAAAGTGCAGATTGTAACGGGAAATGAA
                                                                                              

Bombyx_mori|1472                  CTTGAAATACTCATTGTGCCCGATGGCTTGTTCCAAGTGCTGAGTTTCTTGCGCAATCAC
Caenorhabditis_elegans|1745       TTAGAGCTCTTGATTCATCCATCAGGAGTTGTTCCAGTTCTTTCCTTCCTTAAAGGAAAT
Apis_mellifera|34131              CTTGAAATATTAGTATGTCCAGAGGGGATTATTCCAACATTAAAGTTTTTAAAATTACAT
Pediculus_humanus|9612            TTAGAGATTTTGATAGCTCCAGAGGGAGTTTTACCTGTGATGCAATTTCTTAAAGATCAC
Echinops_telfairi|14665           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Branchiostoma_floridae|18878      CTCGAGGTGTTGATCTCACCAGAGGGAGTGGTTCCTGTCCTGTCCTTCCTGAAGGACCAC
Choloepus_hoffmanni|1658          CTAGAGATCTGTATCCATCCTGATGGTGTCATCCCAGTGTTGACTTTCCTCAGGGATCAT
Dipodomys_ordii|10698             TTGGAGATCTGTATCCATCCTGATGGAATCATCCCAGTGTTGACTTTCCTCAGGGATCAC
Ochotona_princeps|5383            TTAGAGATCTGCATTCATCCCGACGGTGTCATCCCAGTGCTGACCTTCCTCAGGGACCAC
Tursiops_truncatus|13883          TTAGAGATCTGTATCCATCCTGATGGAGTCATCCCAGTGCTNNNNNNNNNNNNNNNNNNN
Danio_rerio|29215                 CTGGAGATCATGGTCCACCCAGAAGGTATTATTCCTGTTCTCACCTTCTTGAAGGATCAC
Tetraodon_nigroviridis|14433      CTGGAAGTGATGATCCATCCTGATGGCGTCATACCTGTTCTGACCTTCCTGAGGGACCAC
Gasterosteus_aculeatus|2706       CTGGAGATGATGATCCACCCCGACGGGGTGATCCCCGTGCTCACCTTCCTGAGGGACCAC
Oryzias_latipes|24786             TTGGAAGTCATGATCCATCCTGACGGCGTGATCCCAGTGCTGACCTTCCTGAGGGACCAC
Xenopus_tropicalis|4093           CTGGAAGTCATGGTTCACCCAGATGGGGTTATACCAGTCCTCACGTTTCTTCGCGACCAC
Sorex_araneus|7405                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGTGCTGACATTCCTCAGGGACCAC
Otolemur_garnettii|12074          TTAGAGATCTGCATCCATCCTGATGGAGTCATCCCAGTGCTGACTTTCCTTAGAGATCAC
Dasypus_novemcinctus|7086         CTAGAGATCTGTATTCATCCTGATGGAGTCATCCCAGTGCTGACTTTCCTCAGGGATCAC
Tupaia_belangeri|6420             CTAGAGATCTGCATCCATCCTGACGGAGTCATCCCCGTGCTGACTTTCCTCAGGGATCAC
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             TTAGAGATCTGTATCCATCCTGATGGAGTCATTCCAGTGCTGACTTTCCTCAAGGATCAC
Cavia_porcellus|21637             CTAGAGGTCTGTATCCATCCTGACGGCGTCATCCCGGTGCTCACCTTCCTCAAGGATCAC
Vicugna_pacos|1330                ---GAGATCTGTATCCAT---GATGGAGTCATCCCAGTGCTGACT---CTCAGGGATCAC
Anolis_carolinensis|2777          TTGGAAATCTTAATTCACCCAGATGGAGTCATTCCAGTTCTAACCTTTCTAAAAGATCAC
Gallus_gallus|16773               TTGGAGCTTTTGATCCATCCAGATGGGATTATTCCAGTTCTGACCTTCCTCCGAGATCAC
Taeniopygia_guttata|12022         CTGGAACTTCTGATCCATCCAGATGGGATCATTCCTGTCCTGACCTTCCTTCGTGATCAC
Taeniopygia_guttata|12021         CTGGAACTTCTGATCCATCCAGATGGGATCATTCCTGTCCTGACCTTCCTTCGTGATCAC
Monodelphis_domestica|24637       CTAGAGATCTGTATCCATCCTGATGGAGTCATCCCTGTACTGACATTCCTCAGAGATCAC
Macropus_eugenii|12713            CTAGAGATCTGTATCCATCCCGACGGAGTCATCCCTGTGCTGACGTTCCTCAAAGATCAC
Ornithorhynchus_anatinus|16840    TTGGAAATCTGTATCCATCCCGATGGAGTGATCCCCGTGCTGACCTTCCTTAAGGACCAT
Microcebus_murinus|1163           TTAGAGGTCTGCATTCATCCTGATGGAGTTATCCCAGTGCTGACTTTCCTCAGGGATCAC
Mus_musculus|22981                TTAGAAATCTGTATCCATCCCGATGGAGTCATCCCAACGCTGACTTTTCTCAGGGATCAC
Rattus_norvegicus|22470           TTAGAAATCTGCATCCATCCTGATGGAGTCATCCCAACGATAACCTTTCTCAAGGATCAT
Callithrix_jacchus|41072          TTAGAGATCTGTATCCATCCTGATGGCATCATCCCAGTGCTGACTTTCCTCAAGGATCAC
Procavia_capensis|9423            CTAGAGATCTGTATCCATCCTGATGGAGTCATCCCAGTACTAACTTTCCTCAGGGATCAC
Rhesus_macaque|12579              TTAGAGGTCTGTATCCATCCTGATGGCATCATCCCAGTGCTGACTTTCCTCAGGGATCAC
Pongo_abelii|4686                 TTAGAGGTCTGTATCCATCCTGATGGCGTCATTCCAGTGCTGACTTTCCTCAGGGATCAC
Homo_sapiens|17579                TTAGAGGTCTGTATCCATCCTGATGGCGTCATCCCAGTGCTGACTTTCCTCAGGGATCAC
Pan_troglodytes|6811              TTAGAGGTCTGTATCCATCCTGATGGCGTCATCCCAGTGCTGACTTTCCTCAGGGATCAC
Oryctolagus_cuniculus|1824        TTGGAGATCTGTATTCATCCTGATGGCGTCATCCCAGTGCTGACCTTCCTCAGGGATCAC
Loxodonta_africana|10391          TTAGAGATCTGTATCCATCCTGATGGAGTCATCCCAGTGCTGACTTTCCTCAGGGATCAC
Sus_scrofa|9854                   TTAGAGATTTTTATCCATCCTGATGGAGTCATCCCAGTGCTGACTTTCCTCAGGGATCAC
Bos_taurus|6586                   TTAGAGATCTGTATCCATCCTGATGGGGTCATCCCAGTGCTGACTTTCCTCAGGGATCAC
Pteropus_vampyrus|17693           TTAGAGATCTGTATCCATCCTGATGGAGTCATCCCAGTGCTCACTTTTCTCAGGGATCAC
Equus_caballus|5167               CTAGAGATCTGTATCCATCCCGACGGGGTCATCCCAGTGCTGACTTTCCTCAGGGATCAC
Felis_catus|42678                 TTAGAGATCTGTATCCATCCTGACGGAGTCATCCCAGTGCTGACTTTCCTCAGGGATCAC
Canis_familiaris|8459             TTAGAGATCTGTATCCATCCTGATGGGGTCATCCCAGTGCTGACTTTCCTCAGGGATCAC
Spermophilus_tridecemlineatus|623 TTAGAGATCTGTATCCATCCTGATGGAGTCATCCCAGTGCTGACTTTCCTCAGGGATCAT
Erinaceus_europaeus|8157          TTGGAGATCTGTATCCATCCAGATGGAGTCATCCCAGTGTTGACTTTCCTCCGCGATCAC
Nematostella_vectensis|3047       ------------------------------ATGGTGTTTATCTTATTTGTCAAGCTTCAT
Ixodes_scapularis|10240           CTGGAAGTCATGATCGCTCCGGAGGGCGTCGTTCCGGTCCTCAGCTTCCTCAAGGACCAC
Linepithema_humile|12923          CTTGAGTTGCTCATCGCTCCTGATGGCATCATCCCTACCTTTACATTTTTAAAAGACCAT
Pogonomyrmex_barbatus|8503        TTGGAATTACTAATCGCTCCTGATGGCCTTATTCCTACGTTTACATTTTTAAAAGATCAC
Nasonia_vitripennis|16429         TTGGAAATATGCATTGCACCTGAAGGAATCATACCCACAGTCAGTTTTTTAAAAGATCAT
Drosophila_persimilis|10001       CTGGAAGTGCTGATTGCCCCTGAAGGCGTGGTGCCCGTGCTGCAGTTCCTGAAGGACCAC
Drosophila_melanogaster|9698      CTGGAGGTGCTTATTGCGCCAGAGGGCGTGGTGCCCGTGCTGCAGTTCCTTAAGGATCAT
Drosophila_sechellia|15374        CTGGAGGTGCTTATTGCCCCAGAGGGCGTGGTGCCCGTGCTGCAGTTCCTTAAGGATCAC
Drosophila_simulans|7898          CTGGAGGTGCTTATTGCCCCAGAGGGCGTGGTGCCCGTGCTGCAGTTCCTTAAGGATCAC
Bombyx_mori|4173                  CTAGAGGTGCTCATCCCTCCGGACGCAGTCATCCCGGTTTTATCCTTTTTGAAGGACCAC
Culex_quinquefasciatus|5100       CTGGAGGTGCTGATTGCCCCGGAGGGCGTCGTGCCGGTGTTGCAGTTCCTGAAGGATCAC
Daphnia_pulex|25769               TTAGAGGTTCTAATTGCACCTGATGGAATAGTCCCTGTTCTACAATTCTTGAAAGACCAT
                                                                                              

Bombyx_mori|1472                  CAACACGCATGTTGCAACCAGTGTTCCTGCGTAACAGCTATAGACGTTCCGACGAGGCAG
Caenorhabditis_elegans|1745       CATTCTGCTCAATTCACCAACTTAACCTTCATCACCGGAATGGATGTTCCAACTCGCAAG
Apis_mellifera|34131              CAAAATACCCAATATACTTCATTATCAGATATAACTGCAATGGATGTTCCTTCAAGACAA
Pediculus_humanus|9612            CATAACTGTCAATTTGAAAGTTTGGTCGATATTGCTGGAATGGATGTACCTGGGAGGGAA
Echinops_telfairi|14665           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Branchiostoma_floridae|18878      CACAATGCCCAGTTCAAGTCCCTGGCTGACATTGCATGTGTGGACATGCCCACCAAGCCA
Choloepus_hoffmanni|1658          ACCAATGCACAATTCAAATCCTTGGCTGACTTGACAGCAGTGGATGTCCCAACCCGGCAA
Dipodomys_ordii|10698             ACCAATGCACAGTTCAAATCCTTGTCTGACTTGACAGCAGTAGACATTCCAACTCGACAG
Ochotona_princeps|5383            ACCAATGCGCAGTTCAAGTCCTTGGCTGACCTGACGGCAGTGGACGTTCCGACCCGGCAG
Tursiops_truncatus|13883          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Danio_rerio|29215                 ACAAATGCTCAGTTCCGCAATCTGGCTGATCTGACAGCTGTGGACATCCCTTCAAAGCAG
Tetraodon_nigroviridis|14433      ACCAACGCTCAGTTCAGGAACATGATTGACCTGACTGCTGTTGATATCCCAACACGCCAG
Gasterosteus_aculeatus|2706       ACCAACACCCAGTTTAGGAACATGATCGACCTGACGGCGGTCGACATCCCATCCCGGCAG
Oryzias_latipes|24786             ACTAACGGCCAGTTCAGGAACATGGTGGACCTGACGGCCGTGGACATTCCCACTCGACAG
Xenopus_tropicalis|4093           ACAAACGCCCAGTTCAAATCACTGGCCGATCTGACTGCTGTTGACGTCCCAGCAAAAACA
Sorex_araneus|7405                ACCAACGCACAGTTCAAATCCTTGGCTGACTTGACAGCAGTTGACGTCCCCACCCGGCAG
Otolemur_garnettii|12074          ACCAATGCACAATTCAGGTCCTTGGCTGACTTGACAGCAGTGGATATTCCAACTCGGCAG
Dasypus_novemcinctus|7086         ACCAACGCACAATTCAAATCCTTGGCTGACTTGACAGCAGTGGATGTCCCAACGCGACAG
Tupaia_belangeri|6420             ACCAACGCACAGTTCAAATCCTTGGCTGACTTGACAGCAGTGGACATCCCAACGCGGCAG
Myotis_lucifugus|16876            ------------------------------------------------------------
Tarsius_syrichta|7730             ACCAATGCACAATTCAGATCCTTGGCTGACTTGACAGCAGTGGACATCCCAACCCGGCAG
Cavia_porcellus|21637             TCCAATGCACAGTTCAAATCCTTGGCTGACTTGACAGCAGTGGACATCCCAACTCGGCAG
Vicugna_pacos|1330                ATCAACGCACAATTCAAATCTTTGGCTGACTTGACAGCAGTGGATGTCCCCACCCGGCAG
Anolis_carolinensis|2777          ACAAATGCTCAGTTTAAATCCTTGGCTGACCTAACAGCTGTTGATGTTCCATCTCGACAG
Gallus_gallus|16773               ACTAATGCCCAGTTCAAGTCCTTGGCTGACTTGACTGCTGTTGATGTCCCATCTCGGCAG
Taeniopygia_guttata|12022         ACCAATGCCCAGTTCAAATCCTTGGCAGACCTGACTGCTGTTGATGTCCCGTCTCGGCAG
Taeniopygia_guttata|12021         ACCAATGCCCAGTTCAAATCCTTGGCAGACCTGACTGCTGTTGATGTCCCGTCTCGGCAG
Monodelphis_domestica|24637       ACCAATGCCCAGTTCAAGTCCTTGGCTGATTTAGGAGCAGTTGATGTCCCAACCCGGCAG
Macropus_eugenii|12713            ACCAATGCCCAGTTCAAGTCCTTGGCTGACTTGGGAGCGGTTGATGTTCCATCCCGGCAG
Ornithorhynchus_anatinus|16840    ACGAATGCCCAGTTCAAATCCCTGGCTGATTTGACAGCAGTCGACGTCCCAACCCGGCAG
Microcebus_murinus|1163           ACCAATGCACAGTTCAAATCCTTGGCTGACTTGACAGCAGTGGACATCCCAACTCGGCAG
Mus_musculus|22981                ACCAATGCACAATTCAAATCCTTGGCTGACTTGACGGCAGTGGATGTCCCAACTCGGCAG
Rattus_norvegicus|22470           ACCAATGCACAGTTCAAATCCTTGGCTGACTTGACAGCAGTGGATGTCCCAACTCGGCAG
Callithrix_jacchus|41072          ACCAATGCACAGTTCAAATCCCTGGCTGACTTGACAGCAGTGGACATCCCAACTCGACAG
Procavia_capensis|9423            ACCAATGCACAGTTCAGATCGTTGGCTGACTTAACAGCAGTAGACATCCCAACCCGGCAA
Rhesus_macaque|12579              ACCAATGCACAGTTCAAATCCCTGGTTGACTTGACAGCAGTGGATGTCCCAACTCGGCAG
Pongo_abelii|4686                 ACCAATGCACAGTTCAAATCCCTGGTTGACTTGACAGCAGTGGATGTCCCAACTCGGCAG
Homo_sapiens|17579                ACCAATGCACAGTTCAAATCTCTGGTTGACTTGACAGCAGTGGACGTCCCAACTCGGCAA
Pan_troglodytes|6811              ACCAATGCGCAGTTCAAATCCCTGGTTGACTTGACAGCAGTGGACGTCCCAACTCGGCAG
Oryctolagus_cuniculus|1824        ACCAATGCGCAGTTCAAATCCCTGGCTGACTTGACAGCAGTGGACATCCCATCCCGGCAG
Loxodonta_africana|10391          ACCAACGCACAATTCAGATCCTTGGCTGACTTAACGGCAGTGGATATCCCAACCCGGCAA
Sus_scrofa|9854                   ACTAACGCACAGTTCAAATCCTTGGCTGACCTGACAGCAGTGGATGTACCTACCCGGCAG
Bos_taurus|6586                   AGCAATGCACAATTCAAATCCTTGGCTGACTTGACGGCGGTGGACATCCCCACCCGGCAG
Pteropus_vampyrus|17693           AGTAACGCACAGTTCAAATCTTTGGCTGATCTGACGGCAGTGGACATCCCCACCCGGCAG
Equus_caballus|5167               AGCAATGCACAGTTCAAATCCCTGGCTGACTTGACGGCAGTGGACATCCCCACCCGGCAG
Felis_catus|42678                 ACCAATGCACAGTTCAAATCCTTGGCTGACTTGACAGCAGTGGACGTCCCCACCCGGCAA
Canis_familiaris|8459             ACCAATGCACAATTCAAATCCTTGGCTGACTTGACAGCAGTGGACATCCCCACCCGGCAG
Spermophilus_tridecemlineatus|623 ACCAATGCACAGTTCAAATCCTTGGCTGACCTGACAGCAGTGGATGTACCAACTCGGCAA
Erinaceus_europaeus|8157          ACCAATGCACAGTTCAAATCCTTGGCTGACTTGACAGCAGTTGACATCCCCACCCGGCAG
Nematostella_vectensis|3047       CAA---------------------------------------------------------
Ixodes_scapularis|10240           CACAACGCCCAGTACGCCAACATCGTGGACATTGCGGGCGTAGACGTGCCGACCAGGCAG
Linepithema_humile|12923          CATAATACACAATTTGTCAGTTTGGCAGATATTACTGCACTAGATGTACCCAGCAGACAA
Pogonomyrmex_barbatus|8503        CATAATACGCAATTTGTTAATCTGTCGGATATTACCGCTCTTGATGTACCTAGTAGACAG
Nasonia_vitripennis|16429         CACAATTGTCAATTCACCAACTTATCAGACATCACTGCTGTTGATATTCCAAGCAGGCCA
Drosophila_persimilis|10001       CACCAGGCACAGTTCACCAATCTGATCGATATTGCAGGCATGGATGTGCCCTGCCGCAAG
Drosophila_melanogaster|9698      CATCAGGCGCAGTTTACCAACCTGGTTGACATTGCCGGCGTGGATGTGCCCTGTCGCAAG
Drosophila_sechellia|15374        CATCAGGCGCAGTTTACCAACCTGGTCGACATTGCCGGCGTGGATGTGCCCTGCCGCAAG
Drosophila_simulans|7898          CATCAGGCGCAGTTTACCAACCTGGTCGACATTGCCGGCGTGGATGTGCCCTGCCGCAAG
Bombyx_mori|4173                  CACAGCGCTCAGTTTGCAAACCTTGTCGATATCGCTGGCATGGACGTACCCTCGCGCTCA
Culex_quinquefasciatus|5100       CACCAGGCGCAGTTCGCAAATCTGGTCGACATTGCCGGGATGGACGTTCCGAGCCGTCAG
Daphnia_pulex|25769               CATCAATGTCAGTTTGCTAGTTTGGCTGATATTGGGGCCATGGATGTTCCTTCAAGGGAA
                                                                                              

Bombyx_mori|1472                  TTTCGATTCGAAGTCGTATATTGCCTGCTCAGTATAAGGTTCGGCGAACGAATTCGAGTT
Caenorhabditis_elegans|1745       AATCGTCTTGAAGTTATTTATTCGCTTTACTCTGTTCGATTCAACGCCAGAGTTCGTGTT
Apis_mellifera|34131              TATAGGTTTGAGATTATCTATAATCTACTTTCTATAACTTTTAACAAACGTATTAGAGTA
Pediculus_humanus|9612            TACAGATTTGAAATTATCTATAATTTATTGTCATTGCGTTATAACTCTAGAGTAAGGGTT
Echinops_telfairi|14665           NNNNNNNNNNNNATTGTCTACAATCTGCTGTCTCTGCGTTTTAACTCACGGATCCGGGTG
Branchiostoma_floridae|18878      TACAGATTTGAGCTGGTGTACATGCTCATGTCCCTCACCTACAACTCCCGCATCCGGGTC
Choloepus_hoffmanni|1658          AACCGTTTTGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|10698             AACCGTTTTGAGATTGTCTACAACCTGTTATCTCTGCGCTTTAACTCACGGGTTCGTGTG
Ochotona_princeps|5383            AACCGTTTTGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tursiops_truncatus|13883          NNNNNNNNNNNNATTGTTTACAACTTGCTCTCTCTGCGTTTCAACTCCCGGATCCGTGTG
Danio_rerio|29215                 AACCGCTTTGAGATTGTGTACAATCTGCTGTCCTTGCATTATAACTCTCGTATCCGAGTA
Tetraodon_nigroviridis|14433      AATCGCTTTGAGATCGTGTATAACCTGTTGTCCCTACGCTTTAACTCTCGTATTCGTGTC
Gasterosteus_aculeatus|2706       AACCGCTTTGAGATTGTGTACCACCTGCTGTCGCTGCGCTACAACTCCCGTCTGCGCATT
Oryzias_latipes|24786             AACCGCTTCGAGATCGTCTACAACCTGCTTTCTCTGCGCTACAACTCACGTGTCCGTGTA
Xenopus_tropicalis|4093           AACCGGTTTGAAATAGTGTACAACCTTTTGTCATTGCGGTTCAACACCCGTATGCGCGTG
Sorex_araneus|7405                AACCGTTTCGAGATTGTTTATAACCTCCTCTCTCTGCGCTTCAACTCCCGGATCCGGGTG
Otolemur_garnettii|12074          AACCGTTTTGAGATTGTCTACAACCTACTCTCTCTGCGCTTCAACTCACGGATTCGTGTG
Dasypus_novemcinctus|7086         AATCGTTTCGAGATTGTCTACAACCTCCTGTCTCTGCGCTTCAACTCAAGAATCCGTGTG
Tupaia_belangeri|6420             AACCGTTTTGAGATTGTCTACAACCTGCTCTCTCTGCGCTTCAACTCACGGATCCGTGTG
Myotis_lucifugus|16876            ------------ATTGTTTACAACCTGCTGTCTCTGCGCTTCAACTCCCGCATCCGTGTG
Tarsius_syrichta|7730             AATCGTTTTGAGATTGTCTACAACCTGCTGTCTCTGCGTTTCAACTCTCGGATCCGTGTG
Cavia_porcellus|21637             AATCGTTTTGAGATAGTCTACAACCTGCTATCCCTACGCTTCAACTCTCGGATCCGTGTA
Vicugna_pacos|1330                AACCGTTTTGAGATTGTTTACAACCTCTTGTCTCTTCGCTTCAACTCACGGATCCGTGTG
Anolis_carolinensis|2777          TACCGTTTTGAGATTGTTTACAATCTCTTATCCCTACGCTACAACTCCCGGATTCGTGTG
Gallus_gallus|16773               TACCGCTTCGAGATTGTTTACAATCTCCTGTCTCTGCGATTCAACAGTCGGATCCGTGTG
Taeniopygia_guttata|12022         TACCGCTTTGAGATTGTGTACAACCTCTTGTCGCTGCGGTTCAACAGCCGCATCCGTGTG
Taeniopygia_guttata|12021         TACCGCTTTGAGATTGTGTACAACCTCTTGTCGCTGCGGTTCAACAGCCGCATCCGTGTG
Monodelphis_domestica|24637       AACCGTTTTGAGATTGTTTATAACCTGCTTTCTCTGCGCTTCAATTCTCGGATCCGAGTG
Macropus_eugenii|12713            AACCGTTTTGAGGTTGTTTATAACCTGCTTTCTTTGCACTTCAATACTCGCATCCGAGTG
Ornithorhynchus_anatinus|16840    AACCGCTTTGAGATTGTCTACAACCTTCTGTCTCTTCGCTTCAACTCGCGGATCCGGGTG
Microcebus_murinus|1163           AACCGTTTTGAGATTGTCTACAACCTACTCTCTCTGCGCTTCAACTCACGGATCCGTGTG
Mus_musculus|22981                AACCGTTTTGAGATTGTCTACAACCTGCTGTCTCTGCGGTTCAACTCTAGGATTCGTGTG
Rattus_norvegicus|22470           AACCGTTTTGAGATTGTCTACAACCTGCTGTCCCTGCGGTTTAACTCTAGGATTCGTGTG
Callithrix_jacchus|41072          AACCGTTTTGAGATTGTCTACAACCTGTTGTCTCTGCGCTTTAACTCACGGATCCGTGTG
Procavia_capensis|9423            AACCGTTTTGAGATTGTCTACAACCTGCTGTCTCTACACTTCAACTCACGGATCCGTGTG
Rhesus_macaque|12579              AACCGTTTTGAGATTGTCTACAACTTGTTGTCTCTGCGCTTCAACTCACGGATCCGTGTG
Pongo_abelii|4686                 AACCGTTTTGAGATTGTCTACAACCTATTGTCTCTGCGCTTCAACTCACGGATCCGTGTG
Homo_sapiens|17579                AACCGTTTTGAGATTGTCTACAACCTGTTGTCTCTGCGCTTCAACTCACGGATCCGTGTG
Pan_troglodytes|6811              AACCGTTTTGAGATTGTCTACAACCTGTTGTCTCTGCGCTTCAACTCACGGATCCGTGTG
Oryctolagus_cuniculus|1824        AACCGTTTTGAGATTGTCTACAACCTGCTGTCCCTGCGCTTCAACACTCGGATCCGGGTG
Loxodonta_africana|10391          AACCGTTTTGAGATTGTCTACAACTTGCTGTCCCTGCACTTCAACTCACGAATCCGTGTG
Sus_scrofa|9854                   AACCGTTTCGAGATTGTTTACAACCTGCTCTCTTTGCGCTTCAACTCCCGGATCCGTGTG
Bos_taurus|6586                   AACCGTTTTGAGATCGTTTACAACCTGCTCTCTCTGCGCTTCAACTCGCGGATCCGTGTG
Pteropus_vampyrus|17693           AACCGTTTTGAGATTGTTTACAACCTACTCTCTCTGCGCTTCAACTCCCGGATCCGTGTG
Equus_caballus|5167               AACCGTTTTGAGATTGTTTACAACCTGCTCTCTCTGCGCTTCAACTGCCGGATCCGTGTG
Felis_catus|42678                 AACCGTTTTGAGATTGTTTACAACCTGCTCTCTCTGCGCTTCAACTCCCGGATCCATGTG
Canis_familiaris|8459             AACCGTTTTGAGATTGTTTACAACCTGCTTTCTCTGCGTTTCAACTCTCGGATCCGTGTG
Spermophilus_tridecemlineatus|623 AATCGTTTTGAGATTGTCTACAATCTGCTGTCTCTGCGCTTCAATTCACGGATCCGTGTG
Erinaceus_europaeus|8157          AATCGTTTTGAGATTGTTTACAACCTGCTCTCTCTGCGCTACAACTCTCGCATCCGTGTG
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           TACCGTTTTGAAGTCGTCTACAACCTCCTGTCCTTGCACTTTAACTCTAGGATCAGGGTG
Linepithema_humile|12923          TATAGATTTGAGCTTGTCTACAACTTGCTGTCACTGCGATACAACTCACGTATCAGAGTA
Pogonomyrmex_barbatus|8503        TTCAGATTTGAGCTAGTCTACAATCTGCTGTCGTTGCGATACAATTCGCGCATCAGAGTT
Nasonia_vitripennis|16429         TACAGATTTGAACTTGTGTACAACATTCTTTCAATAAGGTATAACACAAGAATCCGTGTG
Drosophila_persimilis|10001       CATCGTTTCGAGGTCATTTACAACCTCCTGTCGCTCCGCTACAACGCCCGTATTCGCGTG
Drosophila_melanogaster|9698      AACCGATTCGAGGTGGTCTACAATTTGCTCTCGCTGCGCTACAATTCGCGCATCCGCGTT
Drosophila_sechellia|15374        AACCGATTCGAGGTGGTCTACAATCTGCTCTCGCTGCGCTACAACTCGCGCATCCGCGTT
Drosophila_simulans|7898          AACCGATTCGAGGTGGTCTACAATCTGCTCTCGCTGCGCTACAACTCGCGCATCCGCGTT
Bombyx_mori|4173                  AACAGATTCGAAATCATATATAACATACTTTCTCTACGTTACAATGCCCGAATAAGAGTC
Culex_quinquefasciatus|5100       TACCGGTTCGAGGTCATCTACAACATCCTGTCGCTGCGGTACAACTCGCGGATCCGCGTC
Daphnia_pulex|25769               AATAGATTTGAGGTCATCTATAATCTCCTCTCACTGCGATTCAACTCACGGATACGAGTC
                                                                                              

Bombyx_mori|1472                  AAAACCTACACAGATGAATTAACGCCGCTGCACTCCGCGTGCGAATTGTGGCAAAGCTGC
Caenorhabditis_elegans|1745       CGTACATACACTGATGAAATTGCTCCAATCGATTCTGCCACTCCAGTTTTCAAGGGTGCT
Apis_mellifera|34131              AAAACATATACGGATGAATTAACACCTGTACCATCAGCAGAACCAATTTTTGATGCTGCT
Pediculus_humanus|9612            AAAACATATACAGATGAATTAACTCCCATCGACTCTGTTTACGAAGTGTACAGGGCAGCA
Echinops_telfairi|14665           AAGACCTACACAGATGAGCTGACCCCCATTGAGTCCGTTGTCTCTGTGCACAAGGCCGCC
Branchiostoma_floridae|18878      CGCACCTACACCGACGAGATCACCCCCATCGAGTCCTGCTACTCGGTCTTCAAGGCAGCT
Choloepus_hoffmanni|1658          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|10698             AAGACTTATACAGATGAGCTGACACCCCTAGAATCCAGTGTCTCTGTGTATAAGGCATCC
Ochotona_princeps|5383            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tursiops_truncatus|13883          AAGACCTATACAGATGAGCTGACACCCATTGAGTCTTCTGTGTCTGTGTACAAGGCAGCC
Danio_rerio|29215                 AAGACCTACACGGATGAGCTGACTCCTCTTGACTCCTCTGTGCCTGTGTTCCAGGCGTCT
Tetraodon_nigroviridis|14433      AAGACGTACACGGATGAGTTGACACCCGTGGACTCTGCAGTCCCAGTCCACATCGCTGCC
Gasterosteus_aculeatus|2706       AAGACGTACACGGACGAGTTGACGCCAGTGGACTCCGCCGTCTCCGTCCACTTAGCTGCT
Oryzias_latipes|24786             AAGACGTACACAGATGAACTGACGCCGTTGGACTCGGCAGTCTCTGTCCACGTGGCGGCC
Xenopus_tropicalis|4093           ATGACCTACACCGATGAGCTGACTCCTGTTGAGTCGGCTGTGCCTGTTTTCGAGGCTGCA
Sorex_araneus|7405                AAGACCTACGCGGATGAGCTGACGCCCATCGACTCCTCTGTGCCTGTGTTCAAGGCGGCC
Otolemur_garnettii|12074          AAGACCTACACAGATGAGCTGACACCCATTGAGTCCACTGTCTCTGTGTATAAGGCATCC
Dasypus_novemcinctus|7086         AAGACCTATACAGATGAGCTGACACCTGTTGAGTCCACTGTCTCTGTGTTCAAGGCATCC
Tupaia_belangeri|6420             AAGACCTACACAGATGAGCTGACGCCTGTTGAGTCCGCTGTCTCTGTGCACAAAGCAGCC
Myotis_lucifugus|16876            AAGACCTATACAGATGAGCTGACACCCATTGAGTCCTCCGTCTCTGTGCATAAGGCAGCA
Tarsius_syrichta|7730             AAGACCTACACAGATGAGCTGACGCCCATCGAGTCCATTGTCTCTGTGCACAAGGCAGCC
Cavia_porcellus|21637             AAGACCTACACAGATGAGCTGACACCCATTGAGTCCTCAGTCTCGGTGTTCAAGGCATCC
Vicugna_pacos|1330                AAAACCTATACGGATGAGCTGACGCCCATAGAGTCTTCTGTGTCTGTGTACAAGGCAGCC
Anolis_carolinensis|2777          AAAACATATACTGATGAATTGACACCTATTGATTCAGTAGTCCCAGTACACCAAGCATCG
Gallus_gallus|16773               AAAACATACACTGATGAGCTGACACCTATTGACTCAGCAGTGTCTGTGCACAAAGCAGCA
Taeniopygia_guttata|12022         AAGACGTACACCGATGAGCTGACACCCATCGACTCAGCAGTGCCTGTGCACAAGGCAGCA
Taeniopygia_guttata|12021         AAGACGTACACCGATGAGCTGACACCCATCGACTCAGCAGTGCCTGTGCACAAGGCAGCA
Monodelphis_domestica|24637       AAGACGTATGCAGATGAGCTGACTCCTGTTGATTCTGTAGTCTCAGTGCACAAAGCTGCA
Macropus_eugenii|12713            AAGACATATACGGATGAGCTGACTCCTATCGATTCAGCAGTCTCTGTACACAAAGCTGCA
Ornithorhynchus_anatinus|16840    AAGACGTACACGGACGAGTTGACTCCGATCGAATCTTCGGTCACCGTGTACAAGGCCGCG
Microcebus_murinus|1163           AAGACCTACACAGATGACCTGACGCCCATTGAATCCATTTACTCTGTGTTCAAGGCAGCC
Mus_musculus|22981                AAGACCTATGCAGATGAGCTGACACCCATTGACTCTATAGTGTCTGTGCACATCGCGGCC
Rattus_norvegicus|22470           AAGACCTATGCAGATGAGCTGACAGCCATTGACTCCATAGTGTCTGTGCACATTGCGGCC
Callithrix_jacchus|41072          AAGACCTACACAGATGAGCTGACGCCCATTGAGTCCCTTACCTCTGTGTTCAAGGCAGCC
Procavia_capensis|9423            AAGACCTATACAGATGAGTTGACACCCATTGAGTCCAGTGTCTCTGTGTACAAGGCAGCC
Rhesus_macaque|12579              AAGACCTACACAGATGAGCTGACGCCCATTGAGTCCGCTATGTCTGTGTTCAAGGCAGCC
Pongo_abelii|4686                 AAGACCTACACAGATGAGCTGACGCCCATTGAGTCTGCTGTCTCTGTGTTCAAGGCAGCC
Homo_sapiens|17579                AAGACCTACACAGATGAGCTGACGCCCATTGAGTCTGCTGTCTCTGTGTTCAAGGCAGCC
Pan_troglodytes|6811              AAGACCTACACAGATGAGCTGACGCCCATTGAGTCTGCTGTCTCTGTGTTCAAGGCAGCC
Oryctolagus_cuniculus|1824        AAGACCTATACAGATGAGCTGACGCCCGTGGATTCCGCTGTCCCCGTGCACAAGGCAGCC
Loxodonta_africana|10391          AAGACCTATACAGATGAGCTGACACCCATAGAGTCCACTGTCTCTGTGTATAAGGCAGCC
Sus_scrofa|9854                   AAGACCTATACAGATGAGCTGACGCCCATTGAGTCTTCTGTGACTGTGTACAAGGCAGCC
Bos_taurus|6586                   AAGACCTATACGGACGAGCTAACGCCCATTGAGTCTTCTGTGCCTGTGTACAAGGCCGCC
Pteropus_vampyrus|17693           AAGACTTACACAGATGAGCTGACACCCATTGAGTCCACTGTCTCTGTGCACAAGGCAGCC
Equus_caballus|5167               AAGACCTACACAGATGAGCTGACGCCCATCGAGTCCGCTGTCTCTGTGCACAAGGCCGCC
Felis_catus|42678                 AAGACCTACACAGATGAGCTGACACCCATTGAGTCCACTGTTCCTGTGTATAAGGCAGCT
Canis_familiaris|8459             AAGACTTACACAGATGAGCTGACACCCATTGAGTCCACTGTTTCTGTGTATAAGGCAGCT
Spermophilus_tridecemlineatus|623 AAGACCTATACAGATGAGCTGACACCAATTGAGTCCACAGTCTCTGTGTATAAGGCAGCC
Erinaceus_europaeus|8157          AAGACCTATACGGACGAGCTGACACCCATTGACTCCACAGTCCCTGTGTACAAGGCAGCC
Nematostella_vectensis|3047       ------------------------------------------------------------
Ixodes_scapularis|10240           AAGACGTACACGGACGAATTGACGGCGCTGGACTCCGCGACGCCCGTATACAAGGGAGCC
Linepithema_humile|12923          AAAACCTACACTGATGAGTTGACACCAGTTGACTCAATAAACAGTATATTTAAAGCTGCT
Pogonomyrmex_barbatus|8503        AAAACTTATACCGATGAATTGACGCCAGTCGACTCCATTTATAGCATATTCAAAGCTGCT
Nasonia_vitripennis|16429         AAAACTTACACAGATGAATTAACACCAGTAGATTCTATTTATGATGTACACAAGGCTGCT
Drosophila_persimilis|10001       AAGACCTACACCGATGAGCTGACCCCCTTGGACTCTGCCTGCGAGGTGCACAAGGCTGCC
Drosophila_melanogaster|9698      AAGACCTACACCGATGAGCTGACTCCTCTGGACTCCGCCTGCGAGGTGCATAAGGCGGCC
Drosophila_sechellia|15374        AAGACCTACACCGATGAGCTGACTCCCCTGGACTCCGCGTGCGAGGTGCATAAGGCGGCC
Drosophila_simulans|7898          AAGACCTACACCGATGAGCTGACTCCCCTGGACTCCGCGTGCGAGGTGCATAAGGCGGCC
Bombyx_mori|4173                  AAAACTTACACTGACGAGTTGACTCCTGTAGACTCAGCCTGCGATGTATTCAAGGCCGCA
Culex_quinquefasciatus|5100       AAGACCTACACCGACGAGCTGACCCCGATCGATTCGTGCAACGAGGTGTTCAAGGCCGCC
Daphnia_pulex|25769               AAGAGTTACACAGATGAATTGACTCCGGTCGATTCTTCCTATGAAGTTTTTAAAGCTGCT
                                                                                              

Bombyx_mori|1472                  AACTGGTTCGAACGTGAGGTATACGATATGTTTGGTATTGTGTTTACTCATCACCCGGAT
Caenorhabditis_elegans|1745       GACTGGTTTGAGCGTGAAGTGTACGATATGTATGGAGTATGGTTCAACAATCACCCAGAT
Apis_mellifera|34131              AACTGGTATGAACGAGAAATATGGGATATGTTTGGTATATTATTTATGGGACATACAGAT
Pediculus_humanus|9612            GATTGGTACGAACGAGAGGTATGGGATATGTATGGAGTATATTTTAAAAATCATCCAGAC
Echinops_telfairi|14665           AACTGGTATGAGAGGGAGATCTGGGACATGTTTGGAGTCTTCTTTGCCAACCACCCTGAC
Branchiostoma_floridae|18878      GATTGGTACGAAAGAGAGGCATGGGACATGTACGGGGTGTACTTCTCCAACCACCCTGAT
Choloepus_hoffmanni|1658          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|10698             AATTGGTATGAGAGGGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|5383            NNNNNNNNNNNNNNNNNNATCTGGGACATGTTTGGAGTCTTCTTTGCCAACCACCCTGAT
Tursiops_truncatus|13883          AACTGGTATGAGAGGGAGATTTGGGACATGTTTGGAGTCTTCTTTGCTAACCACCCTGAC
Danio_rerio|29215                 AACTGGTATGAGAGAGAGGTTTGGGACATGTTTGGAGTTTTCTTCACAAACCATCCAGAT
Tetraodon_nigroviridis|14433      AACTGGTACGAGAGGGAGGTGTGGGACATGTTCGGGGTGTTCTTCGCTAACCACCCGGAC
Gasterosteus_aculeatus|2706       AACTGGTACGAGAGGGAGGTTTGGGACATGTTCGGCGTGTTCTTCGCCAACCACCCGGAC
Oryzias_latipes|24786             AACTGGTATGAGCGAGAGGTTTGGGACATGTTTGGAGTGTTCTTTGCCAACCATCCCGAC
Xenopus_tropicalis|4093           AACTGGTATGAGAGAGAGGTTTGGGATATGTACGGTGTATTTTTCGCAAACCATCCCGAT
Sorex_araneus|7405                AACTGGTATGAGCGGGAGATCTGGGACATGTTTGGCGTCTTCTTCGCTAACCATCCTGAC
Otolemur_garnettii|12074          AACTGGTATGAGAGGGAGATCTGGGACATGTTTGGAGTCTTTTTTGCTAACCATCCTGAC
Dasypus_novemcinctus|7086         AACTGGTATGAGAGAGAGATC---GACATGTTTGGAATCTTCTTTGCTAACCACCCTGAC
Tupaia_belangeri|6420             AACTGGTATGAGAGGGAGATCTGGGACATGTTTGGAGTCTTCTTCGCCAACCACCCTGAC
Myotis_lucifugus|16876            AACTGGTATGAGAGGGAGATCTGGGACATGTTTGGAGTCTTCTTTGCTAACCACCCTGCC
Tarsius_syrichta|7730             AACTGGTATGAGAGGGAGATCTGGGACATGTTTGGAGTCTTCTTTGCTAACCACCCTGAC
Cavia_porcellus|21637             ATCTGGTATGAGAGGGAGGTCTGGGACATGTTTGGAGTCTTCTTTACTAACCACCCTGAC
Vicugna_pacos|1330                AACTGGTATGAGAGGGAGATCTGGGACATGTTTGGAGTCTTCTTTGCTAACCACCCTGAC
Anolis_carolinensis|2777          AACTGGTATGAAAGAGAGGTCTGGGACATGTATGGAGTCTTCTTTGCCAACCACCCTGAT
Gallus_gallus|16773               AACTGGTATGAAAGAGAGGTTTGGGACATGTATGGTGTTTTCTTTGCCAACCATCCTGAT
Taeniopygia_guttata|12022         AACTGGTATGAAAGAGAGGTTTGGGACATGTATGGTGTTTTCTTTGCCAACCACCCTGAT
Taeniopygia_guttata|12021         AACTGGTATGAAAGAGAGGTTTGGGACATGTATGGTGTTTTCTTTGCCAACCACCCTGAT
Monodelphis_domestica|24637       AATTGGTATGAAAGGGAGATATGGGACATGTTTGGAGTCTACTTTGCCAATCACCCTGAT
Macropus_eugenii|12713            AATTGGTATGAAAGGGAGATCTGGGACATGTTTGGAGTCTTCTTTGCCAATCACCCCGAT
Ornithorhynchus_anatinus|16840    AACTGGTACGAGAGGGAGATCTGGGACATGTTTGGAGTCTTCTTTTTCAACCACCCGGAT
Microcebus_murinus|1163           AACTGGTATGAGAGGGAGATCTGGGACATGTTTGGTGTCTTTTTTACCAACCATCCTGAC
Mus_musculus|22981                AATTGGTATGAGAGGGAGGTCTGGGACATGTTTGGAGTTTTCTTTTTTAACCACCCTGAT
Rattus_norvegicus|22470           AATTGGTATGAGAGGGAGGTCTGGGACATGTTTGGAGTTTTCTTCTTCAACCACCCTGAC
Callithrix_jacchus|41072          AACTGGTATGAGAGGGAGGTCTGGGACATGTTTGGCGTCTTCTTTGTTAACCACCCTGAT
Procavia_capensis|9423            AACTGGTATGAGAGGGAGATCTGGGACATGTTTGGAGTCTTCTTTGCTAACCACCCTGAC
Rhesus_macaque|12579              AACTGGTATGAAAGGGAGATCTGGGACATGTTTGGAGTCTTCTTTGCTAACCACCCTGAT
Pongo_abelii|4686                 AACTGGTATGAAAGGGAGATCTGGGACATGTTTGGAGTCTTCTTTGCTAACCACCCTGAC
Homo_sapiens|17579                AACTGGTATGAAAGGGAGATCTGGGACATGTTTGGAGTCTTCTTTGCTAACCACCCTGAT
Pan_troglodytes|6811              AACTGGTATGAAAGGGAGATCTGGGACATGTTTGGAGTCTTCTTTGCTAACCACCCTGAT
Oryctolagus_cuniculus|1824        AACTGGTATGAGAGGGAGATCTGGGATATGTTTGGGGTCTTCTTTGCCAACCATCCTGAC
Loxodonta_africana|10391          AACTGGTATGAGAGGGAGGTCTGGGACATGTTTGGAGTCTTCTTTGCTAACCACCCTGAC
Sus_scrofa|9854                   AACTGGTATGAGAGGGAGATCTGGGACATGTTTGGAGTCTTCTTTGCTAACCACCCTGAC
Bos_taurus|6586                   AACTGGTATGAGAGGGAGATCTGGGACATGTTCGGAGTCTTCTTTGCTAACCACCCTGAT
Pteropus_vampyrus|17693           AACTGGTATGAGAGAGAGATATGGGACATGTTTGGAGTCTTCTTTGCTAACCACCCTGAC
Equus_caballus|5167               AACTGGTATGAGAGGGAGATCTGGGACATGTTTGGAGTTTTCTTTGCTAACCACCCTGAC
Felis_catus|42678                 AACTGGTATGAGAGGGAGATCTGGGACATGTTTGGAGTGTTTTTTGCTAACCATCCTGAT
Canis_familiaris|8459             AACTGGTATGAGAGAGAGATCTGGGACATGTTTGGAGTCTTCTTTGCTAACCACCCTGAC
Spermophilus_tridecemlineatus|623 AACTGGTATGAGAGGGAGATCTGGGACATGTTTGGTGTCTTTTTTGCTAACCACCCTGAC
Erinaceus_europaeus|8157          AACTGGTATGAGAGGGAGATCTGGGACATGTTTGGAGTCTTCTTTGCTAACCATCCTGAT
Nematostella_vectensis|3047       GATTGGATCTGTCATCCAGGTTGGGATATGTATGGAGTGTTCTTTTCAAATCACCCCGAC
Ixodes_scapularis|10240           AACTGGTACGAGCGTGAGGTGTGGGACATGTTCGGCGTGTTCTTCGGCAATCATCCCGAC
Linepithema_humile|12923          GATTGGTATGAGCGAGAAGTGTGGGACATGTTCGGTGTATTCTTCTCAAATCATCCCGAT
Pogonomyrmex_barbatus|8503        GATTGGTATGAGCGAGAGATATGGGATATGTTCGGTGTGTTCTTCTCGAATCATCCCGAT
Nasonia_vitripennis|16429         GACTGGTATGAGCGAGAAGTATGGGATATGTTTGGAATCTACTTTGCTGGTCATCCCGAT
Drosophila_persimilis|10001       AACTGGTACGAGCGTGAAATTTGGGACATGTATGGCGTGTTCTTTGCCAACCACCCCGAC
Drosophila_melanogaster|9698      AACTGGTACGAACGTGAGATCTGGGACATGTACGGCGTGTTCTTTGCCAACCATCCCGAC
Drosophila_sechellia|15374        AACTGGTACGAACGTGAGATCTGGGACATGTACGGAGTGTTCTTTGCCAATCATCCCGAC
Drosophila_simulans|7898          AACTGGTACGAACGTGAGATCTGGGACATGTACGGCGTGTTCTTTGCCAACCATCCCGAC
Bombyx_mori|4173                  AATTGGTACGAACGAGAGATCTGGGACATGTATGGAGTATTTTTTGCTAACCATCCTGAT
Culex_quinquefasciatus|5100       AATTGGTACGAGCGCGAAATCTGGGACATGTACGGTGTGTTCTTCGCGAACCACCCGGAC
Daphnia_pulex|25769               GACTGGTATGAAAGAGAAGTTTGGGACATGTATGGGGTATTTTTTGCGAACCACCCTGAT
                                     ...                  .   ...  ..  .    ..             .  

Bombyx_mori|1472                  CTGAGAAGGATTTTAACTGACTATGGATTCGTCGGTCACCCCCTTCGAAAAGATTTTCCA
Caenorhabditis_elegans|1745       CTTCGAAGAATTCTCACTGATTACGGTTTCGAGGGTCACCCATTCCGCAAGGATTATCCA
Apis_mellifera|34131              CTTCGTAGAATTCTTACAGATTATGGTTTTGAAGGACATCCATTAAGAAAAGATTTTCCT
Pediculus_humanus|9612            TTGAGAAGAATCCTAACAGATTATGGTTTTGAGGGTCATCCACAGAGAAGGGATTTCCCA
Echinops_telfairi|14665           CTGAGAAGGATCCTGACAGACTATGGCTTTGAGGGACATCCTTTCCGGAAAGACTTCCCC
Branchiostoma_floridae|18878      CTGCGGCGGATTCTCACAGACTACGGGTTTGAGGGCCATCCATTCAGGAAGGACTTTCCT
Choloepus_hoffmanni|1658          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|10698             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|5383            CTCAGGAGGATCCTGACAGATTACGGCTTCGAAGGACACCCTTTCCGGAAAGACTTCCCC
Tursiops_truncatus|13883          CTAAGAAGGATCCTAACAGACTATGGTTTTGAGGGACATCCTTTCCGGAAAGATTTCCCC
Danio_rerio|29215                 CTGAGACGCATCTTGACAGATTATGGATTTGAAGGCCATCCATTCAGGAAAGATTTCCCG
Tetraodon_nigroviridis|14433      CTGAGGCGCATCCTCACAGACTACGGCTTCGAGGGGCATCCCTTCCGGAAGGACTTCCCG
Gasterosteus_aculeatus|2706       CTGAGGCGTATTCTGACGGACTACGGCTTCGAGGGTCACCCCTTCAGGAAGGACTTCCCC
Oryzias_latipes|24786             CTAAGGCGCATTCTGACTGACTACGGCTTCGAAGGTCATCCCTTCAGGAAGGACTTCCCC
Xenopus_tropicalis|4093           TTGAGACGGATCCTTACAGACTACGGGTTTGAAGGCCATCCCTTCCGTAAAGATTTCCCA
Sorex_araneus|7405                TTGAGGAGGATCCTGACAGATTACGGCTTTGAGGGCCATCCTTTCAGGAAAGACTTCCCT
Otolemur_garnettii|12074          CTAAGAAGGATTCTGACAGATTATGGCTTTGAGGGACATCCTTTCCGGAAAGACTTCCCC
Dasypus_novemcinctus|7086         CTAAGAAGGATCCTGACAGACTACGGCTTTGAAGGACATCCTTTCCGGAAAGACTTCCCC
Tupaia_belangeri|6420             CTAAGAAGGATTCTGACAGATTATGGCTTTGAGGGACATCCTTTCCGGAAAGATTTCCCC
Myotis_lucifugus|16876            CTAAGAAGGATCCTGACAGACTATGGCTTTAAGGTACATCCTTTTCGGAAAGACTTTCCC
Tarsius_syrichta|7730             CTAAGAAGAATCTTGACAGATTATGGCTTTGAGGGACATCCTTTCCGGAAAGACTTCCCC
Cavia_porcellus|21637             CTGAGGCGGATCCTGACGGATTATGGCTTTGAGGGACATCCGTTCCGGAAGGACTTCCCC
Vicugna_pacos|1330                CTAAGAATGATCCTGACAGACTATGGCTTTGAGGGCCATCCTTTCTGG---AACTTCCCC
Anolis_carolinensis|2777          CTGAGGCGAATCCTGACAGATTATGGCTTTGAGGGGCATCCTTTCCGGAAAGATTTCCCT
Gallus_gallus|16773               CTAAGGCGAATCCTCACAGACTATGGGTTTGAAGGCCATCCTTTCCGGAAGGACTTTCCA
Taeniopygia_guttata|12022         CTAAGGCGAATCCTCACAGATTATGGGTTTGAGGGCCATCCGTTCCGGAAGGACTTCCCA
Taeniopygia_guttata|12021         CTAAGGCGAATCCTCACAGATTATGGGTTTGAGGGCCATCCATTCCGGAAGGACTTCCCA
Monodelphis_domestica|24637       CTCAGGAGGATCCTGACAGACTATGGGTTTGAGGGACATCCTTTCCGGAAGGACTTCCCT
Macropus_eugenii|12713            CTCAGGAGGATCCTGACAGACTATGGGTTTGAGGGACATCCCTTCCGGAAGGACTTCCCA
Ornithorhynchus_anatinus|16840    CTGAGGCGGATTCTGACCGACTACGGGTTTGAGGGCCACCCTTTCCGGAAGGACTTCCCC
Microcebus_murinus|1163           CTAAGAAGGATCCTCACAGATTATGGCTTCGAGGGACATCCTTTCCGGAAAGACTTCCCT
Mus_musculus|22981                TTAAGAAGGATCCTGACAGATTATGGCTTCGAGGGACATCCTTTCCGGAAAGACTTTCCC
Rattus_norvegicus|22470           TTGAGAAGGATCCTGACAGATTATGGCTTCGAGGGACATCCTTTCCGGAAAGACTTTCCC
Callithrix_jacchus|41072          CTAAGAAGGATCCTGACAGATTATGGCTTCGAGGGACATCCTTTCCGGAAAGACTTCCCT
Procavia_capensis|9423            CTAAGAAGAATCCTAACAGACTATGGCTTTGAGGGTCATCCTTTCCGTAAGGACTTCCCC
Rhesus_macaque|12579              CTAAGAAGGATCCTGACGGATTATGGCTTCGAGGGACATCCTTTCCGGAAAGACTTTCCT
Pongo_abelii|4686                 CTAAGAAGGATCCTGACAGATTATGGCTTCGAGGGACATCCTTTCCGGAAAGACTTTCCT
Homo_sapiens|17579                CTAAGAAGGATCCTGACAGATTATGGCTTCGAGGGACATCCTTTCCGGAAAGACTTTCCT
Pan_troglodytes|6811              CTAAGAAGGATCCTGACAGATTATGGCTTCGAGGGACATCCTTTCCGGAAAGACTTTCCT
Oryctolagus_cuniculus|1824        CTGAGAAGGATCCTGACAGATTATGGCTTCGAGGGCCATCCTTTCCGGAAAGACTTCCCG
Loxodonta_africana|10391          CTAAGAAGGATCCTGACAGACTATGGCTTTGAGGGACATCCTTTCCGGAAGGATTTCCCC
Sus_scrofa|9854                   CTAAGAAGGATCCTGACAGACTATGGCTTTGAGGGACATCCTTTCCGGAAAGATTTCCCC
Bos_taurus|6586                   CTAAGAAGAATCCTAACAGACTATGGCTTTGAGGGACATCCTTTCCGGAAAGACTTCCCC
Pteropus_vampyrus|17693           CTAAGAAGGATCCTGACAGACTATGGCTTTGAGGGACATCCTTTCCGGAAGGACTTCCCC
Equus_caballus|5167               CTAAGAAGGATCCTGACAGACTATGGCTTCGAGGGACACCCTTTCCGGAAAGACTTCCCC
Felis_catus|42678                 CTAAGGAGGATCCTGACAGACTATGGCTTTGAGGGACATCCTTTCCGGAAAGACTTTCCC
Canis_familiaris|8459             CTAAGAAGGATCCTGACAGACTATGGCTTTGAAGGACATCCTTTCCGGAAAGACTTTCCA
Spermophilus_tridecemlineatus|623 CTAAGAAGGATCCTGACAGATTATGGCTTTGAGGGACATCCTTTCCGGAAAGACTTCCCA
Erinaceus_europaeus|8157          CTGAGGAGGATCCTGACAGACTATGGCTTTGAGGGGCATCCTTTCAGAAAAGACTTCCCC
Nematostella_vectensis|3047       TTGAGGCGGATCTTGACTGATTATGGCTTTGAGGGGCATCCATTCCGCAAGGACTTTCCT
Ixodes_scapularis|10240           CTGAGGAGGATCCTGACCGACTACGGCTTCGAGGGCCACCCGTTCCGCAAGGACTTCCCG
Linepithema_humile|12923          CTTCGTAGAATTCTTACAGATTATGGCTTTGAAGGGCATCCATTAAGGAAAGATTTTCCA
Pogonomyrmex_barbatus|8503        CTCCGTAGGATTCTTACAGACTACGGTTTTGAAGGGCATCCATTGAGGAAAGATTTTCCA
Nasonia_vitripennis|16429         TTAAGGAGAATTCTGACTGATTACGGATTTGAGGGTCATCCTATGAGAAAAGATTTCCCT
Drosophila_persimilis|10001       TTGCGTCGCATTCTCACCGACTACGGCTTCGAGGGCCATCCCCAGCGCCGCGACTTCCCC
Drosophila_melanogaster|9698      TTGCGCCGCATCCTGACCGATTACGGTTTTGAGGGACATCCCCAGCGCCGCGACTTCCCG
Drosophila_sechellia|15374        TTGCGCCGCATCCTGACCGATTACGGTTTCGAGGGACACCCCCAGCGCCGCGACTTCCCG
Drosophila_simulans|7898          TTGCGTCGCATCCTGACCGATTACGGTTTTGAGGGACACCCCCAGCGCCGCGACTTCCCG
Bombyx_mori|4173                  TTAAGAAGGATTTTAACAGATTACGGTTTTGAGGGGCACCCTTTCAGGAAGGACTTCCCT
Culex_quinquefasciatus|5100       CTGCGTCGCATCCTGACCGATTACGGGTTTGAGGGACACCCGCAGCGCCGTGACTTCCCG
Daphnia_pulex|25769               TTACGACGAATTTTGACTGATTACGGATTTGAAGGCCATCCATTTCGAAAGGATTTCCCC
                                   .  .     .  .    .  .  .. ..    .            .       .     

Bombyx_mori|1472                  TTAATCGGCTACACTGAGGTTCGTTACGATGACGAGCTGAAGAAACTTGTTTATGAGCCC
Caenorhabditis_elegans|1745       CTTTCGGGATACAACGAGGTCCGCTACGATCCAGAGCTGAAGCGTGTCGTCTATGAACCA
Apis_mellifera|34131              CTCAGTGGTTTTGTAGAGGTACGCTATGATGATGAATTAAAGAGAGTTGTATGTGAACCA
Pediculus_humanus|9612            TTAAGTGGTTATGTAGAAGTTCGTTATGATGATGAAGTTCAAAGAGTTGTTTGTGAGAGT
Echinops_telfairi|14665           TTATCTGGCTACGTTGAGCTACGCTACGATGATGAAGTGAAGCGGGTGGTGGCTGAGCCG
Branchiostoma_floridae|18878      CTCAGCGGTTATGTAGAGATAAGGTATGACAATGAGCTGAAGCGGATTGTCCAGGAGCCA
Choloepus_hoffmanni|1658          NNNNNNNNNNNNNNNNNNTTACGCTACGACGACGAGGTGAAGCGGGTGGTGGCTGAGCCA
Dipodomys_ordii|10698             NNNNNNNNNNNNNNNNNNTTACGCTATGATGATGAGGTAAAGCGGGTGGTGGCCGAGCCA
Ochotona_princeps|5383            CTGTCTGGTTACGTGGAGTTGCGCTATGACGATGAGGTGAAGCGGGTGGTGGCAGAGCCT
Tursiops_truncatus|13883          CTGTCTGGCTATGTTGAGTTACGCTATGACGATGAGGTGAAGCGGGTGGTGGCCGAGCCG
Danio_rerio|29215                 TTATCTGGATATGTGGAGGTGCGCTATGATGATGAAGTGAAGCGGGTTGTGGCAGAACCT
Tetraodon_nigroviridis|14433      CTGTCTGGATACGTAGAGGTGCGCTACGACGACGAGGTGAAGCGCGTGGTGGCCGAGCCT
Gasterosteus_aculeatus|2706       CTCTCGGGATACGTGGAGGTGCGTTACGACGACGAGGTGAAGCGAGTGGTGGCGGAGCCC
Oryzias_latipes|24786             CTGTCTGGATATGTGGAGGTGCGTTACGATGACGAGTTAAAGCGTGTGGTGGCCGAGCCA
Xenopus_tropicalis|4093           CTGTCTGGATATGTGGAGGTGCGCTATGATGATGAGGTAAAGCGAGTGGTGGCAGAGCCG
Sorex_araneus|7405                TTGTCTGGCTACGTGGAGCTGCGCTATGACGATGAAGTGAAGCGCGTGGTGGCCGAGCCC
Otolemur_garnettii|12074          CTGTCTGGCTATGTTGAGTTACGCTATGATGATGAAGTGAAGCGGGTAGTAGCTGAGCCG
Dasypus_novemcinctus|7086         CTGTCTGGCTATGTTGAGTTACGCTATGACGATGAGGTGAAGCGGGTGGTGGCCGAGCCA
Tupaia_belangeri|6420             CTCTCTGGCTATGTTGAG------------------------------------------
Myotis_lucifugus|16876            CTGTCTGGCTACGTTGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|7730             CTGTCTGGCTATGTTGAG------------------------------------------
Cavia_porcellus|21637             CTGTCTGGCTATGTTGAGTTGCGCTATGATGAGGAGGTGAAGCGTGTGGTGGCCGAGCCA
Vicugna_pacos|1330                CTGTCTGGCTATGTTNNNTTACGCTATGATGATGAGGTGAAGCGGGTGGTGGCTGAACCA
Anolis_carolinensis|2777          CTGTCTGGATATGTGGAGGTTAGATATGATGATGAGGTGAAACGTGTCGTGGCTGAACCT
Gallus_gallus|16773               CTCTCTGGTTATGTAGAGGTGCGGTATGACGATGAAGTGAAACGGGTAGTGGCAGAACCT
Taeniopygia_guttata|12022         CTCTCTGGTTATGTGGAGGTA---------------------------------------
Taeniopygia_guttata|12021         CTCTCTGGTTATGTGGAGGTGCGGTATGATGATGAAGTCAAACGTGTGGTGGCAGAGCCC
Monodelphis_domestica|24637       CTCTCTGGATATGTAGAGGTCCGCTATGATGATGAGGTGAAGCGGGTTGTAGCAGAGCCA
Macropus_eugenii|12713            CTCTCTGGATATGTAGAGGTCCGCTATGATGATGAGGTGAAGAGAGTGGTGGCAGAGCCC
Ornithorhynchus_anatinus|16840    CTCTCTGGCTACGTGGAGTTGCGCTATGACGACGAAGTGAAGCGAGTGGTCGCGGAACCG
Microcebus_murinus|1163           CTATCTGGCTATGTGGAGTTACGCTATGACGATGAGGTGAAGCGGGTGGTGGCTGAGCCG
Mus_musculus|22981                CTCACTGGCTATGTTGAGCTTCGTTACGACGATGAGGTAAAGCGGGTAGTGGCTGAACCA
Rattus_norvegicus|22470           CTCACTGGCTATGTTGAGCTACGTTATGACGATGAGGTGAAGCGGGTAGTGGCTGAGCCA
Callithrix_jacchus|41072          CTATCTGGCTATGTTGAGTTACGCTATGACGATGAGGTGAAGCGAGTGGTGGCAGAGCCA
Procavia_capensis|9423            TTGTCTGGCTATGTTGAGCTACGCTATGACAACGAGGTGAAGCGGGTGGTGGCTGAGCCG
Rhesus_macaque|12579              CTATCTGGCTACGTTGAGGTACGCTATGACGATGAGGTGAAGCGGGTGGTGGCAGAGCCG
Pongo_abelii|4686                 CTATCTGGCTATGTTGAGTTACGTTATGACGATGAAGTGAAGCGGGTGGTGGCAGAGCCG
Homo_sapiens|17579                CTATCTGGCTATGTTGAGTTACGTTATGATGATGAAGTGAAGCGGGTGGTGGCAGAGCCG
Pan_troglodytes|6811              CTATCTGGCTATGTTGAGTTACGTTATGATGATGAAGTGAAGCGGGTGGTGGCAGAGCCG
Oryctolagus_cuniculus|1824        CTGTCTGGCTACGTTGAGTTGCGCTACGACGATGAGGTGAAGCGGGTGGTGGCTGAGCCG
Loxodonta_africana|10391          CTGTCTGGCTATGTTGAGCTACGCTATGACGATGAGGTGAAGCGGGTGGTGGCCGAGCCT
Sus_scrofa|9854                   CTGTCTGGCTATGTTGAGTTGCGCTACGATGATGAGGTGAAGCGGGTGGTGGCCGAGCCA
Bos_taurus|6586                   CTGTCTGGCTATGTTGAGTTACGCTATGACGATGAGGTGAAGCGGGTGGTGGCCGAGCCG
Pteropus_vampyrus|17693           CTGTCTGGCTACGTTGAGTTACGCTATGATGATGAAGTGAAACGGGTGGTGGCCGAGCCA
Equus_caballus|5167               CTGTCTGGCTACGTTGAGCTACGCTACGACGATGAGGTGAAGCGGGTGGTGGCTGAGCCG
Felis_catus|42678                 CTATCTGGCTACGTTGAGTTGCGCTATGACGATGAGGTGAAGCGGGTGGTGGCTGAGCCA
Canis_familiaris|8459             CTGTCTGGCTACGTTGAGTTACGGTATGATGATGAAGTGAAGCGGGTCGTGGCCGAGCCG
Spermophilus_tridecemlineatus|623 CTGTCTGGTTATGTTGAGTTACGCTATGATGATGAAGTAAAGCGGGTGGTGGCTGAGCCT
Erinaceus_europaeus|8157          TTGTCTGGCTATGTTGAGTTACGCTATGATGATGAAGTGAAGCGGGTGGTGGCTGAGCCA
Nematostella_vectensis|3047       GTTCAGGGATATGTTGAGGTTCGGTACGACGATGAACTGAAGCGGCTCGTGTGTGAACCG
Ixodes_scapularis|10240           CTCAGCGGTTACGTGGAAGTGCGCTACGACGACGAAGTCAAGCGGGTCGTGGTCGAGCCC
Linepithema_humile|12923          CTCAGCGGATATGTCGAGGTACGCTATGACGACGAATATAAAAGAATAGTGATTGAACCA
Pogonomyrmex_barbatus|8503        CTCAGCGGATATGTTGAGGTGCGCTATGACGACGAATATAAAAGAATAGTAATTGAACCA
Nasonia_vitripennis|16429         CTAACTGGTTATATTGAGGTTCGGTACGATGACGAGAAAAAACGAGTGGTTGCTGAACCT
Drosophila_persimilis|10001       CTGTCCGGTTACGTGGAGTTGCGCTACGATGATGAGAAGAAACGCGTTGTCTGCGAGCCC
Drosophila_melanogaster|9698      CTGTCCGGCTACGTAGAGCTGCGCTACGATGATGAGAAGAAGCGAGTCGTCTGCGAGCCC
Drosophila_sechellia|15374        CTGTCCGGCTACGTAGAGCTGCGCTACGATGATGAGAAGAAGCGCGTCGTCTGCGAGCCC
Drosophila_simulans|7898          CTGTCCGGCTACGTAGAGCTGCGCTACGATGATGAGAAGAAGCGCGTCGTCTGCGAGCCC
Bombyx_mori|4173                  CTAAGTGGATATGTAGAAGTTCGTTATGACGATGAGCAGAAGCGTGTGGTGGTCGAACCC
Culex_quinquefasciatus|5100       CTGACCGGGTACGTCGAGCTGCGGTACGACGACGAGAAGAAACGCGTCGTGTGCGAGCCG
Daphnia_pulex|25769               CTCACTGGATATGTTGAAGTACGTTACGATGATGAAGCGAAACGTGTTGTTGTTGAGCCA
                                   .    .. .     .                                            

Bombyx_mori|1472                  GTCGAGTATGCTCAAGAAATGCGCCGCTATCAACTGGAGTCTCCTTGGAATTACATGAAT
Caenorhabditis_elegans|1745       TCTGAATTGGCTCAAGAATTCCGTAAATTCGATTTGAACACTCCATGGGAGACATTCCCA
Apis_mellifera|34131              TTAGAATTAGCCCAAGAATTTCGTAAATTTGAATTATCTGCTCCATGGGAACAATTTCCA
Pediculus_humanus|9612            CTCGATAAGACGCCTGCTTTC---------------------------GAAATTTTATTT
Echinops_telfairi|14665           GTGGAGTTGGCCCAGGAGTTCCGAAAGTTCGACCTGAACAGTCCCTGGGAGGCTTTCCCT
Branchiostoma_floridae|18878      GTGGAGCTAGCACAGGAGTTCCGCAAGTTTGACCTGTCCAGCACCTGGGAGACGTTTCCA
Choloepus_hoffmanni|1658          GTGGAGTTGGCTCAAGAGTTCCGCAAGTTCGACCTGAACAGCCCCTGGGAAGCTTTCCCT
Dipodomys_ordii|10698             GTGGAGTTGGCTCAAGAGTTCCGAAAATTTGACCTGAACAGCCCCTGGGAAGCCTTCCCT
Ochotona_princeps|5383            GTGGAGTTGGCCCAAGAGTTCCGCAAGTTCGACCTGAATAGCCCCTGGGAGGCTTTCCCA
Tursiops_truncatus|13883          GTGGAGTTGGCCCAAGAGTTCCGCAGGTTTGATCTGAACAGCCCCTGGGAGACTTTCCCT
Danio_rerio|29215                 GTGGAGCTGGCTCAGGAGTTCCGTAAGTTTGACTTGAACAGTCCATGGGAAGCATTTCCT
Tetraodon_nigroviridis|14433      GTGGAGCTGTCGCAGGAGTTCAGGAAGTTCGATCTGAACACACCCTGGGAGGTTTTCCCA
Gasterosteus_aculeatus|2706       GTCGAGCTGTCGCAGGAGTTCAGGAAGTTCGACCTGAACACGCCGTGGGAGGTGTTCCCC
Oryzias_latipes|24786             GTAGAGCTTGCTCAAGAGTTCAGGAAGTTTGACCTGAACACACCCTGGGAGGTGTTTCCT
Xenopus_tropicalis|4093           GTGCAGCTGTCCCAGGAGTTCCGCAAGTTTGACCTGAGCAGCCCATGGGAAGCCTTTCCG
Sorex_araneus|7405                GTGGAGCTGGCGCAAGAGTTCCGCAAGTTTGACCTGAACAGCCCCTGGGAGGCTATCCCG
Otolemur_garnettii|12074          GTGGAGCTGGCCCAAGAGTTCCGCAAGTTTGACCTGAACAGCCCCTGGGAGGCTTTCCCT
Dasypus_novemcinctus|7086         GTGGAGTTGTCCCAAGAATTCCGCAAGTTTGATCTCAACAGCCCCTGGGAAGCTTTCCCT
Tupaia_belangeri|6420             ------------------------------------------------------------
Myotis_lucifugus|16876            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|7730             ------------------------------------------------------------
Cavia_porcellus|21637             GTGGAGCTGGCCCAGGAGTTCCGCAAGTTCGACCTGAACAGCCCGTGGGAGACTTTCCCT
Vicugna_pacos|1330                GTGGAATTGGCCCAAGAGTTCCGCAAGTTTGATCTGAACAGCCCATGGGAGGCTTTCCCT
Anolis_carolinensis|2777          GTGGAGCTGGCTCAGGAGTTCCGCAAATTCGACTTGAACAGTCCCTGGGAGACTTTTCCT
Gallus_gallus|16773               GTGGAGCTATCTCAGGAATTTCGCAAGTTTGATCTGAATAGCCCTTGGGAGGCATTTCCT
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         GTGGAGCTAGCTCAGGAGTTTCGCAAGTTCGATCTGAATAGCCCGTGGGAGGCATTTCCT
Monodelphis_domestica|24637       GTGGAACTAGCCCAGGAGTTCCGGAAGTTTGACCTGAACAGCCCCTGGGAGGCTTTCCCT
Macropus_eugenii|12713            GTGGAGCTGGCCCAGGAGTTCCGGAAGTTTGATCTGAGCAGCCCTTGGGAGACTTTCCCT
Ornithorhynchus_anatinus|16840    GTGGAGTTGGCCCAGGAGTTCCGCAAGTTCGACCTGAACAGCCCCTGGGAGGCTTTCCCT
Microcebus_murinus|1163           GTGGAGTTGTCCCAAGAGTTCCGCAAGTTTGACCTGAATAGCCCCTGGGAGGCTTTCCCT
Mus_musculus|22981                GTGGAGCTGGCACAAGAATTCCGCAAGTTTGACCTGAACAGCCCCTGGGAGGCTTTCCCT
Rattus_norvegicus|22470           GTGGAGTTGGCACAAGAGTTCCGCAAGTTTGACCTGAACAGCCCCTGGGAGGCTTTCCCT
Callithrix_jacchus|41072          GTGGAGTTGGCCCAAGAGTTCCGAAAATTTGACCTGAACAGCCCCTGGGAGGCTTTCCCA
Procavia_capensis|9423            GTGGAGCTGGCCCAAGAGTTCCGCAAGTTTGACCTGAGCAGCCCCTGGGAGGCTTTCCCT
Rhesus_macaque|12579              GTGGAGTTGGCCCAAGAGTTCCGCAAATTTGACCTGAACAGCCCCTGGGAGGCTTTCCCA
Pongo_abelii|4686                 GTGGAGTTGGCCCAAGAGTTCCGCAAATTTGACCTGAACAGCCCCTGGGAGGCTTTCCCA
Homo_sapiens|17579                GTGGAGTTGGCCCAAGAGTTCCGCAAATTTGACCTGAACAGCCCCTGGGAGGCTTTCCCA
Pan_troglodytes|6811              GTGGAGTTGGCCCAAGAGTTCCGCAAATTTGACCTGAACAGCCCCTGGGAGGCTTTCCCA
Oryctolagus_cuniculus|1824        GTGGAGTTGGCCCAAGAATTCCGCAAGTTCGACCTGAACAGCCCTTGGGAGGCTTTCCCT
Loxodonta_africana|10391          GTGGAGTTGGCGCAAGAGTTCCGCAAGTTCGACCTGAACAGCCCCTGGGAGGCATTCCCT
Sus_scrofa|9854                   GTGGAGTTGGCCCAAGAGTTCCGCAAGTTTGATCTAAACAGCCCGTGGGAGGCTTTCCCT
Bos_taurus|6586                   GTGGAGTTGGCTCAAGAGTTCCGCAAGTTTGATCTGAACAGCCCGTGGGAGGCTTTCCCT
Pteropus_vampyrus|17693           GTGGAGTTGTCCCAAGAGTTCCGCAAGTTTGACCTGAATAGTCCATGGGAGGCTTTCCCT
Equus_caballus|5167               GTGGAGCTGGCCCAAGAGTTCCGCAAGTTTGACCTGAACAGCCCGTGGGAGGCTTTCCCT
Felis_catus|42678                 GTGGAATTGGCCCAGGAGTTCCGCAAGTTTGACCTGAACAGCCCTTGGGAGGCTTTCCCT
Canis_familiaris|8459             GTCGAGTTGGCCCAGGAGTTCCGCAAGTTCGACCTGAACAGCCCGTGGGAGGCCTTCCCT
Spermophilus_tridecemlineatus|623 GTGGAGTTGGCCCAAGAGTTCCGCAAGTTTGACCTGAACAGCCCCTGGGAGGCTTTCCCT
Erinaceus_europaeus|8157          GTGGAGTTGGCCCAAGAGTTCCGCAAGTTTGACCTGAACAGCCCATGGGAGGCTTTCCCT
Nematostella_vectensis|3047       ATAGAGATGGCCCAGGAGTACCGCAAATTTGACATCAGTCCAACATGGGAACAATTCCCA
Ixodes_scapularis|10240           CTAGAGTTGACCCAGGAGTACCGAAAGTTTGACCTGGCTACGCCGTGGGAGACCTTCCCT
Linepithema_humile|12923          TTGGAATTGGCTCAGGAATTTCGTAAATTTGAACTAGCTGCTCCATGGGAACAATTCCCT
Pogonomyrmex_barbatus|8503        TTAGAATTAACTCAAGAATTCCGTAAATTTGAATTGGCTGCCCCATGGGAACAGTTTCCT
Nasonia_vitripennis|16429         CTTGAATTGGCTCAAGAATACAGGAAATTCGAGTTATCTGCACCTTGGGAACAGTTCCCA
Drosophila_persimilis|10001       CTGGAGTTGGCGCAAGAGTTCCGGAAGTTTGATTTGTCGGCCCCCTGGGAGCAGTTCCCC
Drosophila_melanogaster|9698      TTGGAGTTGGCCCAGGAGTTCAGGAAGTTTGACTTGTCGGCGCCTTGGGAACAGTTCCCC
Drosophila_sechellia|15374        TTGGAGTTGGCCCAGGAGTTCAGGAAGTTCGACTTGTCGGCGCCTTGGGAACAGTTCCCC
Drosophila_simulans|7898          TTGGAGTTGGCCCAGGAGTTCAGGAAGTTCGACTTGTCGGCGCCTTGGGAACAGTTCCCC
Bombyx_mori|4173                  CTTGAGTTGGCACAAGAGTTCAGACGCTTTGAACTGAGTGCACCATGGGAGCAGTTCCCT
Culex_quinquefasciatus|5100       CTCGAGTTGGCCCAGGAGTTCCGCAAGTTTGACCTGTCGGCGCCGTGGGAACAGTTCCCG
Daphnia_pulex|25769               GTAGAGTTGGCACAAGAATTTAGGAAATTCGACCTTTCAAGTCCGTGGGAGACGTTTCCT
                                                                                              

Bombyx_mori|1472                  AACTTTCAC---GAGGGA------TACAAC---AATCCAAAGCCAATAGATAAAAAA---
Caenorhabditis_elegans|1745       GCCTTCCGTAATCAGTCGATCACCAGTGGATACGAAACGATCCTTGAAGTTGCTGAG---
Apis_mellifera|34131              AATTTTAGAAGTATACCT------CCATCT---GATGAAAGTAAGGAAGATTCAACT---
Pediculus_humanus|9612            AGGTTTAAC------------------------ACGATGAGAATTTCT------------
Echinops_telfairi|14665           GCCTATCGC---CAGCCC------CCGGAG---AGTCTCAAGCTTGAGGCTGGAGAC---
Branchiostoma_floridae|18878      GCACACAGG---CAG---------------------------------------------
Choloepus_hoffmanni|1658          GCTTATCGC---CAGCCC------CCTGAA---AATCTCAAGATTGAGGCTGGAGAC---
Dipodomys_ordii|10698             GCCTATCGT---CAGCCC------CCTGAG---AGTCTCAAGCTTGAAGCTGGAGTC---
Ochotona_princeps|5383            GCCTATCGC---CAGCCC------CCAGAG---AGTCTCAAACTTGAAGCCGGGGAC---
Tursiops_truncatus|13883          GCTTATCGC---CAGCCC------CCTGAG---AGTCTCAGGCTTGAAGCTGGAGAC---
Danio_rerio|29215                 GCATACCGG---GAGCCT------AAAGAA---GCACCCAAGCTGGAGTCTGGGGAT---
Tetraodon_nigroviridis|14433      GCACACCGC---GAGGCC------AAAGAGGCCACCGCCAAACTGGAGGCCGGCGAG---
Gasterosteus_aculeatus|2706       GCCTACCGG---GAGCCC------AAAGAGGCCGCGCCCAAGCTGGAGGCCGGCGATGCC
Oryzias_latipes|24786             GCCTACCGA---GAGCCC------AAAGAACCTGCACCCAAACTGGAGGCTGGAGAC---
Xenopus_tropicalis|4093           GCACATCGT---CAGCAG------CCTGAA---AGCCCAAAACTGGAGCCCGGGGAA---
Sorex_araneus|7405                GCCTACCGC---CAGCCC------CCCGAC---AGCCCCAAGCTGGAAGCTGGA------
Otolemur_garnettii|12074          GCCTATCGC---CAGCCC------CCCGAG---AGTCCCAAACTTGAAGCTGGAGAC---
Dasypus_novemcinctus|7086         GCTTATCGC---CAACCT------CCTGAA---AGTCTGAAGCTTGAGGCTGGAGAC---
Tupaia_belangeri|6420             ------------------------------------------------------------
Myotis_lucifugus|16876            NNNNNNNNN---NNNNNN------NNNNNN---NNNNNNNNNNNNNNNNNNNNNNNN---
Tarsius_syrichta|7730             ------------------------------------------------------------
Cavia_porcellus|21637             GCCTACCGC---CAGCCC------CCTGCA---AGTCCCCAGCTCCAAGCCGGAGAC---
Vicugna_pacos|1330                GCCTATCGC---CAGCCC------CCTGAG---AGTCTCAAGCTTGAAGCCGGAGAC---
Anolis_carolinensis|2777          GCCTACCGT---GATGCT------CCAGAA---ACCTTGAAGATAGAACCAGGAGAG---
Gallus_gallus|16773               GCTTATCGT---GCACCT------CCAGAA---CCCCTGAAAATAGAAGCTGGAGCC---
Taeniopygia_guttata|12022         ------------------------------------------------------------
Taeniopygia_guttata|12021         GCCTATCGT---CCACCT------CCAGAA---CCCCTGAAAATAGAAGCAGGAGCC---
Monodelphis_domestica|24637       GCTTATCGC---CAGCCT------CCAGAG---AGCCCCAAACTTGAGGCTGGAGAT---
Macropus_eugenii|12713            GCTTTTCGC---CAGCCC------CCACCG---AGCCCCAGACTGGAGGCTGGAGAT---
Ornithorhynchus_anatinus|16840    GCCTACCGC---CAGGCT------GCTGAC---CAGCCCAGACTCGAGGCCGGAGAC---
Microcebus_murinus|1163           GCCTATCGC---CAGCCG------CCTGAG---AGTCTCAAACTTGAAGCTGGAGAC---
Mus_musculus|22981                GCCTATCGC---CAGCCT------CCTGAG---AGTCTCAAGCTCGAAGCTGGAGAC---
Rattus_norvegicus|22470           GCCTATCGT---CAGCCC------CCTGAG---CATCTCAAGCTTGAAGCTGGAGAC---
Callithrix_jacchus|41072          ATCTATCGC---CAACCC------CCAGAG---AGTCTCAAGCTTGAAGCGGGAGAG---
Procavia_capensis|9423            GCCTACCGC---CAGCCC------CCTGAG---AGTCTCAGGCTTGAGGCTGGAGAG---
Rhesus_macaque|12579              GTCTATCGC---CAACCC------CCGGAG---AGTCTCAAGCTTGAAGCCGGAGAT---
Pongo_abelii|4686                 GTCTATCGC---CAACCC------CCAGAG---AGTCTCAAGCTTGAAGCCGGAGAC---
Homo_sapiens|17579                GTCTATCGC---CAACCC------CCGGAG---AGTCTCAAGCTTGAAGCCGGAGAC---
Pan_troglodytes|6811              GTCTATCGC---CAACCC------CCGGAG---AGTCTCAAGCTTGAAGCCGGAGAC---
Oryctolagus_cuniculus|1824        GCCTATCGC---CAGCCT------CCTGAG---AGTCTGAAGCTTGAAGCCGGAGAC---
Loxodonta_africana|10391          GCCTACCGC---GAGCCC------CCTGAG---AGTCTCAAGCTTGAGGCTGGAGAC---
Sus_scrofa|9854                   GCCTATCGC---CAGCCC------CCTGAG---GATCTCAAGCTTGAAGCCGGAGAC---
Bos_taurus|6586                   GCCTATCGC---CAGCCC------CCCGAG---AGTCTCAAGCTTGAAGCCGGAGAC---
Pteropus_vampyrus|17693           GCCTATCGC---CAGCCT------CCTGAG---AGTCTCAAGCTGGAAGCTGGAGAC---
Equus_caballus|5167               GCCTATCGC---CAGCCC------CCCGAG---AGTCTCAAACTTGAAGCCGGAGAC---
Felis_catus|42678                 GCCTATCGG---CAGCCT------CCTGAA---AGTCTCAAGCTCGAAGCTGGGGAC---
Canis_familiaris|8459             GCCTATCGA---CAGCCC------CCCGAG---AGTCTCAAGCTTGAACCCGGAGAC---
Spermophilus_tridecemlineatus|623 GCCTATCGT---CAGCCT------CCTGAG---AATCTCAAGCTTGAAGCCGGAGGC---
Erinaceus_europaeus|8157          GCCTACCGG---CAGCCC------CCTGAA---AACCTCAAGCTTGAAGCTGGAGAG---
Nematostella_vectensis|3047       ACCTTCAGG---AAG---------------------------------------------
Ixodes_scapularis|10240           AAGTTTAGGTCCGGTGGT------GCGGCCGAGGAAGTGGCGCTGCCCAGCGGGCAG---
Linepithema_humile|12923          AATTTCAGGGATGCTCCG------CCATCT---TCTGAACCTGTCTCTAAAGAAAAG---
Pogonomyrmex_barbatus|8503        AACTTTCGG---GATGCT------CCATCA---ACTTCTAAACCTACTTCAAAGGAA---
Nasonia_vitripennis|16429         AATTTCAGA---AATGCT------TCAAAT---TCAGCAGAAGATGTACCGATCAAG---
Drosophila_persimilis|10001       AATTTCCGC---AATGCT------AATCCC---CCCGCTGAGGTGGTGCCCTCACAG---
Drosophila_melanogaster|9698      AACTTCCGCAACGCTAAT------CCCCCC---GCCGAGGTAGTTCCGCCA---------
Drosophila_sechellia|15374        AACTTCCGCAACGCTAAT------CCCCCC---GCCGAGGTCGTTCCGCCA---------
Drosophila_simulans|7898          AACTTCCGCAACGCTAAT------CCCCCC---GCCGAGGTCGTTCCGCCACAGGCT---
Bombyx_mori|4173                  AACTTTAGA---GCCAAC------CCTGTAACAGAGGAAGTAGTGAACCCGTCTGAG---
Culex_quinquefasciatus|5100       AACTTCCGCAACGCCAAT------CCGGCC---ACCGAGGAGATCGCGACC---------
Daphnia_pulex|25769               AATTTTCGG------------------------GCAGTTTCTGCTGGAACGGAAGAG---
                                                                                              

Bombyx_mori|1472                  ------AAGAAAAAT---------------------------TAA
Caenorhabditis_elegans|1745       CCAACACCAGCTACTCCACAGAACAAG---------------TAG
Apis_mellifera|34131              ---------------AAAGATAAAAAT---------------TAA
Pediculus_humanus|9612            ------------------------------------------TAG
Echinops_telfairi|14665           ---------AAAAAACCCGAAGCCAAG---------------TAG
Branchiostoma_floridae|18878      ---------------------------------------------
Choloepus_hoffmanni|1658          ---------AAGAAACCTGAAGCCAAG---------------TAG
Dipodomys_ordii|10698             ---------AAGAAACCTGAAGCCAAG---------------TAG
Ochotona_princeps|5383            ---------AAGAAGCCAGAAGCCAAG---------------TAG
Tursiops_truncatus|13883          ---------AAGAACCCCGAAACCAAG---------------TAG
Danio_rerio|29215                 ---------------AAATCAGAAAAA---------------TAA
Tetraodon_nigroviridis|14433      ------------ACCCCAGAGAAAAAG---------------TAA
Gasterosteus_aculeatus|2706       GCCGCCGCCGCCCAGCCCGACAAGAAA---------------TGA
Oryzias_latipes|24786             ---------TTGGCGCCTGACAAGAAG---------------TGA
Xenopus_tropicalis|4093           ---------ACCAAA---------------------------TAA
Sorex_araneus|7405                ---------------------------------------------
Otolemur_garnettii|12074          ---------CAGATGCCTGAAGCTAAGAAGCCCGAAGCCAAGTAG
Dasypus_novemcinctus|7086         ---------AAAAAACCTGAAGCCAAG---------------TAG
Tupaia_belangeri|6420             ---------------------------------------------
Myotis_lucifugus|16876            ---------NNNNNNNNNNNNNNNNNN---------------TAG
Tarsius_syrichta|7730             ---------------------------------------------
Cavia_porcellus|21637             ------CAGAAGAAGCCTGAAGCCAAG---------------TAA
Vicugna_pacos|1330                ---------AAAAAACCTGAAACCAAG---------------TAG
Anolis_carolinensis|2777          ---------AAGAAAGAAGATGTGAAA---------------TAG
Gallus_gallus|16773               ---------AAGAAGGAAGATGCAAAA---------------TAA
Taeniopygia_guttata|12022         ---------------------------------------------
Taeniopygia_guttata|12021         ---------AAGAAAGAAGATGCCAAA------------------
Monodelphis_domestica|24637       ---------AAGAAACCTGAAGCAAAA---------------TAG
Macropus_eugenii|12713            ---------AATAAACCCGAAGCAAAG---------------TAG
Ornithorhynchus_anatinus|16840    ---------AAGAAGCCAGAAGCCAAA---------------TAG
Microcebus_murinus|1163           ---------CAGAAGCCTGAAGCCAAGAAGCCCGAATCCAAGTAG
Mus_musculus|22981                ---------AAGAAGCCTGAAACCAAG---------------TAA
Rattus_norvegicus|22470           ---------AAGAAGCCTGAAGCCAAG---------------TAA
Callithrix_jacchus|41072          ---------AAGAAGCCTGAAGCCAAG---------------TAG
Procavia_capensis|9423            ---------AAAAAACCTGAAGCCAAG---------------TAG
Rhesus_macaque|12579              ---------AAGAAGCCTGAAGCCAAG---------------TAG
Pongo_abelii|4686                 ---------AAGAAGCCTGAAGCCAAG---------------TAG
Homo_sapiens|17579                ---------AAGAAGCCTGATGCCAAG---------------TAG
Pan_troglodytes|6811              ---------AAGAAGCCTGAAGCCAAG---------------TAG
Oryctolagus_cuniculus|1824        ---------AAGAAGCCTGAAGCCAAG---------------TAG
Loxodonta_africana|10391          ---------AAAAAACCTGAAGCAAAG---------------TAG
Sus_scrofa|9854                   ---------AAGAAACCTGAAACCAAG---------------TAG
Bos_taurus|6586                   ---------ACGAAACCTGAAGCCAAG---------------TAG
Pteropus_vampyrus|17693           ---------AAGAAACCGGAAACCAAG---------------TAG
Equus_caballus|5167               ---------AAGAAACCTGAAACCAAG---------------TAG
Felis_catus|42678                 ---------AAGAAACCTGAAACCAAG---------------TAG
Canis_familiaris|8459             ---------AAGAAACCTGAAACCAAG---------------TAG
Spermophilus_tridecemlineatus|623 ---------AAGAAGCCTGAAGCCAAA---------------TAG
Erinaceus_europaeus|8157          ------------AAAACAGAAACCAAG---------------TAG
Nematostella_vectensis|3047       ---------------------------------------------
Ixodes_scapularis|10240           ---------GAGACGCCGAAACCCGAGAAA------------TAA
Linepithema_humile|12923          ------------------------------------------TAA
Pogonomyrmex_barbatus|8503        ---------AAA------------------------------TAG
Nasonia_vitripennis|16429         ---------------GAAAATAAG---------------------
Drosophila_persimilis|10001       ---------GCCCAGCCAGCCAAGAAG---------------TAG
Drosophila_melanogaster|9698      ---------CAGGCTCCAGCCAAGAAG---------------TAA
Drosophila_sechellia|15374        ---------CAGGCTCCAGCCAAGAAG---------------TAA
Drosophila_simulans|7898          ---------------CCAGCCAAGAAG---------------TAA
Bombyx_mori|4173                  ---------GATCAACCAAAAAAA------------------TAA
Culex_quinquefasciatus|5100       ---------AAGCCGGAGGAGAAGAAG---------------TGA
Daphnia_pulex|25769               ---------GATAAAACTAAAGCCACG---------------TAA
                                                                               

multiple sequence alignment in CLUSTALW format


Bombyx_mori|3447                  ------------------------------------------------------------
Caenorhabditis_elegans|205        ------------------------------------------------------------
Apis_mellifera|5353               ------------------------------------------------------------
Pediculus_humanus|9437            ------------------------------------------------------------
Echinops_telfairi|11568           ------------------------------------------------------------
Branchiostoma_floridae|2681       ------------------------------------------------------------
Choloepus_hoffmanni|1462          ------------------------------------------------------------
Dipodomys_ordii|10039             ------------------------------------------------------------
Ochotona_princeps|4670            ------------------------------------------------------------
Tursiops_truncatus|13134          ------------------------------------------------------------
Danio_rerio|14187                 ------------------------------------------------------------
Tetraodon_nigroviridis|13814      ------------------------------------------------------------
Gasterosteus_aculeatus|22600      ------------------------------------------------------------
Oryzias_latipes|22114             ------------------------------------------------------------
Xenopus_tropicalis|4505           ------------------------------------------------------------
Sorex_araneus|6585                ------------------------------------------------------------
Otolemur_garnettii|10384          ------------------------------------------------------------
Dasypus_novemcinctus|6260         ------------------------------------------------------------
Tupaia_belangeri|5543             ------------------------------------------------------------
Myotis_lucifugus|15173            ------------------------------------------------------------
Tarsius_syrichta|7080             ------------------------------------------------------------
Cavia_porcellus|17077             ------------------------------------------------------------
Vicugna_pacos|1241                ------------------------------------------------------------
Anolis_carolinensis|1892          ------------------------------------------------------------
Gallus_gallus|10804               ------------------------------------------------------------
Taeniopygia_guttata|14165         ------------------------------------------------------------
Taeniopygia_guttata|14152         ------------------------------------------------------------
Monodelphis_domestica|13747       ------------------------------------------------------------
Macropus_eugenii|11563            ------------------------------------------------------------
Ornithorhynchus_anatinus|12662    ------------------------------------------------------------
Microcebus_murinus|992            ------------------------------------------------------------
Mus_musculus|21669                ------------------------------------------------------------
Rattus_norvegicus|13219           ------------------------------------------------------------
Callithrix_jacchus|32538          ------------------------------------------------------------
Procavia_capensis|8819            ------------------------------------------------------------
Rhesus_macaque|14962              ------------------------------------------------------------
Pongo_abelii|9808                 ------------------------------------------------------------
Homo_sapiens|28957                ------------------------------------------------------------
Pan_troglodytes|11867             ------------------------------------------------------------
Oryctolagus_cuniculus|14124       ------------------------------------------------------------
Loxodonta_africana|1277           ------------------------------------------------------------
Sus_scrofa|14003                  ------------------------------------------------------------
Bos_taurus|18487                  ------------------------------------------------------------
Pteropus_vampyrus|16675           ------------------------------------------------------------
Equus_caballus|11243              ------------------------------------------------------------
Felis_catus|8584                  ------------------------------------------------------------
Canis_familiaris|2176             ------------------------------------------------------------
Spermophilus_tridecemlineatus|567 ------------------------------------------------------------
Erinaceus_europaeus|6715          ------------------------------------------------------------
Nematostella_vectensis|10942      ------------------------------------------------------------
Ixodes_scapularis|10246           ------------------------------------------------------------
Linepithema_humile|2849           ------------------------------------------------------------
Pogonomyrmex_barbatus|6675        ------------------------------------------------------------
Nasonia_vitripennis|4550          ------------------------------------------------------------
Drosophila_persimilis|10433       ------------------------------------------------------------
Drosophila_melanogaster|8805      ------------------------------------------------------------
Drosophila_sechellia|4031         ------------------------------------------------------------
Drosophila_simulans|3658          ------------------------------------------------------------
Bombyx_mori|14483                 ------------------------------------------------------------
Culex_quinquefasciatus|12439      MASILRSLATVARSGVLAGNATVRKPDAAARADLSDFGKYVAECMPKYVQKVQLTSGDEL
Daphnia_pulex|18127               ------------------------------------------------------------
                                                                                              

Bombyx_mori|3447                  ------------------------------------------------------------
Caenorhabditis_elegans|205        ------------------------------------------------------------
Apis_mellifera|5353               ------------------------------------------------------------
Pediculus_humanus|9437            ------------------------------------------------------------
Echinops_telfairi|11568           ------------------------------------------------------------
Branchiostoma_floridae|2681       ------------------------------------------------------------
Choloepus_hoffmanni|1462          ------------------------------------------------------------
Dipodomys_ordii|10039             ------------------------------------------------------------
Ochotona_princeps|4670            ------------------------------------------------------------
Tursiops_truncatus|13134          ------------------------------------------------------------
Danio_rerio|14187                 ------------------------------------------------------------
Tetraodon_nigroviridis|13814      ------------------------------------------------------------
Gasterosteus_aculeatus|22600      ------------------------------------------------------------
Oryzias_latipes|22114             ------------------------------------------------------------
Xenopus_tropicalis|4505           ------------------------------------------------------------
Sorex_araneus|6585                ------------------------------------------------------------
Otolemur_garnettii|10384          ------------------------------------------------------------
Dasypus_novemcinctus|6260         ------------------------------------------------------------
Tupaia_belangeri|5543             ------------------------------------------------------------
Myotis_lucifugus|15173            ------------------------------------------------------------
Tarsius_syrichta|7080             ------------------------------------------------------------
Cavia_porcellus|17077             ------------------------------------------------------------
Vicugna_pacos|1241                ------------------------------------------------------------
Anolis_carolinensis|1892          ------------------------------------------------------------
Gallus_gallus|10804               ------------------------------------------------------------
Taeniopygia_guttata|14165         ------------------------------------------------------------
Taeniopygia_guttata|14152         ------------------------------------------------------------
Monodelphis_domestica|13747       ------------------------------------------------------------
Macropus_eugenii|11563            ------------------------------------------------------------
Ornithorhynchus_anatinus|12662    ------------------------------------------------------------
Microcebus_murinus|992            ------------------------------------------------------------
Mus_musculus|21669                ------------------------------------------------------------
Rattus_norvegicus|13219           ------------------------------------------------------------
Callithrix_jacchus|32538          ------------------------------------------------------------
Procavia_capensis|8819            ------------------------------------------------------------
Rhesus_macaque|14962              ------------------------------------------------------------
Pongo_abelii|9808                 ------------------------------------------------------------
Homo_sapiens|28957                ------------------------------------------------------------
Pan_troglodytes|11867             ------------------------------------------------------------
Oryctolagus_cuniculus|14124       ------------------------------------------------------------
Loxodonta_africana|1277           ------------------------------------------------------------
Sus_scrofa|14003                  ------------------------------------------------------------
Bos_taurus|18487                  ------------------------------------------------------------
Pteropus_vampyrus|16675           ------------------------------------------------------------
Equus_caballus|11243              ------------------------------------------------------------
Felis_catus|8584                  ------------------------------------------------------------
Canis_familiaris|2176             ------------------------------------------------------------
Spermophilus_tridecemlineatus|567 ------------------------------------------------------------
Erinaceus_europaeus|6715          ------------------------------------------------------------
Nematostella_vectensis|10942      ------------------------------------------------------------
Ixodes_scapularis|10246           ------------------------------------------------------------
Linepithema_humile|2849           ------------------------------------------------------------
Pogonomyrmex_barbatus|6675        ------------------------------------------------------------
Nasonia_vitripennis|4550          ------------------------------------------------------------
Drosophila_persimilis|10433       ------------------------------------------------------------
Drosophila_melanogaster|8805      ------------------------------------------------------------
Drosophila_sechellia|4031         ------------------------------------------------------------
Drosophila_simulans|3658          ------------------------------------------------------------
Bombyx_mori|14483                 ------------------------------------------------------------
Culex_quinquefasciatus|12439      EVLIAPEGVVPVLQFLKDHHQAQFANLVDIAGMDVPSRQYRFEVIYNILSLRYNSRIRVK
Daphnia_pulex|18127               ------------------------------------------------------------
                                                                                              

Bombyx_mori|3447                  ------------------------------------------------------------
Caenorhabditis_elegans|205        -----------------------------------------MDSEILNYPIHRFLDSSLL
Apis_mellifera|5353               ------------------------------------------------------------
Pediculus_humanus|9437            ------------------------------------------------------------
Echinops_telfairi|11568           ------------------------------------------------------------
Branchiostoma_floridae|2681       ------------------------------------------------------------
Choloepus_hoffmanni|1462          ------------------------------------------------------------
Dipodomys_ordii|10039             ------------------------------------------------------------
Ochotona_princeps|4670            ------------------------------------------------------------
Tursiops_truncatus|13134          ------------------------------------------------------------
Danio_rerio|14187                 ------------------------------------------------------------
Tetraodon_nigroviridis|13814      ------------------------------------------------------------
Gasterosteus_aculeatus|22600      ------------------------------------------------------------
Oryzias_latipes|22114             ------------------------------------------------------------
Xenopus_tropicalis|4505           ------------------------------------------------------------
Sorex_araneus|6585                ------------------------------------------------------------
Otolemur_garnettii|10384          ------------------------------------------------------------
Dasypus_novemcinctus|6260         ------------------------------------------------------------
Tupaia_belangeri|5543             ------------------------------------------------------------
Myotis_lucifugus|15173            ------------------------------------------------------------
Tarsius_syrichta|7080             ------------------------------------------------------------
Cavia_porcellus|17077             ------------------------------------------------------------
Vicugna_pacos|1241                ------------------------------------------------------------
Anolis_carolinensis|1892          ------------------------------------------------------------
Gallus_gallus|10804               ------------------------------------------------------------
Taeniopygia_guttata|14165         ------------------------------------------------------------
Taeniopygia_guttata|14152         ------------------------------------------------------------
Monodelphis_domestica|13747       ------------------------------------------------------------
Macropus_eugenii|11563            ------------------------------------------------------------
Ornithorhynchus_anatinus|12662    ------------------------------------------------------------
Microcebus_murinus|992            ------------------------------------------------------------
Mus_musculus|21669                ------------------------------------------------------------
Rattus_norvegicus|13219           ------------------------------------------------------------
Callithrix_jacchus|32538          ------------------------------------------------------------
Procavia_capensis|8819            ------------------------------------------------------------
Rhesus_macaque|14962              ------------------------------------------------------------
Pongo_abelii|9808                 ------------------------------------------------------------
Homo_sapiens|28957                ------------------------------------------------------------
Pan_troglodytes|11867             ------------------------------------------------------------
Oryctolagus_cuniculus|14124       ------------------------------------------------------------
Loxodonta_africana|1277           ------------------------------------------------------------
Sus_scrofa|14003                  ------------------------------------------------------------
Bos_taurus|18487                  ------------------------------------------------------------
Pteropus_vampyrus|16675           ------------------------------------------------------------
Equus_caballus|11243              ------------------------------------------------------------
Felis_catus|8584                  ------------------------------------------------------------
Canis_familiaris|2176             ------------------------------------------------------------
Spermophilus_tridecemlineatus|567 ------------------------------------------------------------
Erinaceus_europaeus|6715          ------------------------------------------------------------
Nematostella_vectensis|10942      ------------------------------------------------------------
Ixodes_scapularis|10246           ------------------------------------------------------------
Linepithema_humile|2849           ------------------------------------------------------------
Pogonomyrmex_barbatus|6675        ------------------------------------------------------------
Nasonia_vitripennis|4550          ------------------------------------------------------------
Drosophila_persimilis|10433       ------------------------------------------------------------
Drosophila_melanogaster|8805      ------------------------------------------------------------
Drosophila_sechellia|4031         ------------------------------------------------------------
Drosophila_simulans|3658          ------------------------------------------------------------
Bombyx_mori|14483                 ------------------------------------------------------------
Culex_quinquefasciatus|12439      TYTDELTPIDSCNEVFKAANWYEREIWDMYGVFFANHPDLRRILTDYGFEGHPQRRDFPL
Daphnia_pulex|18127               ------------------------------------------------------------
                                                                                              

Bombyx_mori|3447                  --------------------------------MSKLPHGNFSERRVKPYDGKQSV-----
Caenorhabditis_elegans|205        GQFIGPEGSNIYKIEKYNKVALDIWKNDEENSNVRITGPYWNLKSALNDVLELVSTIRNK
Apis_mellifera|5353               ---------------------------------MSSLLKNYWK---LMRNLPVTS-----
Pediculus_humanus|9437            ---------------------------------MASMIRGVLRN----------------
Echinops_telfairi|11568           ---------------------------------MAAAAAGLWRG--LVGATALAR-----
Branchiostoma_floridae|2681       ------------------------------------------------------------
Choloepus_hoffmanni|1462          -------------------------------MAAAAAVWGWWRG--LAGATALAR-----
Dipodomys_ordii|10039             --------------------------------MAAAAAVVWRRG--LAGAAAVAR-----
Ochotona_princeps|4670            ----------------------------------MAGLAGCWRG--LLGAATLAR-----
Tursiops_truncatus|13134          -----------------------------MAAAAAASGSELWLG--LVGSAALAR-----
Danio_rerio|14187                 --------------------------------MAASLVRFVRSG--FGRSLNVAR-----
Tetraodon_nigroviridis|13814      --------------------------------MAASLVRFVRGG--LGRSINVAR-----
Gasterosteus_aculeatus|22600      ------------------------------------------------------------
Oryzias_latipes|22114             ------------------------------------------------------------
Xenopus_tropicalis|4505           -------------------------------------------------ACAFRS-----
Sorex_araneus|6585                ---------------------------------MAAAARGWWRG--LAGAVALSR-----
Otolemur_garnettii|10384          --------------------------------MAATAARVWWRG--LVGSAALAR-----
Dasypus_novemcinctus|6260         -------------------------------MATAAATRGWWRG--LAGAAALAR-----
Tupaia_belangeri|5543             --------------------------------MAAAAARVWLRG--LVGAAALAR-----
Myotis_lucifugus|15173            ------------------------------------------------------------
Tarsius_syrichta|7080             --------------------------------MALPAARACWRR--FVGSAALAR-----
Cavia_porcellus|17077             -----------------------------PGKMAAAAARVWWRG--LVGARAVAG-----
Vicugna_pacos|1241                ---------------------------------MTSAVKGWGAK-----VQELAK-----
Anolis_carolinensis|1892          ------------------------------------------------------------
Gallus_gallus|10804               ---------------------------------AAAVQTRLAGG----------------
Taeniopygia_guttata|14165         ------------------------------------------------------------
Taeniopygia_guttata|14152         ------------------------------------------------------------
Monodelphis_domestica|13747       ---------------------------------LGAAGARAGRG--VTGAASGLP-----
Macropus_eugenii|11563            ------------------------------------------------------------
Ornithorhynchus_anatinus|12662    ---------------------------------VMAAAGGLLRGGGLLRGSGLLR-----
Microcebus_murinus|992            --------------------------------MAATAARVWWRR--LAGAAALAR-----
Mus_musculus|21669                --------------------------------MAAAAARVWCRG--LLGAASVGR-----
Rattus_norvegicus|13219           --------------------------------MASAAARVWCRG--LLGAASVAR-----
Callithrix_jacchus|32538          --------------------------------MATLATRFWWRG--IVGAAALTR-----
Procavia_capensis|8819            -----------------------------------MAAARLWRG--LLGAAAMAR-----
Rhesus_macaque|14962              -------------------------------MAAAATARLWWRG--IVGAAALTR-----
Pongo_abelii|9808                 ---------------------------------AAAVARLWWRG--ILGASALTR-----
Homo_sapiens|28957                -------------------------------MAAAAVARLWWRG--ILGASALTR-----
Pan_troglodytes|11867             -------------------------------MAAAAVARLWWRG--ILGASALTR-----
Oryctolagus_cuniculus|14124       -----------------------------PGNMAAVAARGWWRG--LVRAATLAR-----
Loxodonta_africana|1277           ---------------------------------NMAAARGWWRL--LVGTAAIAR-----
Sus_scrofa|14003                  -------------------------------MAAAAAARGCWRG--LVGPAAVAR-----
Bos_taurus|18487                  ----------------------------MAAAAVAAAARGCWQR--LVGSAAPAI-----
Pteropus_vampyrus|16675           ---------------------------------MAAVAEGLWRG--FVGAVALPR-----
Equus_caballus|11243              ------------------------------ENMAAAAARGWWRG--LVGTVALAR-----
Felis_catus|8584                  ------------------------------MAATAAAARGWWRG--LVGSVALAR-----
Canis_familiaris|2176             -------------------------------SMAAAAARGWWQG--IKGSVALAR-----
Spermophilus_tridecemlineatus|567 ----------------------------------MAAVARWWRG--LLEASAVVR-----
Erinaceus_europaeus|6715          ------------------------------------------------------------
Nematostella_vectensis|10942      ------------------------------------------------------------
Ixodes_scapularis|10246           ----------------------------------MSLLFGKVRQLARLGGAYSHR-----
Linepithema_humile|2849           ---------------------------------MTSILRNCWR---LPRNLPIAV-----
Pogonomyrmex_barbatus|6675        ---------------------------------MTSILRNCWRLSRLPVATPKCY-----
Nasonia_vitripennis|4550          --------------------------------MAFAMKNVFTAIKSLTRAAPV-------
Drosophila_persimilis|10433       -------------------------------MAAIIRTLGARAAVAVLATKHVLP-----
Drosophila_melanogaster|8805      -------------------------------MAALIRNLGARAAVAALSAKHVVP-----
Drosophila_sechellia|4031         -------------------------------MAALIRNLGARTAVAVLSAKHVVP-----
Drosophila_simulans|3658          -------------------------------MAALIRNLGARAAVAVLSAKHVVP-----
Bombyx_mori|14483                 ----------------------------MSFFLKRTIGAGNGVGRAILNSTKI-------
Culex_quinquefasciatus|12439      TGYVELRYDDEKKRVVCEPLELAQEFRKFDLSAPESAEQFYFLCRKLFGMASILRSLATV
Daphnia_pulex|18127               ------------------------------------------------------------
                                                                                              

Bombyx_mori|3447                  --------------------------------------------------------QIGN
Caenorhabditis_elegans|205        NQRYKFEMPSKDIGFLIGKNGAKINEIKLSSNVDVHFERNNENRDNGETDGRVVVSVTGN
Apis_mellifera|5353               ------------------------------------------------------------
Pediculus_humanus|9437            ------------------------------------------------------------
Echinops_telfairi|11568           --------------------------------------------------------GARR
Branchiostoma_floridae|2681       ------------------------------------------------------------
Choloepus_hoffmanni|1462          --------------------------------------------------------GAGR
Dipodomys_ordii|10039             --------------------------------------------------------GAGR
Ochotona_princeps|4670            --------------------------------------------------------GTGR
Tursiops_truncatus|13134          --------------------------------------------------------VAWR
Danio_rerio|14187                 ------------------------------------------------------------
Tetraodon_nigroviridis|13814      ------------------------------------------------------------
Gasterosteus_aculeatus|22600      ------------------------------------------------------------
Oryzias_latipes|22114             ------------------------------------------------------------
Xenopus_tropicalis|4505           ------------------------------------------------------------
Sorex_araneus|6585                --------------------------------------------------------VARR
Otolemur_garnettii|10384          --------------------------------------------------------GVGR
Dasypus_novemcinctus|6260         --------------------------------------------------------GAGR
Tupaia_belangeri|5543             --------------------------------------------------------GAGR
Myotis_lucifugus|15173            ------------------------------------------------------------
Tarsius_syrichta|7080             --------------------------------------------------------GTGR
Cavia_porcellus|17077             --------------------------------------------------------GAGR
Vicugna_pacos|1241                --------------------------------------------------------XXXX
Anolis_carolinensis|1892          ------------------------------------------------------------
Gallus_gallus|10804               ------------------------------------------------------------
Taeniopygia_guttata|14165         ------------------------------------------------------------
Taeniopygia_guttata|14152         ------------------------------------------------------------
Monodelphis_domestica|13747       --------------------------------------------------------QAAS
Macropus_eugenii|11563            ------------------------------------------------------------
Ornithorhynchus_anatinus|12662    --------------------------------------------------------GGGL
Microcebus_murinus|992            --------------------------------------------------------GAGR
Mus_musculus|21669                --------------------------------------------------------GAGR
Rattus_norvegicus|13219           --------------------------------------------------------GAGR
Callithrix_jacchus|32538          --------------------------------------------------------GAGR
Procavia_capensis|8819            --------------------------------------------------------GARP
Rhesus_macaque|14962              --------------------------------------------------------GAGR
Pongo_abelii|9808                 --------------------------------------------------------GAGR
Homo_sapiens|28957                --------------------------------------------------------GTGR
Pan_troglodytes|11867             --------------------------------------------------------GTGR
Oryctolagus_cuniculus|14124       --------------------------------------------------------GTGR
Loxodonta_africana|1277           --------------------------------------------------------GAGR
Sus_scrofa|14003                  --------------------------------------------------------VSGR
Bos_taurus|18487                  --------------------------------------------------------VAGR
Pteropus_vampyrus|16675           --------------------------------------------------------VARR
Equus_caballus|11243              --------------------------------------------------------AARR
Felis_catus|8584                  --------------------------------------------------------VAGR
Canis_familiaris|2176             ------------------------------------------------------VQVAGR
Spermophilus_tridecemlineatus|567 --------------------------------------------------------GAGR
Erinaceus_europaeus|6715          ------------------------------------------------------------
Nematostella_vectensis|10942      ------------------------------------------------------------
Ixodes_scapularis|10246           ------------------------------------------------------------
Linepithema_humile|2849           ------------------------------------------------------------
Pogonomyrmex_barbatus|6675        --------------------------------------------------------AVAS
Nasonia_vitripennis|4550          ------------------------------------------------------------
Drosophila_persimilis|10433       --------------------------------------------------------AAG-
Drosophila_melanogaster|8805      --------------------------------------------------------AAG-
Drosophila_sechellia|4031         --------------------------------------------------------AAG-
Drosophila_simulans|3658          --------------------------------------------------------AAG-
Bombyx_mori|14483                 ------------------------------------------------------------
Culex_quinquefasciatus|12439      ARSGVLA-------------------------------------------------GNGL
Daphnia_pulex|18127               ------------------------------------------------------------
                                                                                              

Bombyx_mori|3447                  --------------------------------------------PFCL--K---------
Caenorhabditis_elegans|205        YQQILIGLRLIYDRLTSKGQKTLYEDPRTRQFAESLMKMLGSVIRQAV--SRQIVRNSPI
Apis_mellifera|5353               --------------------------------------------PKCYPKLLPLTRMNT-
Pediculus_humanus|9437            --------------------------------------------------IKPFTQNKK-
Echinops_telfairi|11568           --------------------------------------------PSAL--SLP-VRTAS-
Branchiostoma_floridae|2681       ------------------------------------------------------------
Choloepus_hoffmanni|1462          --------------------------------------------PSAL--FLP-VRRES-
Dipodomys_ordii|10039             --------------------------------------------PSVL--LQR-VRRES-
Ochotona_princeps|4670            --------------------------------------------PSVR--LLP-VRKQG-
Tursiops_truncatus|13134          --------------------------------------------PLVL--LLP-VRRES-
Danio_rerio|14187                 --------------------------------------------QSAA--I---VQTRS-
Tetraodon_nigroviridis|13814      --------------------------------------------SSRV--LQQHQRLQS-
Gasterosteus_aculeatus|22600      -----------------------------------------------V--LQQQKRLQG-
Oryzias_latipes|22114             ------------------------------------------------------------
Xenopus_tropicalis|4505           ---------------------------------------------------LPQVRLEG-
Sorex_araneus|6585                --------------------------------------------PSAL--LLP-VRKES-
Otolemur_garnettii|10384          --------------------------------------------PWAL--LVP-VRRES-
Dasypus_novemcinctus|6260         --------------------------------------------PSAL--LLP-VRRES-
Tupaia_belangeri|5543             --------------------------------------------PSVL--LLP-VRKES-
Myotis_lucifugus|15173            ------------------------------------------------------------
Tarsius_syrichta|7080             --------------------------------------------PSIL--LLP-VRRES-
Cavia_porcellus|17077             --------------------------------------------PSAL--LQW-VRTES-
Vicugna_pacos|1241                --------------------------------------------XXXX--XXX-XXXXX-
Anolis_carolinensis|1892          ------------------------------------------------------------
Gallus_gallus|10804               ------------------------------------------------------------
Taeniopygia_guttata|14165         ------------------------------------------------------------
Taeniopygia_guttata|14152         ------------------------------------------------------------
Monodelphis_domestica|13747       VVVG----------------------------------------AACAGVLLP-VRKES-
Macropus_eugenii|11563            ------------------------------------------------------------
Ornithorhynchus_anatinus|12662    --------------------------------------------PSAV--LLS-TRGRT-
Microcebus_murinus|992            --------------------------------------------PWVL---LP-VRRES-
Mus_musculus|21669                --------------------------------------------PSVL--WQH-VRRES-
Rattus_norvegicus|13219           --------------------------------------------PSVL--LQQRVRRES-
Callithrix_jacchus|32538          --------------------------------------------PLVL---LP-VRRES-
Procavia_capensis|8819            --------------------------------------------PSAL---LP-VRRES-
Rhesus_macaque|14962              --------------------------------------------PSVL--LLP-VRRES-
Pongo_abelii|9808                 --------------------------------------------PSVL--LLP-VRRES-
Homo_sapiens|28957                --------------------------------------------PSVL--LLP-VRRES-
Pan_troglodytes|11867             --------------------------------------------PSVL--LLP-VRRES-
Oryctolagus_cuniculus|14124       --------------------------------------------PSVL--LLP-VRKES-
Loxodonta_africana|1277           --------------------------------------------PSAL--LLP-VRRES-
Sus_scrofa|14003                  --------------------------------------------PSVL--LLP-VRKES-
Bos_taurus|18487                  --------------------------------------------PSVL--LLP-VRRES-
Pteropus_vampyrus|16675           --------------------------------------------PSVL--LLP-MRRES-
Equus_caballus|11243              --------------------------------------------PSVL--LLP-VRTES-
Felis_catus|8584                  --------------------------------------------PSVL--LLP-VRRES-
Canis_familiaris|2176             --------------------------------------------PSVL--LLP-ARRES-
Spermophilus_tridecemlineatus|567 --------------------------------------------PSVL--LQR-VRRES-
Erinaceus_europaeus|6715          ------------------------------------------------------------
Nematostella_vectensis|10942      ------------------------------------------------------------
Ixodes_scapularis|10246           --------------------------------------------APSL--TQSFARRES-
Linepithema_humile|2849           --------------------------------------------PKSYA-VASSVRCNT-
Pogonomyrmex_barbatus|6675        --------------------------------------------LSSVRYNTTTTSDKS-
Nasonia_vitripennis|4550          --------------------------------------------PQRYISACSALRNSS-
Drosophila_persimilis|10433       --------------------------------------------TAAL--RFASTAPVD-
Drosophila_melanogaster|8805      --------------------------------------------STAL--RMASTTPVE-
Drosophila_sechellia|4031         --------------------------------------------SAAL--RMASTTPVE-
Drosophila_simulans|3658          --------------------------------------------SAAL--RMASTTPVE-
Bombyx_mori|14483                 --------------------------------------------PGVQ--RVATKSTEK-
Culex_quinquefasciatus|12439      A-------------------------------------------RSAT--VPALIRCKS-
Daphnia_pulex|18127               ------------------------------------------------------------
                                                                                              

Bombyx_mori|3447                  ---------------PVECENHTLRKHDNLRRQRLYEFGLYVAACLPKYVQKVQMQFNDQ
Caenorhabditis_elegans|205        STTAAVAQTNQTGDKKESPKKPTIWKIDEHKRERLANFGKYAAECLPKFVQKVQFAAGDE
Apis_mellifera|5353               ------------TETEKTETRPTIRKI-QTDLETIKDLGLYIAACLPKYVQKTQIVAGDE
Pediculus_humanus|9437            ---------------IFSDVRKYCQKVTE--NGKTTHFGKYVSECLPKYVQMIQMTSQGE
Echinops_telfairi|11568           ---------------GQADTRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Branchiostoma_floridae|2681       ----------------------TIRPQDEVMRNQLTVFGEYVAECLPKYVQTVQVTSQNE
Choloepus_hoffmanni|1462          ---------------AAAHMHPTVRSRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNE
Dipodomys_ordii|10039             ---------------AAADARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTCFNE
Ochotona_princeps|4670            ---------------AAADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQHVQVSCFNE
Tursiops_truncatus|13134          ---------------AAADTRPTVRPQNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNE
Danio_rerio|14187                 ---------------TTTESRPTVRPKDPVTHSQLSEFGEYVAEILPKYVQQVQVTCFNE
Tetraodon_nigroviridis|13814      ---------------SAADNQPTVRPKDAVAHNQLAAFGEYVSEMMPKYVQQVQVTCYNE
Gasterosteus_aculeatus|22600      ---------------SITETRPTVRPKDAVTHSQLAAFGEYVAEMMPKYVQQVQVTCYNE
Oryzias_latipes|22114             --------------------------------------------MMPKYVQQVQVTCFNE
Xenopus_tropicalis|4505           ---------------TTTETRPTVRPQDKVQLNQLSAFGEYVAEILPKYVQQVQVTCNGE
Sorex_araneus|6585                ---------------AAADSRPTVRPRDDVTNKQLSAF-EYVAEILP-YVQHVXXXXXXX
Otolemur_garnettii|10384          ---------------AAAETRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSCFNE
Dasypus_novemcinctus|6260         ---------------AAADTRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSCFNE
Tupaia_belangeri|5543             ---------------AAADTRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSCFNE
Myotis_lucifugus|15173            ------------------------------------------------------------
Tarsius_syrichta|7080             ---------------AAANARPTVRPQNDMAHKQLSAFGEYVAEILPKYVQQVQVSCFNE
Cavia_porcellus|17077             ---------------AAADSRPTVRPKDAVTHKQLSAFGEYVAEILPKYVQQVQVTCFNE
Vicugna_pacos|1241                ---------------XXXXXXXTVRPRNDVVHKQLSAFGEYVAEILXXXXXXXXV-CFNE
Anolis_carolinensis|1892          ----------------------TVRPKDEVTLKQLSAFGEYVAEILPKYVQQVQVTCFNE
Gallus_gallus|10804               ---------------SATETRPTVRPKNEVEQKQLCAFGEYVAEILPKYIQQVQVTCFNE
Taeniopygia_guttata|14165         ----------------------TVRPKNEVEQKQLCAFGEYVAEILPKYIQQVQVTCFNE
Taeniopygia_guttata|14152         ----------------------TVRPKNEVEQKQLCAFGEYVAEILPKYIQQVQVTCFNE
Monodelphis_domestica|13747       -------------SPAAGSQHPTVRQWDEVTHKQLSAFGEYVAEILPKYVQQVQVSYFNE
Macropus_eugenii|11563            ----------------------TVKQWDEVTHKQLSAFGEYVAEILPKYVQQVQVSCFNE
Ornithorhynchus_anatinus|12662    ---------------SAADKRPTVRSQDNVVHKQLSAFGEYVAEILPKYVQQVQVSCFNE
Microcebus_murinus|992            ---------------AAADTRPTVRPQNDVARKQLSAFGEYVAEILPKYVQQVQVCFFNE
Mus_musculus|21669                ---------------AAADKRPTVRPRSDVTHKQLSAFGEYVAEILPKYVQQVQVSCLDE
Rattus_norvegicus|13219           ---------------AAADKRPTVRPSSDVTHKRLSAFGEYVAEILPKYVQQVQVTCFDE
Callithrix_jacchus|32538          ---------------AGADTRPTVRPRNDAAHKQLSAFGEYVAEILPKYVQQVQVSLFDE
Procavia_capensis|8819            ---------------ATADTRPTVRPRNDVAHKELSAFGEYVAEILPKYVQQVQVSCFNE
Rhesus_macaque|14962              ---------------AGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNE
Pongo_abelii|9808                 ---------------AGADTRPTVRPRNDVAHQQLSAFGEYVAEILPKYVQQVQVSCFNE
Homo_sapiens|28957                ---------------AGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNE
Pan_troglodytes|11867             ---------------AGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNE
Oryctolagus_cuniculus|14124       ---------------AAADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQHVQVSCFDE
Loxodonta_africana|1277           ---------------AAADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNE
Sus_scrofa|14003                  ---------------AAADTRPTIRPRNDVVHKQLSAFGQYVAEILPKYVQQVQVSCFNE
Bos_taurus|18487                  ---------------SAADTRPTVRPRNAVAHKQLSAFGEYVAEILPKYVQQVQVSCFNE
Pteropus_vampyrus|16675           ---------------TAADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNE
Equus_caballus|11243              ---------------AAADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNE
Felis_catus|8584                  ---------------VAADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNE
Canis_familiaris|2176             ---------------AAADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNE
Spermophilus_tridecemlineatus|567 ---------------ASADTRPTVRPQNDVVHKQLSAFGEYVAEILPKYVQQVQVTCFNE
Erinaceus_europaeus|6715          ----------------------TVRLRDDVTHKQLSAFGEYVAEILPKYVQQVQVTCFSE
Nematostella_vectensis|10942      ------------------------------------------------------------
Ixodes_scapularis|10246           ----------TQATPTAEETRPAVRKPQVVQRQKLEDFGRYVAECLPKYVQKVQITQGDE
Linepithema_humile|2849           --------TTVNEETEKTETRPTVRKPSHVDVKRLRNFGSYIEDCLPKYIQQVQLTAGDE
Pogonomyrmex_barbatus|6675        ---------------EKIETRPTIRKPSHVDIDHLIQFGRYINECLPKYIQQVQLAACDE
Nasonia_vitripennis|4550          ----------GKSTEAPKDTRPTVRKIDQEKVAQLKDFGQYVAECLPKYVQKVQIEAGDE
Drosophila_persimilis|10433       ---------------AKKPEKPTVRKPDAAGRTSLSDFGRYVAECLPKYVQKVQLTAGDE
Drosophila_melanogaster|8805      ---------------PKKADKPTVRQPDAVARSHLSDFGRYVAECLPKYVQKVQLTAGDE
Drosophila_sechellia|4031         ---------------PKKADKPTVRQPDAVARSHLSDFGRYVAECLPKYVQKVQLTAGDE
Drosophila_simulans|3658          ---------------PKKADKPTVRQPDAVARSHLSDFGRYVAECLPKYVQKVQLTAGDE
Bombyx_mori|14483                 --------------TPVQETRPTVAKLDPLQKAQLVDFGKYVADCLPKYVQKVQLTAGNE
Culex_quinquefasciatus|12439      --------------EAAAESRPTVRKPDAAARADLSDFGKYVAECMPKYVQKVQLTSGDE
Daphnia_pulex|18127               -----------------------------------MDFGLYVAECMPKYVQKVQIVTGNE
                                                                                              

Bombyx_mori|3447                  LEILIVPDGLFQVLSFLRNHQHACCNQCSCVTAIDVPTRQFRFEVVYCLLSIRFGERIRV
Caenorhabditis_elegans|205        LELLIHPSGVVPVLSFLKGNHSAQFTNLTFITGMDVPTRKNRLEVIYSLYSVRFNARVRV
Apis_mellifera|5353               LEILVCPEGIIPTLKFLKLHQNTQYTSLSDITAMDVPSRQYRFEIIYNLLSITFNKRIRV
Pediculus_humanus|9437            LEILIAPEGVLPVMQFLKDHHNCQFESLVDIAGMDVPGREYRFEIIYNLLSLRYNSRVRV
Echinops_telfairi|11568           XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVYNLLSLRFNSRIRV
Branchiostoma_floridae|2681       LEVLISPEGVVPVLSFLKDHHNAQFKSLADIACVDMPTKPYRFELVYMLMSLTYNSRIRV
Choloepus_hoffmanni|1462          LEICIHPDGVIPVLTFLRDHTNAQFKSLADLTAVDVPTRQNRFEXXXXXXXXXXXXXXXX
Dipodomys_ordii|10039             LEICIHPDGIIPVLTFLRDHTNAQFKSLSDLTAVDIPTRQNRFEIVYNLLSLRFNSRVRV
Ochotona_princeps|4670            LEICIHPDGVIPVLTFLRDHTNAQFKSLADLTAVDVPTRQNRFEXXXXXXXXXXXXXXXX
Tursiops_truncatus|13134          LEICIHPDGVIPVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVYNLLSLRFNSRIRV
Danio_rerio|14187                 LEIMVHPEGIIPVLTFLKDHTNAQFRNLADLTAVDIPSKQNRFEIVYNLLSLHYNSRIRV
Tetraodon_nigroviridis|13814      LEVMIHPDGVIPVLTFLRDHTNAQFRNMIDLTAVDIPTRQNRFEIVYNLLSLRFNSRIRV
Gasterosteus_aculeatus|22600      LEMMIHPDGVIPVLTFLRDHTNTQFRNMIDLTAVDIPSRQNRFEIVYHLLSLRYNSRLRI
Oryzias_latipes|22114             LEVMIHPDGVIPVLTFLRDHTNGQFRNMVDLTAVDIPTRQNRFEIVYNLLSLRYNSRVRV
Xenopus_tropicalis|4505           LEVMVHPDGVIPVLTFLRDHTNAQFKSLADLTAVDVPAKTNRFEIVYNLLSLRFNTRMRV
Sorex_araneus|6585                XXXXXXXXXXXXVLTFLRDHTNAQFKSLADLTAVDVPTRQNRFEIVYNLLSLRFNSRIRV
Otolemur_garnettii|10384          LEICIHPDGVIPVLTFLRDHTNAQFRSLADLTAVDIPTRQNRFEIVYNLLSLRFNSRIRV
Dasypus_novemcinctus|6260         LEICIHPDGVIPVLTFLRDHTNAQFKSLADLTAVDVPTRQNRFEIVYNLLSLRFNSRIRV
Tupaia_belangeri|5543             LEICIHPDGVIPVLTFLRDHTNAQFKSLADLTAVDIPTRQNRFEIVYNLLSLRFNSRIRV
Myotis_lucifugus|15173            --------------------------------------------IVYNLLSLRFNSRIRV
Tarsius_syrichta|7080             LEICIHPDGVIPVLTFLKDHTNAQFRSLADLTAVDIPTRQNRFEIVYNLLSLRFNSRIRV
Cavia_porcellus|17077             LEVCIHPDGVIPVLTFLKDHSNAQFKSLADLTAVDIPTRQNRFEIVYNLLSLRFNSRIRV
Vicugna_pacos|1241                -EICIH-DGVIPVLT-LRDHINAQFKSLADLTAVDVPTRQNRFEIVYNLLSLRFNSRIRV
Anolis_carolinensis|1892          LEILIHPDGVIPVLTFLKDHTNAQFKSLADLTAVDVPSRQYRFEIVYNLLSLRYNSRIRV
Gallus_gallus|10804               LELLIHPDGIIPVLTFLRDHTNAQFKSLADLTAVDVPSRQYRFEIVYNLLSLRFNSRIRV
Taeniopygia_guttata|14165         LELLIHPDGIIPVLTFLRDHTNAQFKSLADLTAVDVPSRQYRFEIVYNLLSLRFNSRIRV
Taeniopygia_guttata|14152         LELLIHPDGIIPVLTFLRDHTNAQFKSLADLTAVDVPSRQYRFEIVYNLLSLRFNSRIRV
Monodelphis_domestica|13747       LEICIHPDGVIPVLTFLRDHTNAQFKSLADLGAVDVPTRQNRFEIVYNLLSLRFNSRIRV
Macropus_eugenii|11563            LEICIHPDGVIPVLTFLKDHTNAQFKSLADLGAVDVPSRQNRFEVVYNLLSLHFNTRIRV
Ornithorhynchus_anatinus|12662    LEICIHPDGVIPVLTFLKDHTNAQFKSLADLTAVDVPTRQNRFEIVYNLLSLRFNSRIRV
Microcebus_murinus|992            LEVCIHPDGVIPVLTFLRDHTNAQFKSLADLTAVDIPTRQNRFEIVYNLLSLRFNSRIRV
Mus_musculus|21669                LEICIHPDGVIPTLTFLRDHTNAQFKSLADLTAVDVPTRQNRFEIVYNLLSLRFNSRIRV
Rattus_norvegicus|13219           LEICIHPDGVIPTITFLKDHTNAQFKSLADLTAVDVPTRQNRFEIVYNLLSLRFNSRIRV
Callithrix_jacchus|32538          LEICIHPDGIIPVLTFLKDHTNAQFKSLADLTAVDIPTRQNRFEIVYNLLSLRFNSRIRV
Procavia_capensis|8819            LEICIHPDGVIPVLTFLRDHTNAQFRSLADLTAVDIPTRQNRFEIVYNLLSLHFNSRIRV
Rhesus_macaque|14962              LEVCIHPDGIIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRV
Pongo_abelii|9808                 LEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRV
Homo_sapiens|28957                LEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRV
Pan_troglodytes|11867             LEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRV
Oryctolagus_cuniculus|14124       LEICIHPDGVIPVLTFLRDHTNAQFKSLADLTAVDIPSRQNRFEIVYNLLSLRFNTRIRV
Loxodonta_africana|1277           LEICIHPDGVIPVLTFLRDHTNAQFRSLADLTAVDIPTRQNRFEIVYNLLSLHFNSRIRV
Sus_scrofa|14003                  LEIFIHPDGVIPVLTFLRDHTNAQFKSLADLTAVDVPTRQNRFEIVYNLLSLRFNSRIRV
Bos_taurus|18487                  LEICIHPDGVIPVLTFLRDHSNAQFKSLADLTAVDIPTRQNRFEIVYNLLSLRFNSRIRV
Pteropus_vampyrus|16675           LEICIHPDGVIPVLTFLRDHSNAQFKSLADLTAVDIPTRQNRFEIVYNLLSLRFNSRIRV
Equus_caballus|11243              LEICIHPDGVIPVLTFLRDHSNAQFKSLADLTAVDIPTRQNRFEIVYNLLSLRFNCRIRV
Felis_catus|8584                  LEICIHPDGVIPVLTFLRDHTNAQFKSLADLTAVDVPTRQNRFEIVYNLLSLRFNSRIHV
Canis_familiaris|2176             LEICIHPDGVIPVLTFLRDHTNAQFKSLADLTAVDIPTRQNRFEIVYNLLSLRFNSRIRV
Spermophilus_tridecemlineatus|567 LEICIHPDGVIPVLTFLRDHTNAQFKSLADLTAVDVPTRQNRFEIVYNLLSLRFNSRIRV
Erinaceus_europaeus|6715          LEICIHPDGVIPVLTFLRDHTNAQFKSLADLTAVDIPTRQNRFEIVYNLLSLRYNSRIRV
Nematostella_vectensis|10942      ----------MVFILFVKLHQ---------------------------------------
Ixodes_scapularis|10246           LEVMIAPEGVVPVLSFLKDHHNAQYANIVDIAGVDVPTRQYRFEVVYNLLSLHFNSRIRV
Linepithema_humile|2849           LELLIAPDGIIPTFTFLKDHHNTQFVSLADITALDVPSRQYRFELVYNLLSLRYNSRIRV
Pogonomyrmex_barbatus|6675        LELLIAPDGLIPTFTFLKDHHNTQFVNLSDITALDVPSRQFRFELVYNLLSLRYNSRIRV
Nasonia_vitripennis|4550          LEICIAPEGIIPTVSFLKDHHNCQFTNLSDITAVDIPSRPYRFELVYNILSIRYNTRIRV
Drosophila_persimilis|10433       LEVLIAPEGVVPVLQFLKDHHQAQFTNLIDIAGMDVPCRKHRFEVIYNLLSLRYNARIRV
Drosophila_melanogaster|8805      LEVLIAPEGVVPVLQFLKDHHQAQFTNLVDIAGVDVPCRKNRFEVVYNLLSLRYNSRIRV
Drosophila_sechellia|4031         LEVLIAPEGVVPVLQFLKDHHQAQFTNLVDIAGVDVPCRKNRFEVVYNLLSLRYNSRIRV
Drosophila_simulans|3658          LEVLIAPEGVVPVLQFLKDHHQAQFTNLVDIAGVDVPCRKNRFEVVYNLLSLRYNSRIRV
Bombyx_mori|14483                 LEVLIPPDAVIPVLSFLKDHHSAQFANLVDIAGMDVPSRSNRFEIIYNILSLRYNARIRV
Culex_quinquefasciatus|12439      LEVLIAPEGVVPVLQFLKDHHQAQFANLVDIAGMDVPSRQYRFEVIYNILSLRYNSRIRV
Daphnia_pulex|18127               LEVLIAPDGIVPVLQFLKDHHQCQFASLADIGAMDVPSRENRFEVIYNLLSLRFNSRIRV
                                                                                              

Bombyx_mori|3447                  KTYTDELTPLHSACELWQSCNWFEREVYDMFGIVFTHHPDLRRILTDYGFVGHPLRKDFP
Caenorhabditis_elegans|205        RTYTDEIAPIDSATPVFKGADWFEREVYDMYGVWFNNHPDLRRILTDYGFEGHPFRKDYP
Apis_mellifera|5353               KTYTDELTPVPSAEPIFDAANWYEREIWDMFGILFMGHTDLRRILTDYGFEGHPLRKDFP
Pediculus_humanus|9437            KTYTDELTPIDSVYEVYRAADWYEREVWDMYGVYFKNHPDLRRILTDYGFEGHPQRRDFP
Echinops_telfairi|11568           KTYTDELTPIESVVSVHKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Branchiostoma_floridae|2681       RTYTDEITPIESCYSVFKAADWYEREAWDMYGVYFSNHPDLRRILTDYGFEGHPFRKDFP
Choloepus_hoffmanni|1462          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Dipodomys_ordii|10039             KTYTDELTPLESSVSVYKASNWYEREXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Ochotona_princeps|4670            XXXXXXXXXXXXXXXXXXXXXXXXXXIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Tursiops_truncatus|13134          KTYTDELTPIESSVSVYKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Danio_rerio|14187                 KTYTDELTPLDSSVPVFQASNWYEREVWDMFGVFFTNHPDLRRILTDYGFEGHPFRKDFP
Tetraodon_nigroviridis|13814      KTYTDELTPVDSAVPVHIAANWYEREVWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Gasterosteus_aculeatus|22600      KTYTDELTPVDSAVSVHLAANWYEREVWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Oryzias_latipes|22114             KTYTDELTPLDSAVSVHVAANWYEREVWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Xenopus_tropicalis|4505           MTYTDELTPVESAVPVFEAANWYEREVWDMYGVFFANHPDLRRILTDYGFEGHPFRKDFP
Sorex_araneus|6585                KTYADELTPIDSSVPVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Otolemur_garnettii|10384          KTYTDELTPIESTVSVYKASNWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Dasypus_novemcinctus|6260         KTYTDELTPVESTVSVFKASNWYEREI-DMFGIFFANHPDLRRILTDYGFEGHPFRKDFP
Tupaia_belangeri|5543             KTYTDELTPVESAVSVHKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Myotis_lucifugus|15173            KTYTDELTPIESSVSVHKAANWYEREIWDMFGVFFANHPALRRILTDYGFKVHPFRKDFP
Tarsius_syrichta|7080             KTYTDELTPIESIVSVHKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Cavia_porcellus|17077             KTYTDELTPIESSVSVFKASIWYEREVWDMFGVFFTNHPDLRRILTDYGFEGHPFRKDFP
Vicugna_pacos|1241                KTYTDELTPIESSVSVYKAANWYEREIWDMFGVFFANHPDLRMILTDYGFEGHPFW-NFP
Anolis_carolinensis|1892          KTYTDELTPIDSVVPVHQASNWYEREVWDMYGVFFANHPDLRRILTDYGFEGHPFRKDFP
Gallus_gallus|10804               KTYTDELTPIDSAVSVHKAANWYEREVWDMYGVFFANHPDLRRILTDYGFEGHPFRKDFP
Taeniopygia_guttata|14165         KTYTDELTPIDSAVPVHKAANWYEREVWDMYGVFFANHPDLRRILTDYGFEGHPFRKDFP
Taeniopygia_guttata|14152         KTYTDELTPIDSAVPVHKAANWYEREVWDMYGVFFANHPDLRRILTDYGFEGHPFRKDFP
Monodelphis_domestica|13747       KTYADELTPVDSVVSVHKAANWYEREIWDMFGVYFANHPDLRRILTDYGFEGHPFRKDFP
Macropus_eugenii|11563            KTYTDELTPIDSAVSVHKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Ornithorhynchus_anatinus|12662    KTYTDELTPIESSVTVYKAANWYEREIWDMFGVFFFNHPDLRRILTDYGFEGHPFRKDFP
Microcebus_murinus|992            KTYTDDLTPIESIYSVFKAANWYEREIWDMFGVFFTNHPDLRRILTDYGFEGHPFRKDFP
Mus_musculus|21669                KTYADELTPIDSIVSVHIAANWYEREVWDMFGVFFFNHPDLRRILTDYGFEGHPFRKDFP
Rattus_norvegicus|13219           KTYADELTAIDSIVSVHIAANWYEREVWDMFGVFFFNHPDLRRILTDYGFEGHPFRKDFP
Callithrix_jacchus|32538          KTYTDELTPIESLTSVFKAANWYEREVWDMFGVFFVNHPDLRRILTDYGFEGHPFRKDFP
Procavia_capensis|8819            KTYTDELTPIESSVSVYKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Rhesus_macaque|14962              KTYTDELTPIESAMSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Pongo_abelii|9808                 KTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Homo_sapiens|28957                KTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Pan_troglodytes|11867             KTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Oryctolagus_cuniculus|14124       KTYTDELTPVDSAVPVHKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Loxodonta_africana|1277           KTYTDELTPIESTVSVYKAANWYEREVWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Sus_scrofa|14003                  KTYTDELTPIESSVTVYKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Bos_taurus|18487                  KTYTDELTPIESSVPVYKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Pteropus_vampyrus|16675           KTYTDELTPIESTVSVHKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Equus_caballus|11243              KTYTDELTPIESAVSVHKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Felis_catus|8584                  KTYTDELTPIESTVPVYKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Canis_familiaris|2176             KTYTDELTPIESTVSVYKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Spermophilus_tridecemlineatus|567 KTYTDELTPIESTVSVYKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Erinaceus_europaeus|6715          KTYTDELTPIDSTVPVYKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFP
Nematostella_vectensis|10942      --------------------DWICHPGWDMYGVFFSNHPDLRRILTDYGFEGHPFRKDFP
Ixodes_scapularis|10246           KTYTDELTALDSATPVYKGANWYEREVWDMFGVFFGNHPDLRRILTDYGFEGHPFRKDFP
Linepithema_humile|2849           KTYTDELTPVDSINSIFKAADWYEREVWDMFGVFFSNHPDLRRILTDYGFEGHPLRKDFP
Pogonomyrmex_barbatus|6675        KTYTDELTPVDSIYSIFKAADWYEREIWDMFGVFFSNHPDLRRILTDYGFEGHPLRKDFP
Nasonia_vitripennis|4550          KTYTDELTPVDSIYDVHKAADWYEREVWDMFGIYFAGHPDLRRILTDYGFEGHPMRKDFP
Drosophila_persimilis|10433       KTYTDELTPLDSACEVHKAANWYEREIWDMYGVFFANHPDLRRILTDYGFEGHPQRRDFP
Drosophila_melanogaster|8805      KTYTDELTPLDSACEVHKAANWYEREIWDMYGVFFANHPDLRRILTDYGFEGHPQRRDFP
Drosophila_sechellia|4031         KTYTDELTPLDSACEVHKAANWYEREIWDMYGVFFANHPDLRRILTDYGFEGHPQRRDFP
Drosophila_simulans|3658          KTYTDELTPLDSACEVHKAANWYEREIWDMYGVFFANHPDLRRILTDYGFEGHPQRRDFP
Bombyx_mori|14483                 KTYTDELTPVDSACDVFKAANWYEREIWDMYGVFFANHPDLRRILTDYGFEGHPFRKDFP
Culex_quinquefasciatus|12439      KTYTDELTPIDSCNEVFKAANWYEREIWDMYGVFFANHPDLRRILTDYGFEGHPQRRDFP
Daphnia_pulex|18127               KSYTDELTPVDSSYEVFKAADWYEREVWDMYGVFFANHPDLRRILTDYGFEGHPFRKDFP
                                                                                              

Bombyx_mori|3447                  LIGYTEVRYDDELKKLVYEPVEYAQEMRRYQLESPWNYMNNFH-EG--YN-NPKPIDKK-
Caenorhabditis_elegans|205        LSGYNEVRYDPELKRVVYEPSELAQEFRKFDLNTPWETFPAFRNQSITSGYETILEVAE-
Apis_mellifera|5353               LSGFVEVRYDDELKRVVCEPLELAQEFRKFELSAPWEQFPNFRSIP--PS-DESKEDST-
Pediculus_humanus|9437            LSGYVEVRYDDEVQRVVCESLDKTPAF---------EILFRFN--------TMRIS----
Echinops_telfairi|11568           LSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-QP--PE-SLKLEAGD-
Branchiostoma_floridae|2681       LSGYVEIRYDNELKRIVQEPVELAQEFRKFDLSSTWETFPAHR-Q---------------
Choloepus_hoffmanni|1462          XXXXXXLRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-QP--PE-NLKIEAGD-
Dipodomys_ordii|10039             XXXXXXLRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-QP--PE-SLKLEAGV-
Ochotona_princeps|4670            LSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-QP--PE-SLKLEAGD-
Tursiops_truncatus|13134          LSGYVELRYDDEVKRVVAEPVELAQEFRRFDLNSPWETFPAYR-QP--PE-SLRLEAGD-
Danio_rerio|14187                 LSGYVEVRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-EP--KE-APKLESGD-
Tetraodon_nigroviridis|13814      LSGYVEVRYDDEVKRVVAEPVELSQEFRKFDLNTPWEVFPAHR-EA--KEATAKLEAGE-
Gasterosteus_aculeatus|22600      LSGYVEVRYDDEVKRVVAEPVELSQEFRKFDLNTPWEVFPAYR-EP--KEAAPKLEAGDA
Oryzias_latipes|22114             LSGYVEVRYDDELKRVVAEPVELAQEFRKFDLNTPWEVFPAYR-EP--KEPAPKLEAGD-
Xenopus_tropicalis|4505           LSGYVEVRYDDEVKRVVAEPVQLSQEFRKFDLSSPWEAFPAHR-QQ--PE-SPKLEPGE-
Sorex_araneus|6585                LSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAIPAYR-QP--PD-SPKLEAG--
Otolemur_garnettii|10384          LSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-QP--PE-SPKLEAGD-
Dasypus_novemcinctus|6260         LSGYVELRYDDEVKRVVAEPVELSQEFRKFDLNSPWEAFPAYR-QP--PE-SLKLEAGD-
Tupaia_belangeri|5543             LSGYVE------------------------------------------------------
Myotis_lucifugus|15173            LSGYVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XX--XX-XXXXXXXX-
Tarsius_syrichta|7080             LSGYVE------------------------------------------------------
Cavia_porcellus|17077             LSGYVELRYDEEVKRVVAEPVELAQEFRKFDLNSPWETFPAYR-QP--PA-SPQLQAGD-
Vicugna_pacos|1241                LSGYVXLRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-QP--PE-SLKLEAGD-
Anolis_carolinensis|1892          LSGYVEVRYDDEVKRVVAEPVELAQEFRKFDLNSPWETFPAYR-DA--PE-TLKIEPGE-
Gallus_gallus|10804               LSGYVEVRYDDEVKRVVAEPVELSQEFRKFDLNSPWEAFPAYR-AP--PE-PLKIEAGA-
Taeniopygia_guttata|14165         LSGYVEV-----------------------------------------------------
Taeniopygia_guttata|14152         LSGYVEVRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-PP--PE-PLKIEAGA-
Monodelphis_domestica|13747       LSGYVEVRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-QP--PE-SPKLEAGD-
Macropus_eugenii|11563            LSGYVEVRYDDEVKRVVAEPVELAQEFRKFDLSSPWETFPAFR-QP--PP-SPRLEAGD-
Ornithorhynchus_anatinus|12662    LSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-QA--AD-QPRLEAGD-
Microcebus_murinus|992            LSGYVELRYDDEVKRVVAEPVELSQEFRKFDLNSPWEAFPAYR-QP--PE-SLKLEAGD-
Mus_musculus|21669                LTGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-QP--PE-SLKLEAGD-
Rattus_norvegicus|13219           LTGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-QP--PE-HLKLEAGD-
Callithrix_jacchus|32538          LSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPIYR-QP--PE-SLKLEAGE-
Procavia_capensis|8819            LSGYVELRYDNEVKRVVAEPVELAQEFRKFDLSSPWEAFPAYR-QP--PE-SLRLEAGE-
Rhesus_macaque|14962              LSGYVEVRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYR-QP--PE-SLKLEAGD-
Pongo_abelii|9808                 LSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYR-QP--PE-SLKLEAGD-
Homo_sapiens|28957                LSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYR-QP--PE-SLKLEAGD-
Pan_troglodytes|11867             LSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYR-QP--PE-SLKLEAGD-
Oryctolagus_cuniculus|14124       LSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-QP--PE-SLKLEAGD-
Loxodonta_africana|1277           LSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-EP--PE-SLKLEAGD-
Sus_scrofa|14003                  LSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-QP--PE-DLKLEAGD-
Bos_taurus|18487                  LSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-QP--PE-SLKLEAGD-
Pteropus_vampyrus|16675           LSGYVELRYDDEVKRVVAEPVELSQEFRKFDLNSPWEAFPAYR-QP--PE-SLKLEAGD-
Equus_caballus|11243              LSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-QP--PE-SLKLEAGD-
Felis_catus|8584                  LSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-QP--PE-SLKLEAGD-
Canis_familiaris|2176             LSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-QP--PE-SLKLEPGD-
Spermophilus_tridecemlineatus|567 LSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-QP--PE-NLKLEAGG-
Erinaceus_europaeus|6715          LSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYR-QP--PE-NLKLEAGE-
Nematostella_vectensis|10942      VQGYVEVRYDDELKRLVCEPIEMAQEYRKFDISPTWEQFPTFR-K---------------
Ixodes_scapularis|10246           LSGYVEVRYDDEVKRVVVEPLELTQEYRKFDLATPWETFPKFRSGG--AAEEVALPSGQ-
Linepithema_humile|2849           LSGYVEVRYDDEYKRIVIEPLELAQEFRKFELAAPWEQFPNFRDAP--PS-SEPVSKEK-
Pogonomyrmex_barbatus|6675        LSGYVEVRYDDEYKRIVIEPLELTQEFRKFELAAPWEQFPNFR-DA--PS-TSKPTSKE-
Nasonia_vitripennis|4550          LTGYIEVRYDDEKKRVVAEPLELAQEYRKFELSAPWEQFPNFR-NA--SN-SAEDVPIK-
Drosophila_persimilis|10433       LSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSAPWEQFPNFR-NA--NP-PAEVVPSQ-
Drosophila_melanogaster|8805      LSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSAPWEQFPNFRNAN--PP-AEVVPP---
Drosophila_sechellia|4031         LSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSAPWEQFPNFRNAN--PP-AEVVPP---
Drosophila_simulans|3658          LSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSAPWEQFPNFRNAN--PP-AEVVPPQA-
Bombyx_mori|14483                 LSGYVEVRYDDEQKRVVVEPLELAQEFRRFELSAPWEQFPNFR-AN--PVTEEVVNPSE-
Culex_quinquefasciatus|12439      LTGYVELRYDDEKKRVVCEPLELAQEFRKFDLSAPWEQFPNFRNAN--PA-TEEIAT---
Daphnia_pulex|18127               LTGYVEVRYDDEAKRVVVEPVELAQEFRKFDLSSPWETFPNFR--------AVSAGTEE-
                                                                                              

Bombyx_mori|3447                  --KKN---------
Caenorhabditis_elegans|205        PTPATPQNK-----
Apis_mellifera|5353               -----KDKN-----
Pediculus_humanus|9437            --------------
Echinops_telfairi|11568           ---KKPEAK-----
Branchiostoma_floridae|2681       --------------
Choloepus_hoffmanni|1462          ---KKPEAK-----
Dipodomys_ordii|10039             ---KKPEAK-----
Ochotona_princeps|4670            ---KKPEAK-----
Tursiops_truncatus|13134          ---KNPETK-----
Danio_rerio|14187                 -----KSEK-----
Tetraodon_nigroviridis|13814      ----TPEKK-----
Gasterosteus_aculeatus|22600      AAAAQPDKK-----
Oryzias_latipes|22114             ---LAPDKK-----
Xenopus_tropicalis|4505           ---TK---------
Sorex_araneus|6585                --------------
Otolemur_garnettii|10384          ---QMPEAKKPEAK
Dasypus_novemcinctus|6260         ---KKPEAK-----
Tupaia_belangeri|5543             --------------
Myotis_lucifugus|15173            ---XXXXXX-----
Tarsius_syrichta|7080             --------------
Cavia_porcellus|17077             --QKKPEAK-----
Vicugna_pacos|1241                ---KKPETK-----
Anolis_carolinensis|1892          ---KKEDVK-----
Gallus_gallus|10804               ---KKEDAK-----
Taeniopygia_guttata|14165         --------------
Taeniopygia_guttata|14152         ---KKEDAK-----
Monodelphis_domestica|13747       ---KKPEAK-----
Macropus_eugenii|11563            ---NKPEAK-----
Ornithorhynchus_anatinus|12662    ---KKPEAK-----
Microcebus_murinus|992            ---QKPEAKKPESK
Mus_musculus|21669                ---KKPETK-----
Rattus_norvegicus|13219           ---KKPEAK-----
Callithrix_jacchus|32538          ---KKPEAK-----
Procavia_capensis|8819            ---KKPEAK-----
Rhesus_macaque|14962              ---KKPEAK-----
Pongo_abelii|9808                 ---KKPEAK-----
Homo_sapiens|28957                ---KKPDAK-----
Pan_troglodytes|11867             ---KKPEAK-----
Oryctolagus_cuniculus|14124       ---KKPEAK-----
Loxodonta_africana|1277           ---KKPEAK-----
Sus_scrofa|14003                  ---KKPETK-----
Bos_taurus|18487                  ---TKPEAK-----
Pteropus_vampyrus|16675           ---KKPETK-----
Equus_caballus|11243              ---KKPETK-----
Felis_catus|8584                  ---KKPETK-----
Canis_familiaris|2176             ---KKPETK-----
Spermophilus_tridecemlineatus|567 ---KKPEAK-----
Erinaceus_europaeus|6715          ----KTETK-----
Nematostella_vectensis|10942      --------------
Ixodes_scapularis|10246           ---ETPKPEK----
Linepithema_humile|2849           --------------
Pogonomyrmex_barbatus|6675        ---K----------
Nasonia_vitripennis|4550          -----ENK------
Drosophila_persimilis|10433       ---AQPAKK-----
Drosophila_melanogaster|8805      ---QAPAKK-----
Drosophila_sechellia|4031         ---QAPAKK-----
Drosophila_simulans|3658          -----PAKK-----
Bombyx_mori|14483                 ---DQPKK------
Culex_quinquefasciatus|12439      ---KPEEKK-----
Daphnia_pulex|18127               ---DKTKAT-----