Orthologs Set ID: EOG4006DD


Orthology Database
OrthoDB4
Gene Symbol(s)
CU929328.1

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Danio rerio 9092 397, 438, 453, 476, 528
Fugu rubripes 34134 102, 336, 359, 399
Gasterosteus aculeatus 28102 102, 336, 421, 517

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Danio rerio 9092 ENSDART00000081114 ENSDARG00000058262 CU929328.1 danRer6
Fugu rubripes 34134 ENSTRUT00000031077 101077407 ENSTRUG00000012229 fr2
Gasterosteus aculeatus 28102 ENSGACT00000012721 ENSGACG00000009627 gasAcu1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Danio rerio 22599 ENSDARP00000075557 ENSDARG00000058262 CU929328.1 danRer6
Fugu rubripes 30959 ENSTRUP00000030959 101077407 ENSTRUG00000012229 fr2
Gasterosteus aculeatus 12222 ENSGACP00000012697 ENSGACG00000009627 gasAcu1

multiple sequence alignment in CLUSTALW format


Danio_rerio|9092             ------------------------------------------------------------
Gasterosteus_aculeatus|28102 CAATTTGAAGAATTTGGAATGTACCAAAACCACATCAAAGAGACCAACAACAACTGCAAC
Fugu_rubripes|34134          CAG---GAAAAGCTCATCCAAGCTATTAGAAGAATCAAACATGAGGTAGAATTGTGCAGA
                                                                                         

Danio_rerio|9092             ------------------------------------CTACAGAACAGATTTGAAAAGATT
Gasterosteus_aculeatus|28102 GAAGGCCTTGTCAGT------------------GATCACAAGAATAGTTTTGATTCACTG
Fugu_rubripes|34134          GAAGCCCAGAGGGAGACGTACGTAGAGTCAGTGGACGTGGAGAGCCATTTTGATGCCCTG
                                                                  :  ***. ..:*****: . .* 

Danio_rerio|9092             GAGCGTGAAATCAGAGCAGAATTTCAAAACCTCCATCGTTTCCTGAACGAGGAGGAGGAG
Gasterosteus_aculeatus|28102 GAACGAGAAATCAGTGCCGAGTTTGCAAACCTCCATCTTTTCCTGGACGAGGAGGAGTGT
Fugu_rubripes|34134          GAACGAGAGATCAAAGCGGAGTTTCAGAACCTCCACCGTTTCCTGGAAGAGGAGGAGTGT
                             **.**:**.****.:** **.*** ..******** * *******.*.********* . 

Danio_rerio|9092             GCAGATGTGGAGCGACTGAAGAAGGAGAGAGACAAACGAGTGAAGATCTTAAAAGACAGA
Gasterosteus_aculeatus|28102 AAGGAGATAGAGCGACTGAGGCGGGAGAAACAGAAACAACTGAAGCAGCTGAAGGAAAGA
Fugu_rubripes|34134          AAAGACCTGGAACGCTTGAGGAGGGAGGAGCAGAAACAGGTGAAGCTGCTGAAGCAGAGA
                             ...**  *.**.**. ***.*..****... * ****.. *****.:  *.**. * ***

Danio_rerio|9092             GAGAAGAAGATTGCCATGCAGGGTAGAGATCTAGAGAAAGCCATCGAGACGCTGAACTGC
Gasterosteus_aculeatus|28102 AAGAAGAAGATGGCAGAGCAAGGGAGAGACCTGGAGAGAGCAATCTCTGTGCTGAACAGC
Fugu_rubripes|34134          GAGAGGAAGATAGCGGCACAAGAGAAAGACCTGGAGAGAGCCATCACGGTGCTCAACAGC
                             .***.****** ** . .**.*. *.*** **.****.***.*** . . *** ***:**

Danio_rerio|9092             AAACTGCGAGAAGACGACAGTCCCAAACTTCTGAAG---GTGGATTTCCATTTAAAATCG
Gasterosteus_aculeatus|28102 AAACTGACTGAGGAGAACAGTCCTAAACTGATCAGAGAAATTCAAGATCTTCTAAAAAGG
Fugu_rubripes|34134          AAACTTTGTGAGGAGGACAGTCCTAAACTGCTCAAAGATATCCAAGATCTCCTAAAAAGA
                             *****   :**.** .******* ***** .* *..   .*  *: : *:  *****: .

Danio_rerio|9092             GATGAACTGACAGCCAAGGCAGTAAAAGTCTTTATCGAATGCGACAAAAACGCAAATCGG
Gasterosteus_aculeatus|28102 CAGGTTTTCTCA---------GTCAAACTTTTTTTTCTCTCCACTGTTTCCCCCCAATTA
Fugu_rubripes|34134          AAATCCTTGTCC------------------TGGGCTGTCACACATATACATGTGTCTATC
                              *     * :*.                  *      :.: . . .:: .     .:   

Danio_rerio|9092             ------------TTTGATCCTAAGTCATACTGTGAAATCAAAGAGCTTCTCAAAAGATTT
Gasterosteus_aculeatus|28102 TCAGAAGTGGACACTGAGGTGCGCTCCGGACAGTTTGTGGGGCCGATACAGTACAGGATA
Fugu_rubripes|34134          ------------ACAGACACACACAATCTTCACTTTATC---------------------
                                         : :**    .. :.     .  ::.*                      

Danio_rerio|9092             CACATTACAGTGGTGGGGATTTTGATTCATCCTAGTGATTTAACTCTTTTGACGTTTGAC
Gasterosteus_aculeatus|28102 TGGAAGCACATGAGAAGCTCCCTTTACCCA------AATATCACACCAATGACCATTGAC
Fugu_rubripes|34134          ------------------TACTTATTTCCACTTACAGATATTGCACCAGTGACCTTTGAC
                                               :   * :: *.:      .**:* .*:* : **** :*****

Danio_rerio|9092             CCTGAAACAGCACATCCCCTTCTGACCTTGTCTCCTGAGAGAACAGCAGTGACTTTCGAG
Gasterosteus_aculeatus|28102 CCCGACACAGCCCACCCTAATCTGTCGGTGTCCCAGTCTTGCACTTCAGTGTGCTTTGAG
Fugu_rubripes|34134          CCCGACACCGCCCACCCAACCCTGTCTTTCTCTGAATGCTGCGATTCTGTGTGGTTTGAA
                             ** **.**.**.** ** .  ***:*  * **  .    :*...: *:***:  ** **.

Danio_rerio|9092             GAGGGCAAGGAGACTGGGGAGAATGCGGCTGAGAGAAACCCAAAGCGCTTCCACTACTAT
Gasterosteus_aculeatus|28102 GAGGACAAGGACACA------AAGCACGTCCAGGCCAACCCACGACGGTTCCACTACTAC
Fugu_rubripes|34134          GAAGATAAGGATGTT------CAGGCCTGCCCGGCCAACCCGCGAAGGTTCCATTATTAT
                             **.*. ***** . :      .*  .     .*. .*****.....* ***** ** ** 

Danio_rerio|9092             TACTGCGTGATGGGCTCAGAGGGCTTCACTCATGGCCGCCATTACTGGGAGGTGGAGGTA
Gasterosteus_aculeatus|28102 TACTGCGTGTTGGGCCATCAGAGCTTCACCACAGGCCGGCACTACTGGGAGGTGGATGTG
Fugu_rubripes|34134          TACTGCGTGTTCGGCCATCAGGGCTTCAGCACAGGCAGGCACTACTGGGAGGTGGAGGTG
                             *********:* *** .: **.******  ..:***.* ** ************** **.

Danio_rerio|9092             AAAGGCAAGACCGCCTGGAGAGTGGGTGTGGCGAGAGCGGACGTGCACCGCGGGGAGATG
Gasterosteus_aculeatus|28102 GGACAAAAGACGGCGTGGCGGTTGGGCGTTGCACGAGGAGATGTCCCACGAGGTGAGATG
Fugu_rubripes|34134          GGGGGAAAGACGGCGTGGAGGCTGGGCGTGGCTAGAGAAGACGTCCCGAGAGGGGAGATG
                             ... ..***** ** ***.*. **** ** ** .*** .** ** *. .*.** ******

Danio_rerio|9092             GACTCTTCCTCGACGCTAAACGGACTGTGGACGTTGTCTCTCAGAAATGGCTCGATCACA
Gasterosteus_aculeatus|28102 GATGCTACTGGCGCGTCCAGTGGCCTCTGGACTCTGGCCTTGATGGGCGGATCCGTCCAA
Fugu_rubripes|34134          GCATCTACAGGCACCTCCAGTGGCTTCTGGACTCTGGCCCTGAAGGGGGGCTCTATCCTG
                             *.  **:*    .*   .*. **. * *****  ** *  * * ... **.** .**. .

Danio_rerio|9092             GCCTGCACCCACCCAAAGCCCACACCAGTGCTCTCGTACACTCCCCCAATTCGCATCGGC
Gasterosteus_aculeatus|28102 GCCTACACCGACCCGAAGCCCACCAAGGTCAACGTGTCGCTCCGGCTCGTCCGCATCGGT
Fugu_rubripes|34134          GCCTGCACCGACCCACAGCCCATGAAGGTGACCGTGTCTGCCCGGCTGGTCCGCATCGGC
                             ****.**** ****..******  ...** . *  **.    *  *  .* ******** 

Danio_rerio|9092             GTTTTCCTAGACTGTGATAATGAGGAGGTGTCTTTCTACAACGCTGTCACCATGAACCCA
Gasterosteus_aculeatus|28102 GTGTTATTAGATTGTGAAAAGGAGGAGGTGTCTTTCTATAATGCCGTTACCATGGCGCCG
Fugu_rubripes|34134          GTGTTCTTAGATTGTGAAAAGGAGGAGGTGTCTTTCTATAATGCCGTCACCATGTCACCA
                             ** **. **** *****:** ***************** ** ** ** ****** . **.

Danio_rerio|9092             CTCTTCTCCTTCTACACAGGGACTGTTTTAGTGCCACTCTATCCATTCTATAACCCGTGT
Gasterosteus_aculeatus|28102 ATCTATACCTTTACAATGGGGACGGTTGGGGTTCCCTTGTTCCCCTTCTATAATCCATGT
Fugu_rubripes|34134          ATCTACACTTTCACGATGGGAACGCTCACGGTTCCTCTGTTCCCGTATTATAACCCGTGT
                             .***: :* ** :. * .**.**  *   .** **  * *: ** *: ***** **.***

Danio_rerio|9092             GACACAGATGAAGGAAAGAACTGTGCTCCTCTTTCCATATTTCATCCATCA------
Gasterosteus_aculeatus|28102 GATGCAGATGATGGGAAGAACACAGAATCGCTTAAGATCTTTAACCCTTCA------
Fugu_rubripes|34134          GACACAGACGACGGGAGGAACACGGCTGCAATTAACATCTTCAAGCCCTCGTTATGA
                             ** .**** ** **.*.****:  *.: * .**:. **.** .* ** **.      

multiple sequence alignment in CLUSTALW format


Danio_rerio|22599            --------------------------------LQNRFEKIEREIRAEFQNLHRFLNEEEE
Gasterosteus_aculeatus|12222 QFEEFGMYQNHIKETNNNCNEGLVS------DHKNSFDSLEREISAEFANLHLFLDEEEC
Fugu_rubripes|30959          Q-EKLIQAIRRIKHEVELCREAQRETYVESVDVESHFDALEREIKAEFQNLHRFLEEEEC
                                                              :. *: :**** *** *** **:*** 

Danio_rerio|22599            ADVERLKKERDKRVKILKDREKKIAMQGRDLEKAIETLNCKLREDDSPKLLK-VDFHLKS
Gasterosteus_aculeatus|12222 KEIERLRREKQKQLKQLKERKKKMAEQGRDLERAISVLNSKLTEENSPKLIREIQDLLKR
Fugu_rubripes|30959          KDLERLRREEQKQVKLLKQRERKIAAQEKDLERAITVLNSKLCEEDSPKLLKDIQDLLKR
                              ::***::*.:*::* **:*::*:* * :***:** .**.** *::****:: ::  ** 

Danio_rerio|22599            DELTAKAVKVFIECDKNANR----FDPKSYCEIKELLKRFHITVVGILIHPSDLTLLTFD
Gasterosteus_aculeatus|12222 QVFS---VKLFFLSTVSPQLSEVDTEVRSGQFVGPIQYRIWKHMRSSLYP--NITPMTID
Fugu_rubripes|30959          KSLS------WAVTHIHVSI----TDTHNLHFI-------------YLFPLTDIAPVTFD
                             . ::      :       .      : :.   :              *    ::: :*:*

Danio_rerio|22599            PETAHPLLTLSPERTAVTFEEGKETGENAAERNPKRFHYYYCVMGSEGFTHGRHYWEVEV
Gasterosteus_aculeatus|12222 PDTAHPNLSVSQSCTSVCFEEDKDT--KHVQANPRRFHYYYCVLGHQSFTTGRHYWEVDV
Fugu_rubripes|30959          PDTAHPTLSFSECCDSVWFEEDKDV--QACPANPRRFHYYYCVFGHQGFSTGRHYWEVEV
                             *:**** *:.*    :* ***.*:.  :    **:********:* :.*: *******:*

Danio_rerio|22599            KGKTAWRVGVARADVHRGEMDSSSTLNGLWTLSLRNGSITACTHPKPTPVLSYTPPIRIG
Gasterosteus_aculeatus|12222 GQKTAWRLGVARGDVPRGEMDATGASSGLWTLALMGGSVQAYTDPKPTKVNVSLRLVRIG
Fugu_rubripes|30959          GGKTAWRLGVAREDVPRGEMASTGTSSGFWTLALKGGSILACTDPQPMKVTVSARLVRIG
                               *****:**** ** **** ::.: .*:***:* .**: * *.*:*  *      :***

Danio_rerio|22599            VFLDCDNEEVSFYNAVTMNPLFSFYTGTVLVPLYPFYNPCDTDEGKNCAPLSIFHPS-
Gasterosteus_aculeatus|12222 VLLDCEKEEVSFYNAVTMAPIYTFTMGTVGVPLFPFYNPCDADDGKNTESLKIFNPS-
Fugu_rubripes|30959          VFLDCEKEEVSFYNAVTMSPIYTFTMGTLTVPLFPYYNPCDTDDGRNTAAINIFKPSL
                             *:***::*********** *:::*  **: ***:*:*****:*:*:*  .:.**:**