Orthologs Set ID: EOG4006DF


Orthology Database
OrthoDB4
Gene Symbol(s)
RSPH9

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Anolis carolinensis 2075 233, 408, 544, 715
Bos taurus 14517 233, 408, 544, 715
Branchiostoma floridae 48500 108, 233, 408, 544, 715
Callithrix jacchus 31398 233, 408, 544, 715
Canis familiaris 3877 233, 408, 544, 715
Cavia porcellus 5786 233, 389, 408, 544, 715
Choloepus hoffmanni 7693 233, 408
Danio rerio 22509 233, 408, 544, 715
Dasypus novemcinctus 4373 233, 408, 544, 636, 715, 738, 756, 771, 812, 957, 1020
Dipodomys ordii 2417 544, 715, 812, 957, 993, 1005, 1014
Equus caballus 13635 405, 408, 544, 715
Erinaceus europaeus 6081 233, 408, 493, 646, 812, 957
Felis catus 40543 233, 408, 544, 715, 732, 738, 812, 957, 1014
Fugu rubripes 7227 233, 354, 382, 544, 715
Gallus gallus 13422 233, 400, 544, 715
Gasterosteus aculeatus 27306 233, 408, 544, 715
Gorilla gorilla 16823 227, 284, 347, 406, 408, 544, 715
Homo sapiens 73880 233, 408, 544, 715, 812
Loxodonta africana 693 233, 408, 544, 715
Macropus eugenii 14010 233, 408, 544, 715, 812, 858, 957
Microcebus murinus 5423 233, 408, 544, 715, 812
Monodelphis domestica 11253 233, 408, 544, 715
Mus musculus 17689 233, 408, 544, 715
Myotis lucifugus 17998 544, 694, 715, 735, 831, 957, 993
Nematostella vectensis 23593 233, 414, 548, 550, 639
Ochotona princeps 16778 233, 408, 465, 501, 544, 711, 924, 993, 1011
Ornithorhynchus anatinus 12977 233, 408, 544, 727, 739, 776, 830
Oryctolagus cuniculus 3583 233, 408, 544, 715
Oryzias latipes 14562 233, 408, 544, 715
Pan troglodytes 31973 186, 544, 715, 812
Pongo abelii 24761 233, 408, 544, 715
Procavia capensis 7555 233, 408, 544, 715, 735, 822, 831, 1014, 1030
Rattus norvegicus 35242 233, 408, 544, 832
Rhesus macaque 28911 233, 259, 304, 345, 405, 544, 715
Sus scrofa 17815 233, 408, 544, 715
Sus scrofa 7737 233
Taeniopygia guttata 9570 233, 408, 544, 715
Tarsius syrichta 2570 138, 233, 408, 544, 715, 812, 996, 999, 1005, 1006
Tetraodon nigroviridis 5571 233, 405, 544, 715
Tupaia belangeri 3420 69, 233, 408, 544, 715, 716, 799, 809, 812, 999, 1011
Tursiops truncatus 16281 233, 408, 499, 652, 807, 813, 1004
Xenopus tropicalis 15115 408, 544, 715

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 2075 ENSACAT00000000545 100554845 ENSACAG00000000580 RSPH9 anoCar1
Bos taurus 14517 ENSBTAT00000012563 523327 ENSBTAG00000009549 RSPH9 bosTau4
Branchiostoma floridae 48500 estExt_fgenesh2_pg.C_680024 braFlo1
Callithrix jacchus 31398 ENSCJAT00000033828 100403770 ENSCJAG00000017374 RSPH9 calJac3
Canis familiaris 3877 ENSCAFT00000038133 609573 ENSCAFG00000001924 RSPH9 canFam2
Cavia porcellus 5786 ENSCPOT00000027361 100731581 ENSCPOG00000020076 RSPH9 cavPor3
Choloepus hoffmanni 7693 ENSCHOT00000007690 ENSCHOG00000007674 RSPH9 choHof1
Danio rerio 22509 ENSDART00000010903 558005 ENSDARG00000017355 rsph9 danRer6
Dasypus novemcinctus 4373 ENSDNOT00000007094 101441710 ENSDNOG00000007094 RSPH9 dasNov2
Dipodomys ordii 2417 ENSDORT00000014581 ENSDORG00000014581 Rsph9 dipOrd1
Equus caballus 13635 ENSECAT00000000610 100067560 ENSECAG00000000696 RSPH9 equCab2
Erinaceus europaeus 6081 ENSEEUT00000005467 ENSEEUG00000005483 RSPH9 eriEur1
Felis catus 40543 ENSFCAT00000009748 101089439 ENSFCAG00000009746 RSPH9 felCat3
Fugu rubripes 7227 ENSTRUT00000038933 101072795 ENSTRUG00000015187 rsph9 fr2
Gallus gallus 13422 ENSGALT00000016754 421446 ENSGALG00000010299 RSPH9 galGal3
Gasterosteus aculeatus 27306 ENSGACT00000017695 ENSGACG00000013363 rsph9 gasAcu1
Gorilla gorilla 16823 ENSGGOT00000006326 ENSGGOG00000006299 RSPH9 gorGor3
Homo sapiens 73880 ENST00000372165 221421 ENSG00000172426 RSPH9 hg19,GRCh37
Loxodonta africana 693 ENSLAFT00000001166 100657203 ENSLAFG00000001166 RSPH9 loxAfr3
Macropus eugenii 14010 ENSMEUT00000014004 ENSMEUG00000013968 RSPH9 Meug_1.0
Microcebus murinus 5423 ENSMICT00000005055 ENSMICG00000005058 RSPH9 micMur1
Monodelphis domestica 11253 ENSMODT00000024071 100011345 ENSMODG00000018954 RSPH9 monDom5
Mus musculus 17689 ENSMUST00000024762, NM_029338 75564 ENSMUSG00000023966 Rsph9 mm9
Myotis lucifugus 17998 ENSMLUT00000017758 102426118 ENSMLUG00000017754 RSPH9 myoLuc1
Nematostella vectensis 23593 e_gw.3254.3.1 Nemve1
Ochotona princeps 16778 ENSOPRT00000007664 ENSOPRG00000007663 RSPH9 OchPri2.0
Ornithorhynchus anatinus 12977 ENSOANT00000003107 ENSOANG00000001956 RSPH9 ornAna1
Oryctolagus cuniculus 3583 ENSOCUT00000005536 100354872 ENSOCUG00000005537 RSPH9 oryCun2.0
Oryzias latipes 14562 ENSORLT00000021136 101156546 ENSORLG00000016898 rsph9 oryLat2
Pan troglodytes 31973 ENSPTRT00000046140 ENSPTRG00000018208 RSPH9 panTro2
Pongo abelii 24761 ENSPPYT00000020134 100442053 ENSPPYG00000017281 RSPH9 ponAbe2
Procavia capensis 7555 ENSPCAT00000004118 ENSPCAG00000004140 RSPH9 proCap1
Rattus norvegicus 35242 ENSRNOT00000068747, NM_001108205 316238 ENSRNOG00000019474 Rsph9 rn4
Rhesus macaque 28911 ENSMMUT00000040544 ENSMMUG00000029639 rheMac2
Sus scrofa 17815 ENSSSCT00000001888 100157153 ENSSSCG00000001691 RSPH9 susScr2
Sus scrofa 7737 ENSSSCT00000017802 100624486 ENSSSCG00000016347 susScr2
Taeniopygia guttata 9570 ENSTGUT00000008487 100223606 ENSTGUG00000008150 RSPH9 taeGut1
Tarsius syrichta 2570 ENSTSYT00000001380 ENSTSYG00000001381 RSPH9 tarSyr1
Tetraodon nigroviridis 5571 ENSTNIT00000001318 ENSTNIG00000000503 rsph9 tetNig2
Tupaia belangeri 3420 ENSTBET00000003421 ENSTBEG00000003421 RSPH9 tupBel1
Tursiops truncatus 16281 ENSTTRT00000006353 ENSTTRG00000006353 RSPH9 turTru1
Xenopus tropicalis 15115 ENSXETT00000023794 448532 ENSXETG00000010879 rsph9 xenTro2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 542 ENSACAP00000000527 100554845 ENSACAG00000000580 RSPH9 anoCar1
Bos taurus 11696 ENSBTAP00000012563 523327 ENSBTAG00000009549 RSPH9 bosTau4
Branchiostoma floridae 3845 estExt_fgenesh2_pg.C_680024 braFlo1
Callithrix jacchus 23304 ENSCJAP00000032005 100403770 ENSCJAG00000017374 RSPH9 calJac3
Canis familiaris 7966 ENSCAFP00000033809 609573 ENSCAFG00000001924 RSPH9 canFam2
Cavia porcellus 4497 ENSCPOP00000019912 100731581 ENSCPOG00000020076 RSPH9 cavPor3
Choloepus hoffmanni 6795 ENSCHOP00000006791 ENSCHOG00000007674 RSPH9 choHof1
Danio rerio 3915 ENSDARP00000017411 558005 ENSDARG00000017355 rsph9 danRer6
Dasypus novemcinctus 3855 ENSDNOP00000005495 101441710 ENSDNOG00000007094 RSPH9 dasNov2
Dipodomys ordii 2265 ENSDORP00000013714 ENSDORG00000014581 Rsph9 dipOrd1
Equus caballus 621 ENSECAP00000000479 100067560 ENSECAG00000000696 RSPH9 equCab2
Erinaceus europaeus 4993 ENSEEUP00000004976 ENSEEUG00000005483 RSPH9 eriEur1
Felis catus 6283 ENSFCAP00000009038 101089439 ENSFCAG00000009746 RSPH9 felCat3
Fugu rubripes 38794 ENSTRUP00000038794 101072795 ENSTRUG00000015187 rsph9 fr2
Gallus gallus 12587 ENSGALP00000016735 421446 ENSGALG00000010299 RSPH9 galGal3
Gasterosteus aculeatus 17039 ENSGACP00000017661 ENSGACG00000013363 rsph9 gasAcu1
Gorilla gorilla 13491 ENSGGOP00000006160 ENSGGOG00000006299 RSPH9 gorGor3
Homo sapiens 53072 ENSP00000361238 221421 ENSG00000172426 RSPH9 hg19,GRCh37
Loxodonta africana 16291 ENSLAFP00000000983 100657203 ENSLAFG00000001166 RSPH9 loxAfr3
Macropus eugenii 12743 ENSMEUP00000012736 ENSMEUG00000013968 RSPH9 Meug_1.0
Microcebus murinus 4611 ENSMICP00000004610 ENSMICG00000005058 RSPH9 micMur1
Monodelphis domestica 24408 ENSMODP00000023651 100011345 ENSMODG00000018954 RSPH9 monDom5
Mus musculus 10923 ENSMUSP00000024762 75564 ENSMUSG00000023966 Rsph9 mm9
Myotis lucifugus 16194 ENSMLUP00000016197 102426118 ENSMLUG00000017754 RSPH9 myoLuc1
Nematostella vectensis 13288 e_gw.3254.3.1 Nemve1
Ochotona princeps 14628 ENSOPRP00000007015 ENSOPRG00000007663 RSPH9 OchPri2.0
Ornithorhynchus anatinus 2861 ENSOANP00000003106 ENSOANG00000001956 RSPH9 ornAna1
Oryctolagus cuniculus 14664 ENSOCUP00000004805 100354872 ENSOCUG00000005537 RSPH9 oryCun2.0
Oryzias latipes 20306 ENSORLP00000021135 101156546 ENSORLG00000016898 rsph9 oryLat2
Pan troglodytes 24203 ENSPTRP00000040238 ENSPTRG00000018208 RSPH9 panTro2
Pongo abelii 14140 ENSPPYP00000019372 100442053 ENSPPYG00000017281 RSPH9 ponAbe2
Procavia capensis 7091 ENSPCAP00000003863 ENSPCAG00000004140 RSPH9 proCap1
Rattus norvegicus 21377 ENSRNOP00000061272 316238 ENSRNOG00000019474 Rsph9 rn4
Rhesus macaque 28426 ENSMMUP00000033600 ENSMMUG00000029639 rheMac2
Sus scrofa 17263 ENSSSCP00000017321 100624486 ENSSSCG00000016347 susScr2
Sus scrofa 1839 ENSSSCP00000001841 100157153 ENSSSCG00000001691 RSPH9 susScr2
Taeniopygia guttata 11890 ENSTGUP00000008399 100223606 ENSTGUG00000008150 RSPH9 taeGut1
Tarsius syrichta 2355 ENSTSYP00000001283 ENSTSYG00000001381 RSPH9 tarSyr1
Tetraodon nigroviridis 7250 ENSTNIP00000003358 ENSTNIG00000000503 rsph9 tetNig2
Tupaia belangeri 2966 ENSTBEP00000002966 ENSTBEG00000003421 RSPH9 tupBel1
Tursiops truncatus 15412 ENSTTRP00000006012 ENSTTRG00000006353 RSPH9 turTru1
Xenopus tropicalis 16003 ENSXETP00000023794 448532 ENSXETG00000010879 rsph9 xenTro2

multiple sequence alignment in CLUSTALW format


Danio_rerio|22509              ATGGACTCTGATTCTCTGCATTACTCCCTGGATTTAGCTGCTGCTAATGGTTTGACTCTG
Gasterosteus_aculeatus|27306   ATGGACTGCAGCTCGTCGTGCTGCTCTCTGGACCTGGTGGCCGGTAACGGGTGCACGCTG
Oryzias_latipes|14562          ATGGACTTCAACTCCCTGCCGTACTCTCTGGAATTCGTTGCCGGCAGCGGATGCATTTTA
Tetraodon_nigroviridis|5571    ATGGACTCGCAGTCGCTGCACTATTCTTTAGAACACGTTGGCAGTAGCGGATACAATTTA
Fugu_rubripes|7227             ATGGACTCAGAGTCGCTGCAATATTCTTTAGAACACGTCGCCGGTAGCGGATATAAACTA
Nematostella_vectensis|23593   ------------------------------------------------------------
Branchiostoma_floridae|48500   ATGGATTCGGAAGACCTTATCCAGTACGTGGACTTCGTGGCCAGCAGTGGCGTCGTCCTG
Gorilla_gorilla|16823          ATGGACGCCGACAGCCTCCTGCTGTCTCTGGAGCTGGCGTCCGGCAGTGGGCAGGGCCTC
Rhesus_macaque|28911           ATGGACGCCGACAGCCTCCTGCTATCTCTGGAGCTGGCGTCCGGCAGTGGGCAGGGCCTC
Microcebus_murinus|5423        ATGGACGCCGAGGGCCTCCTGCTGTCGCTGGAGCTGGCGTCGGGCAGTGGGCAAGGCCTC
Ornithorhynchus_anatinus|12977 ATGGAGGCCGAGGCGCTGCTGCTGTCGCTGGAGCTGGCGGCGGGCAGCGGGCAGGGCCTG
Tarsius_syrichta|2570          ------------------------------------------------------------
Myotis_lucifugus|17998         ------------------------------------------------------------
Homo_sapiens|73880             ATGGACGCCGACAGCCTCCTGCTGTCTCTGGAGCTGGCGTCCGGCAGTGGGCAGGGCCTC
Pan_troglodytes|31973          ATGGACGCCGACAGCCTCCTGCTGTCTCTGGAGCTGGCGTCCGGCAGTGGGCAGGGCCTC
Procavia_capensis|7555         ATGGATTGCGAGAGCCTCCTGCTGTCGCTGGAACTGGCGTCCGGCAGTGGGCTGGGCCTC
Tupaia_belangeri|3420          ATGGACGCCGAGAGCCTCCTGCTGTCTCTGGAGCTGGCATCGGGCAGCGGGCAGGGCCTC
Choloepus_hoffmanni|7693       ATGGACGCCGAGAGCCTTCTGCTGTCGCTGGAGCTGGCGTCTGGCAGTGGGCAGGGCCTC
Felis_catus|40543              ATGGACGCAGAGAGCCTCCTGCTGTCGCTAGAGCTGGCGTCCGGCAGTGGGCAGGGCCTC
Cavia_porcellus|5786           ATGGATACCGAGAGCCTGATGCTGTCGCTGGAGCTGGCTGCCGGCAGCGGGCAAGGCCTC
Macropus_eugenii|14010         ATGGACTCCGAGAGCCTGCTGCTCTCCCTGGAGCTGGCATCCGGCAGCGGGCAAGGGTTG
Ochotona_princeps|16778        ATGGACGCCGAGAGCCTCCTGCTGTCTTTGGAGCTGGCGTCGGGCAGCGGGCAGGGCCTG
Monodelphis_domestica|11253    ATGGATTCCGAAAGCCTATTGCTTTCCTTGGAGCTGGCATCAGGCAGCGGGCAGGGTTTA
Dipodomys_ordii|2417           ------------------------------------------------------------
Dasypus_novemcinctus|4373      ATGGACGCCGAGAGCCTGCTGCTGTCGCTGGAGCTGGCGTCGGGCAGCGGGCAGGGCCTC
Oryctolagus_cuniculus|3583     ATGGACGCCGAGAGCCTTCTGCTGTCGTTGGAGCTGGCGTCGGGCAGCGGGCAGGGCCTT
Loxodonta_africana|693         ATGGACTCCGAGAGCCTCCTACTGTCGCTGGAGCTGGCGTCCGGCAGTGGGCAGGGCCTC
Erinaceus_europaeus|6081       ATGGACTCCGAGAGCCTCCTTCTGTCGCTGGAGCTGGCGTCTGGCAGCGGGCAGGGCCTC
Mus_musculus|17689             ATGGACGCCGACAGCCTCTTGTTGTCTCTGGAGTTGGCGTCTGGCAGTGGGCAGGGACTC
Rattus_norvegicus|35242        ATGGACGCGGACAGCCTCTTGTTGTCGCTGGAGCTGGCATCTGGCAGTGGGCAGGGTCTC
Equus_caballus|13635           ------------------------------------------------------------
Canis_familiaris|3877          ------------------------------------------------------------
Callithrix_jacchus|31398       ATGGACGCCGAGAGCCTCCTGCTGTCGCTGGAGCTGGCGTCTGGCAGTGGGCAGGGCCTC
Pongo_abelii|24761             ATGGACGCCGACAGCCTCCTGCTGTCTCTGGAGCTGGCGTCCGGCAGTGGGCAGGGCCTC
Tursiops_truncatus|16281       ATGGACGAAGAGAGCCTCCTATTGTCTCTGGAGCTGGCGTCCGGTAGTGGGCAGGGCCTC
Bos_taurus|14517               ATGGACGCAGAAAGCCTCTTGCTGGCCCTGGAGTTGGCGTCTGGCAGTGGGCAGGGCCTT
Sus_scrofa|17815               ATGGACTCGGAGAGCCTCCTGCTATCGCTGGAGCTGGCGTCGGGCAGTGGGCAGGGTCTC
Sus_scrofa|7737                ATGGACTCGGAGAGCCTCCTGCTATCGCTGGAGCTGGCGTCGGGCAGTGGGCAGGGTCTC
Xenopus_tropicalis|15115       ------------------------------------------------------------
Anolis_carolinensis|2075       ATGGACGCGGAGGCGCTGCCTTACGCGCTGGACCTTGTGGCGAGCAGCGGCGTGTGCCTC
Gallus_gallus|13422            ATGGAGCCGGCCGCGCTGCCCACCGCGCTGCAGCTGGCGGCCAGCGGGGACACGGGGCTG
Taeniopygia_guttata|9570       ATGGAGGCGCTGTCGCTGCCCGCGGCCCTGGCGCTGGTGGCCGGCGGCGGCGCGGGGCTC
                                                                                           

Danio_rerio|22509              AGCAGTGAACAGAGAGCCGCTCTTCAATCCTCTCTGCTCATAGTCAAGAGAAACTACAAA
Gasterosteus_aculeatus|27306   AGCGTGGAGCACAGAGCCGCCCTGCAGACCTCCATGGTGCTGCTGAAGAAGAACTACAAG
Oryzias_latipes|14562          ACCCTTGAGGAAAGAACAGCTCTGCAGACATCTTTGGTCATTGTCAAAACGAACTACAAG
Tetraodon_nigroviridis|5571    AACATTGAACAACGAGCAGCTTTGCAGTCTTCTCTTTTAATCCTGAAGAAAAACTACAAA
Fugu_rubripes|7227             AATATTGAACAACAAGCCGCTTTGCAGACTTCTATTTTAATCATGAAGAAAAACTACAAA
Nematostella_vectensis|23593   ---------------------------------------------------AACTACAAA
Branchiostoma_floridae|48500   AGCTCCGAGCAGAAGGCGGCACTTCAGACATCCCTTGTCATCATGAAGAACCACTACAAG
Gorilla_gorilla|16823          AGCCCGGACCGTCGGGCCTCGCTGCTCACGTCTCTTATGCTGGTTAAGCGCGACTACCGC
Rhesus_macaque|28911           AGCCCGGACCGTCGGGCCTCGCTGCTCACGTCTCTTATGCTGGTTAAGCGCGACTACCGC
Microcebus_murinus|5423        GGCCCGGACCGTCGGGCCTCGCTGCTCACTTCCCTTATGCTGGTTAAGCGCGACTACCGC
Ornithorhynchus_anatinus|12977 AGCCCCGACCGGAGGGCGGCCCTGCTCACCTCCCTGCTCATCCTGCGCCGCGACTACCGC
Tarsius_syrichta|2570          ------------------------------------------------------------
Myotis_lucifugus|17998         ------------------------------------------------------------
Homo_sapiens|73880             AGCCCGGACCGTCGGGCCTCGCTGCTCACGTCTCTTATGCTGGTTAAGCGCGACTACCGC
Pan_troglodytes|31973          AGCCCGGACCGTCGGGCCTCGCTGCTCACGTCTCTTATGCTGGTTAAGCGCGACTACCGC
Procavia_capensis|7555         AGTCCCGACCGCCGGGCCTCCCTGCTCACTTCCCTCATGCTGGTGAAACGCGACTACCGC
Tupaia_belangeri|3420          AGTCCGGAC---CGGGTCTCGCTGCTCACCTCCCTCATGCTGGTTAAGCGCGACTACCGC
Choloepus_hoffmanni|7693       AGCCCAGACCGTCGGGCCTCGCTGCTCACGTCCCTGATGCTGGTTAAGCGCGACTACCGC
Felis_catus|40543              AGCCCGGACCGTCGGGCCTCTCTACTTACCTCTCTTCCGCTGGTGAAACGCGACTACCGC
Cavia_porcellus|5786           AGTCCCGACCGGCGGGCTGCGCTGCTCACCTCGCTGCTGCTCGTGAAGCGCGACTACCGC
Macropus_eugenii|14010         AGCCCCGATCGTCGGGCTTCGCTGCTCACCTCCCTGCTTCTCGTGAAGCGCGACTACCGC
Ochotona_princeps|16778        AGCCCGGACCGTCGGGCCTCCCTGCTCACTTCCCTGACCCTGGTGAAGCGCGACTACCGC
Monodelphis_domestica|11253    AGCCCAGACCGTCGGGCCTCGCTGCTCACGTCCCTGCTTCTCGTTAAACGCGACTACCGC
Dipodomys_ordii|2417           ------------------------------------------------------------
Dasypus_novemcinctus|4373      AGCCCCGACCGCCGGGCCTCGCTGCTCACGTCCCTCATGCTGGTGAAGCGCGACTACCGC
Oryctolagus_cuniculus|3583     AGCCCGGACCGTCGGGCCTCGCTGCTCACTTCCCTGACGCTGGTGAAGCGCGACTACCGC
Loxodonta_africana|693         AGCCCCGACCGCCGGGCCTCCCTGCTCACTTCCCTCCTGCTGGTTAAACGCGACTACCGC
Erinaceus_europaeus|6081       AGCCCCGACCGGCGGGCCTCGCTGCTCACCTCCCTCACGCTGGTGAAGCGCGACTACCGC
Mus_musculus|17689             AGCCCTGACCGTCGGGCCTCACTGCTCACGTCCCTTATGCTGGTGAAGCGCGATTACCGC
Rattus_norvegicus|35242        AGCCCGGACCGTCGGGCCTCGCTGCTCACGTCCCTTATGCTGGTTAAACGGGATTACCGC
Equus_caballus|13635           ------------------------------------------------------------
Canis_familiaris|3877          ------------------------------------------------------------
Callithrix_jacchus|31398       AGCCCGGACCGTCGGGCCTCGCTGCTCACGTCTCTTTTGCTGGTTAAGCGCGACTACCGC
Pongo_abelii|24761             AGCCCGGACCGTCGGGCCTCGCTGCTCACGTCTCTTATGCTGGTTAAGCGCGACTACCGC
Tursiops_truncatus|16281       AGCCCGGACCGTCGGGCCTCACTGCTCACTTCCCTTATGCTGGTTAAACGCGACTACCGT
Bos_taurus|14517               AGCCCGGACCGTCGGGCCTCGCTACTCACTTCTCTCATGCTGGTTAAACGTGACTACCGC
Sus_scrofa|17815               AGCCCAGACCGTCGGGCCTCTCTGCTCACCTCCCTTACGCTGGTTAAACGCGACTACCGT
Sus_scrofa|7737                AGCCCAGACCGTCGGGCCTCTCTGCTCACCTCCCTTACGCTGGTTAAACGCGACTACCGT
Xenopus_tropicalis|15115       ------------------------------------------------------------
Anolis_carolinensis|2075       AGCCCGGAGAAGCGGGCGGCCCTGCGGAACTCGCTCCTGCTGGTACGCCGCGACTACCGC
Gallus_gallus|13422            AGCCTGGAGAAGCGGGCGGCGCTGGGGGCTTCGCTGCTGCTCCTGCAGCGCGACTATCGC
Taeniopygia_guttata|9570       AGCCCGGAGCGGCGGGCGGCGCTGGGCGCCTCGCTGCCGCTGGTGCAGCGCGATTACCGC
                                                                                           

Danio_rerio|22509              TTCAGCCGGGTTTTGTTTTGGGGAAAGATTTTGGGAATAAAAAGTGACTATTTTATTGCA
Gasterosteus_aculeatus|27306   TTCCAGCGAGTTCTGCTCTGGGGCAAAATATTCGGATTGAATAGGGACTATTTCATCGCC
Oryzias_latipes|14562          TTCCAGCGAATTTTGTTTTGGGGCAAAATCCTGGGACTACAACATGACTACTTTGTCGCT
Tetraodon_nigroviridis|5571    TTCCATCGAATTCTGTTTTGGGGCAAAATATTGTGTTTAAAAGAGGATTACTTTATTGCT
Fugu_rubripes|7227             TTCCAGCGAGTCCTGTTTTGGGGCAAAATATTGAGTTTAAAAGAGGAATATTTTATCGCc
Nematostella_vectensis|23593   TTTGAGAAAGTGCGATACTGGGGTAAAATACTCGGTGTAAAGAATGACTATTTTATCATA
Branchiostoma_floridae|48500   TTCCACCGGGTTTACCTTTGGGGGAAGATCCTTGGCATCAAGGATGACTACTTCATCGCA
Gorilla_gorilla|16823          TATGATCGGGTTCTCTTCTGGGGCCGCATCCTTGGCCTCGTCGCCGATTACTACATCGCG
Rhesus_macaque|28911           TACGATCGGGTTCTCTTCTGGGGCCGCATCCTTGGCCTCGTCGCCGATTACTACATCGCG
Microcebus_murinus|5423        TATGATCGGGTCCTTTTCTGGGGCCGCATCCTCGGCCTGGTCTCCGATTACTACATCGCA
Ornithorhynchus_anatinus|12977 TACCGGCGCGTCCTCTTCTGGGGCCGCATCCTCGGCCTCACCGCCGACTACTACATCGCC
Tarsius_syrichta|2570          ------CGGGTCCTCTTACAAATATGCATCCTCGGGCTCGTCGGCGATCATTTCATCTCG
Myotis_lucifugus|17998         ------------------------------------------------------------
Homo_sapiens|73880             TATGATCGGGTTCTCTTCTGGGGCCGCATCCTTGGCCTCGTCGCCGATTACTACATCGCG
Pan_troglodytes|31973          TATGATCGGGTTCTCTTCTGGGGCCGCATCCTTGGCCTCGTCGCCGATTACTACATCGCG
Procavia_capensis|7555         TACGACCGGGTCCTCTTCTGGGGCCGCATCCTTGGCCTTGTCGCCGACTACTACATCGCG
Tupaia_belangeri|3420          TACGACCGAGTCCTCTTCTGGGGCCGCATCCTCGGCCTCGTCGCCGACTACTACATCGCG
Choloepus_hoffmanni|7693       TATGATCGCGTGCTTTTCTGGGGCCGCATCCTCGGCCTAGTGGCCGATTACTACATCGCG
Felis_catus|40543              TATGATCGGGTCCTCTTCTGGGGCCGCATCCTCGGCCTTGTCGCGGATTATTACATCGCG
Cavia_porcellus|5786           TACAACCGCGTTCTCTTCTGGGGCCGCATCCTCGGGATCGTGGCCGACTACTACATCGCG
Macropus_eugenii|14010         TACGAGCGGGTGCTGTTCTGGGGCCGGATCCTCGGCCTGGTCGCTGACTACTACATCGCG
Ochotona_princeps|16778        TACAGCCGAGTGCTCTTCTGGGGCCGAATCCTCGGCGTCGTCGCAGATTACTATATCGCG
Monodelphis_domestica|11253    TACGATCGGGTGCTGTTCTGGGGCAGGATCCTCGGCCTGGTCGCTGACTACTACATCGCA
Dipodomys_ordii|2417           ------------------------------------------------------------
Dasypus_novemcinctus|4373      TACGACCGCGTGCTCTTCTGGGGCCGCATCCTCGGCCTGGTCGCCGATTACTACATCGCG
Oryctolagus_cuniculus|3583     TACAATCGAGTCCTCTTCTGGGGCCGCATCCTCGGCGTTGTCGCCGATTACTACATCGCG
Loxodonta_africana|693         TACGACCGGATCCTCTTCTGGGGCCGCATCCTCGGCCTGGTCGCCGATTACTACATCGCG
Erinaceus_europaeus|6081       TACGACCGGGTGCTCTTCTGGGGCCGCATCCTCGGCATCGTGGCCGATTACTACATCGCG
Mus_musculus|17689             TTCGCGAGGGTCCTTTTCTGGGGCCGCATCCTTGGCCTTGTGGCGGATTACTACATCGCA
Rattus_norvegicus|35242        TTCGCGCGGGTCCTCTTCTGGGGCCGCATCCTCGGCCTTGTCGCAGATTACTACATCGCA
Equus_caballus|13635           ------------------------------------------------------------
Canis_familiaris|3877          ------------------------------------------------------------
Callithrix_jacchus|31398       TACGATCGGGTTCTCTTCTGGGGCCGCATTCTCGGCCTGGTCGCCGATTACTACATCGCG
Pongo_abelii|24761             TATGATCGGGTTCTCTTCTGGGGCCGCATCCTTGGCCTCGTCGCCGATTACTACATCGCG
Tursiops_truncatus|16281       TTCGATCGGGTCCTTTTCTGGGGCCGCATCCTCGGCCTCGTCGACGATTACTACATCGCG
Bos_taurus|14517               TTCGATAGGGTCCTCTTCTGGGGCCGCATCCTCGGCCTCGTCGCCGATTACTACATCGCT
Sus_scrofa|17815               TTCGATCGGGTCCTTTTCTGGGGCCGCATCCTCGGCCTCATCGCTGATTACTACATCGCG
Sus_scrofa|7737                TTCGATCGGGTCCTTTTCTGGGGCCGCATCCTCGGCCTCATCGCTGATTACTACATCGCG
Xenopus_tropicalis|15115       ------------------------------------------------------------
Anolis_carolinensis|2075       TTCGAGCAAGTCCGCCTGTGGGGCCGCATCCAAGGCATCCGCGGGGCCTACTACATCGCC
Gallus_gallus|13422            TTCGAGAGGGTCTGGTTCTGGGGCTGCATCCAGGGCGTGCGCGGTACCTACTACATCGCG
Taeniopygia_guttata|9570       TTCGAGCGGGTCTGGTTCTGGGGCTGCATCCAGGGCTTGCGCGGCGCCTACTACATCGCC
                                                                                           

Danio_rerio|22509              CAAGGAGTTGAAGATGATGAACTGAAGAACAGGAAGTCTTTGTAT------AGTTTAAAC
Gasterosteus_aculeatus|27306   CAGGGCAGAGGAGAAGATGAGATGCTGGATAAAAAGAATCTCTAC------AGCTTCAAC
Oryzias_latipes|14562          CAGGGGAGAGGGGAGGATGAAATGACAGACAGAAAAAGTCTGTAC------AGCCTGAAC
Tetraodon_nigroviridis|5571    CAAGGAAGAGGAGAAGATGAACTGCAAGACAAAAGGAATCTCTAC------AGCTTCAAC
Fugu_rubripes|7227             caggggagaggagaagacgaAATGCAAGATAAAAGAAACCTCTAT------AGCTTCAAC
Nematostella_vectensis|23593   CAAGGAGTCGGGAAGGACGAGTTAAAAGAACGAAAAACGCTGTAC------AGCCAAGAC
Branchiostoma_floridae|48500   CAAGGCGTTTCACGGGACGAGATGGCAGAAAGGAAAACCTTGTAC------AGCCTTGAC
Gorilla_gorilla|16823          CAGGGCCTGAGTGAGGACCAGCTCGCACCGCGCAAGACGCTCTATAGGAAGAGCCTGCTC
Rhesus_macaque|28911           CAGGGCCTGAGTGAGGACCAGCTCGCACCGCGCAAGACGCTCTAC------AGAGGCAGG
Microcebus_murinus|5423        CAGGGGGTGAGCGAGGATCAGCTCGCACCGCGCAAGACACTCTAC------AGNNNNNNN
Ornithorhynchus_anatinus|12977 CAGGGCCTCGGCCCGGACCAGCTCGGGGACCGCAAGACCCTCTAC------AGTTTGAAC
Tarsius_syrichta|2570          CAGGGCATGAGAGAGGACCAGCTGGCACCGCGCCAGACGCTTTAC------AGNNNNNNN
Myotis_lucifugus|17998         ------------------------------------------------------------
Homo_sapiens|73880             CAGGGCCTGAGTGAGGACCAGCTCGCACCGCGCAAGACGCTCTAT------AGCCTGAAC
Pan_troglodytes|31973          CAGGGC------------------------------------------------------
Procavia_capensis|7555         CAAGGGTTGAGCGAGGACCAGCTAGCACCACGAAAGACCCTCTAC------AGNNNNNNN
Tupaia_belangeri|3420          CAAGGCCTGAGCGAGGACCAGCTCGCCCCGCGCAAGACTCTGTAC------AGNNNNNNN
Choloepus_hoffmanni|7693       CAGGGCCTGAGCGAGGACCAGCTCGCACCGCGCAAGACTCTCTAC------AGNNNNNNN
Felis_catus|40543              CAGGGCCTGAGTGAGGACCAGCTCGCACCACGCAAGACCCTCTAC------AGNNNNNNN
Cavia_porcellus|5786           CAGGGCCTGGCCGAGGACCAGCTGGCCCCGCGCAAGACACTCTAC------AGCCTGAAC
Macropus_eugenii|14010         CAGGGCTTGGCGGAGGATCAGCTTGAGGAGCGCAAAAGCCTGTAC------AGTTTGAAC
Ochotona_princeps|16778        CAGGGCCTGAGTGAGAACCAGCTCGCACCGCGCAAAACACTGTAC------AGCCTAAAC
Monodelphis_domestica|11253    CAGGGTTTGGGCCCCGACCAACTAGGGGAGCGGAAAAGCTTGTAC------AGTTTGAAC
Dipodomys_ordii|2417           ------------------------------------------------------------
Dasypus_novemcinctus|4373      CAGGGCCTGAGCGAGGATCAGTTCGCACCGCGCAAGACCCTCTAC------AGCCTGAAC
Oryctolagus_cuniculus|3583     CAGGGCCTGAGTGAGAACCAGCTCGCACCGCGCAAGACACTGTAC------AGCCTGAAC
Loxodonta_africana|693         CAGGGCTTGACCGAGGACCAGCTCGCACCGCGCAAAACCCTCTAC------AGTCTGAAC
Erinaceus_europaeus|6081       CAGGGCCTGAGCGCCGACCAGCTCGCCCCGCGCAAGACGCTGTAC------AGCCTGAAC
Mus_musculus|17689             CAGGGCTTGAGTGAGGACCAGCTCGCACCACGCAAGACGCTCTAC------AGCCTGAAC
Rattus_norvegicus|35242        CAGGGCCTGAGTGAGGACCAGCTCGCACCACGCAAGACGCTCTAC------AGCCTGAAC
Equus_caballus|13635           ---------------------------------------------------AGCCTGAAC
Canis_familiaris|3877          CAGGGCTTGAGTGAGGACCAGCTCGCACCACGCAAGACACTCTAC------AGCCTGAAC
Callithrix_jacchus|31398       CAGGGCTTGAGTGAGGACCAGCTCGCACCGCGCAAGACGCTCTAC------AGCCTGAAT
Pongo_abelii|24761             CAGGGCCTGAGTGAGGACCAGCTCGCACCACGCAAGACGCTCTAT------AGCCTGAAC
Tursiops_truncatus|16281       CAGGGCCTGAGCGAGGACCAGCTCGCACCGCGCAAGACCCTGTAC------AGCCTGAAC
Bos_taurus|14517               CAGGGGGTGAGCGAGGACCAGCTCGCACCGCGCAAGACCCTGTAC------AGCCTGAAC
Sus_scrofa|17815               CAGGGCCTGAGCGAGGACCAGCTTGCACCTCGCAAGACTCTATAC------AGCCTGAAC
Sus_scrofa|7737                CAGGGCCTGAGCGAGGACCAGCTTGCACCTCGCAAGACTCTATAC------AGCCTGAAC
Xenopus_tropicalis|15115       ---------------------------------------------------AGCTTGAAC
Anolis_carolinensis|2075       GAGGGATTGGGCCCGGACAGAGCCGGGGCTCGAAGCCGCCTCTAC------agCTTAAAC
Gallus_gallus|13422            CAGGGGCTGGGCCCCGACCTCGCTGCGCCTCGCAGCCGCCTCTAC------AGCTTGAAC
Taeniopygia_guttata|9570       GAGGGGCTGGGTCCCGACCGCGCCGCGCCCCGCTGCCGCCTGTAC------AGCTTGAAC
                                                                                           

Danio_rerio|22509              TGCGTAGATTGGCACCTGCTCCCCCCAGCCACCGAGTCCATGATTGCAGATGTGGCATTA
Gasterosteus_aculeatus|27306   TGCATGGACTGGTTCCTGCTCCCCAGCGCCACCGACTCCATGGTCGAAGACGCGGCCATA
Oryzias_latipes|14562          TGCGTGGACTGGCTCCTGCTCCCTTCTGTCACAGATGCTATGGTGGAGGAAGTGTCCAAA
Tetraodon_nigroviridis|5571    TGCGTGGAGTGGTTGCTGCTCCCACCTGTCACAGAGGACATGATAAAGCAAGTGTCCCAA
Fugu_rubripes|7227             TGCATCGACTGGTTATTGCTGCCACCCATCACGGAAGACATGATGAAGGCAGTGTCCGTT
Nematostella_vectensis|23593   TGCATTCACTGGGGACTGCTACCGGTGGTGACCGACAAAATGAGACACGATTGCTCCTTT
Branchiostoma_floridae|48500   TGTGTGCAGTGGAACCTACTGCCACCTGCAACAAAGGCCATGCGGGATCACACGTCTGTT
Gorilla_gorilla|16823          CGATCAGAGTGGGCAAAATGGCCTGAAAGTGTGGCGAGCACTGTACTAGGCAGTAGCTGG
Rhesus_macaque|28911           ---GCGGGGTGGGCGGGTCAGCCCATGGAGCCAAGGGAGATGTGGGCGGGATCTGAGATG
Microcebus_murinus|5423        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|12977 TGCATGGAGTGGAGCCTCTTGCCGCCGGCCACGGAGAAGATAGTGACGCAGACGTCCGTG
Tarsius_syrichta|2570          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Myotis_lucifugus|17998         ------------------------------------------------------------
Homo_sapiens|73880             TGCACAGAGTGGAGCCTCTTGCCCCCTGCCACAGAGGAGATGGTGGCGCAGTCGTCTGTG
Pan_troglodytes|31973          ------------------------------------------------------------
Procavia_capensis|7555         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|3420          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|7693       NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Felis_catus|40543              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|5786           TGCATGGAGTGGAGCCTCCTGCCCCCTGCCACTGAGGAGATGGCCGCGCAGGTAGCCACG
Macropus_eugenii|14010         TGCATGGAATGGAGTCTCCTGCCGCCGGCAACAGAAGAGATGGTCACCCGGACATCAGTG
Ochotona_princeps|16778        TGCATCGAGTGGAGCCTCCTGCCCCCTGCCACGGAGGAGATGGCGGCGCAGACGGCCATG
Monodelphis_domestica|11253    TGCATGGAATGGAGTCTCCTGCCACCAGCGACAGAAGAGATGGTGACCCAGACATCTGTG
Dipodomys_ordii|2417           ------------------------------------------------------------
Dasypus_novemcinctus|4373      TGCACGGAGTGGAGCCTCTTGCCCCCCGCCACTGAGGAGATGATGGCGCAGACGTCTGTG
Oryctolagus_cuniculus|3583     TGCGTCGAGTGGAGCCTCCTGCCCCCAGCCACGGAGGAGATGGCCGCGCAGACGGCCGTG
Loxodonta_africana|693         TGCATGGAGTGGAGCCTCTTGCCCCCCGCCACGGAGGAGATGCTGCTGCAGACGTCTGTG
Erinaceus_europaeus|6081       TGCATGGAGTGGAGCCTCTTGCCCCCTGCCACTGAGGAGATGATGACACAGACCTCTGTG
Mus_musculus|17689             TGCACAGAGTGGAGTCTCTTGCCCCCTGCCACAGAGGAGATGGCCATGCAGATATCTGTG
Rattus_norvegicus|35242        TGCACAGAGTGGAGCCTCTTGCCCCCGGCCACAGAGGAGATGGTGACACAGACATCTGTG
Equus_caballus|13635           TGCATGGAGTGGAGCCTCCTGCCCCCTGCCACAGACGAGATGATGGTGCAGACATCCGTG
Canis_familiaris|3877          TGTATGGAGTGGAGCCTCTTGCCCCCCGCCACGGAAGAGATGGCAGTGGAGACGTCTGTG
Callithrix_jacchus|31398       TGCACAGAGTGGAGCCTCTTGCCCCCTGCCACAGAGGAGATGGTGGCGCAGTCGTCTGTG
Pongo_abelii|24761             TGCACAGAGTGGAGCCTCTTGCCCCCTGCTACAGAGGAGATGGTGGCGCAGTCGTCTGTG
Tursiops_truncatus|16281       TGCATGGAGTGGAGCCTCCTGCCCCCTGCCACGGAGGAGATGGAGATGCAGACGTCTGTG
Bos_taurus|14517               TGCATGGAGTGGAGCCTCCTGCCTCCCGCCACAAAGGAGATGGAGACACAGACGTCTGTG
Sus_scrofa|17815               TGCATGGAGTGGAGCCTCTTGCCCCCCGCCACCGAGGAGATGGTGACACAGACATCCGTG
Sus_scrofa|7737                TGCATGGAGTGGAGCCTCTTGCCCCCCGCCACCGAGGAGATGGTGACACAGACATCCGTG
Xenopus_tropicalis|15115       TGTGTGGATTGGTGCCTGCTGCCGCCTGCAACGGATGCCCACATTGCCCAGACGCAAGGG
Anolis_carolinensis|2075       TGTGTTGACTGGAGCCTTCTGCCCCCTCCTACTGAGGAAATGGTTACACTGACTGCAGGG
Gallus_gallus|13422            TGCGTGGAGTGGAGCCTCCTGCCGCCGGCGACCGTGGAGATGGTGGAACAGGCCGCGCTG
Taeniopygia_guttata|9570       TGCTTGGACTGGAGCCTCCTGACGCCAGCCACCGAGGAGATGCTTGTGCTGGCTGAGCAG
                                                                                           

Danio_rerio|22509              GCAGCAACGGGACGATTCACAGGCGACCCGTCCCATGAGTACGAGCACACAGAGATCCGC
Gasterosteus_aculeatus|27306   GCTGCGAAGAGACGCTTCATCGGAGACCCGTCCTTCGTGTACGAGCGCCTGGAGATGAGC
Oryzias_latipes|14562          GCGGCACAGGGCCGCTTCAAAGGAAACCCTTCCTTTGTGTATGAGCACAAGGTCAGCCAA
Tetraodon_nigroviridis|5571    GCTGCCAAGGGCCGCTTCAGGGGAGACCCCTCATATTTGTATGAGCATCTGGAGGTGAGT
Fugu_rubripes|7227             GCTGCAAAGGGCCGCTTCAGGGGGGACCCCTCATATGTGTACGAGCACCTTGAGGCATTA
Nematostella_vectensis|23593   ---GTAAAAGGCCGATTCACTGGAGATCCTTCCTATGAATACGAACACACAGAAACAGTG
Branchiostoma_floridae|48500   ---GTGAAGGGTCGGTTCACAGGGGATCCGTCCTATGAGTATGAGCACACAGAGATCAGG
Gorilla_gorilla|16823          ---GGCTCTGGAAGGCAGGTGGGTAAGATTGCAAAAAGAAAAGAGGGGAGTGAGAAGGAC
Rhesus_macaque|28911           ---AGGCCTAGGGCCTGGTGGGGCGGGCCTGGGGACGGTCAAGAGGAAGAAAATCTTGAT
Microcebus_murinus|5423        ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|12977 ---GTGAAAGGTCGTTTCGTGGGGGACCCCTCGCACGAGTACGACCACACCGAGGTGCAG
Tarsius_syrichta|2570          ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Myotis_lucifugus|17998         ------------------------------------------------------------
Homo_sapiens|73880             ---GTGAAGGGCCGCTTCATGGGGGACCCATCATACGAATATGAACACACTGAGCTGCAG
Pan_troglodytes|31973          ------------------------------------------------------------
Procavia_capensis|7555         ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|3420          ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|7693       ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Felis_catus|40543              ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|5786           ---GTGAAGGGCCGCTTCATGGGGGACCCCTCGCACGAGTATGAGCAAACCGAGTTCCAG
Macropus_eugenii|14010         ---GTGAAGGGCCGATTCATGGGGGACCCTTCACATGAATACGAGCACGTTGAGATGCAG
Ochotona_princeps|16778        ---GTGAAGGGCCGCTTCATGGGCGACCCCTCCCACGAGTACGAACACACGGAGCTGCAG
Monodelphis_domestica|11253    ---GTAAAGGGCCGCTTCATGGGGGACCCTTCGCATGAGTATGAGCATGTTGAGATGCAG
Dipodomys_ordii|2417           ------------------------------------------------------------
Dasypus_novemcinctus|4373      ---GTGAACGGCCGCTTCATGGGGGACCCCTCACACGAGTACGAACACACCGAGCTGCAG
Oryctolagus_cuniculus|3583     ---GTGAAGGGCCGCTTCATGGGGGACCCCTCCCACGAGTACGAGCACACCGAGCTGCAG
Loxodonta_africana|693         ---GTGAGCGGCCGCTTCATGGGGGACCCCTCACATGAGTATGAACACACGGAGCTGCAG
Erinaceus_europaeus|6081       ---GTGAAGGGCCGCTTCATGGGGGACCCCTCCCATGAGTACGAGCACACTGAGATGCAG
Mus_musculus|17689             ---GTGAGTGGCCGTTTCATGGGCGACCCTTCACACGAGTATGAACACACAGAGTTGCAG
Rattus_norvegicus|35242        ---GTGAGTGGCCGCTTCATGGGTGATCCTTCACACGAGTATGAACACACCGAGCTCCAG
Equus_caballus|13635           ---GTGAAGGGCCGCTTCACGGGGGACCCCTCGCATGAGTATGAGCACACTGAGCTGCAG
Canis_familiaris|3877          ---GTGAAGGGCCGCTTCATGGGGGACCCCTCGCATGAGTACGAACACACTGAGCTGCAG
Callithrix_jacchus|31398       ---GTGAAGGGCCGCTTCATGGGGGACCCATCATACGAGTATGAACACATTGAGCTGCAG
Pongo_abelii|24761             ---GTGAAGGGCCGCTTCATGGGGGACCCATCATACGAATATGAACACACTGAGCTGCAG
Tursiops_truncatus|16281       ---GTGAAGGGCCGCTTCATGGGGGACCCCTCACATGCGTATGAACACACCGAGCTGCAG
Bos_taurus|14517               ---GTGAAGGGTCGCTTCATGGGGGACCCCTCCCATGAGTACGAACACACTGAGCTGCAG
Sus_scrofa|17815               ---GTGAAAGGCCGCTTCATGGGGGACCCCTCGCATGAGTACGAGCACACTGAGCTGCAG
Sus_scrofa|7737                ---GTGAAAGGCCGCTTCATGGGGGACCCCTCGCATGAGTACGAGCACACTGAGCTGCAG
Xenopus_tropicalis|15115       ---ATTAAAGGGCGCTTTGTAGGGGACCCGGCGCATGAATACGAGTACATTGTGCGCAAT
Anolis_carolinensis|2075       ---CTAAAAGGACGCTTCCAAGGGGATCCATCTTATGAATATGAACAGCCTGAGAAGAAA
Gallus_gallus|13422            ---CTGAAGGGCCTCTTCCAGGGAGATCCGTCTTTTGAGTACGAGTATGCCGAGGTAAAC
Taeniopygia_guttata|9570       ---CTGAAGGGCCACTTTCAGGGGGATCCTTCTTTTGAGTACAGCTTGGCTGAGATAAAC
                                                                                           

Danio_rerio|22509              ACAGAG---GGC---GAGGGGGACGAGGCTACACATGAAGAGGTCACG------GTGAAA
Gasterosteus_aculeatus|27306   GAA------GGA---CAGGGTGGTGCCGCG---GAGGGTGAAGTAGGT------GCCACA
Oryzias_latipes|14562          CAGGAGGGAAAG---GAGCAGGAAAAAGTGGTGAGGAAGCTCCTACAT------TTCAGT
Tetraodon_nigroviridis|5571    ---------GGA---AAATCTGAAGAATTCCCTAAACGTTCCCCAACC---------AAA
Fugu_rubripes|7227             AAT------ACA---CggtcagttatggtgtttttattgaacCCTTGGCTTCAGAGCAAA
Nematostella_vectensis|23593   AAAATTGATAATCAAGATGGCGAGAAAACTGAGGGCGGAGAGGAGGAAAATACGATACTA
Branchiostoma_floridae|48500   AAAATT---GGT---GAGGGGGAAGATGCTACAGAGGAGGAGCATACA------ATTCAA
Gorilla_gorilla|16823          TTCCTC---TCC---CAGCAGAAGAAAGTGAGAAAGAAGGAACCAGAG------GTCCAG
Rhesus_macaque|28911           AGG------AAG---GAAGGTGAGGGCTTGCCCAGAGTGATCTGCGTC---------CAA
Microcebus_murinus|5423        NNNNNN---NNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------
Ornithorhynchus_anatinus|12977 AAGGTG---GAA---GAGGGGGACAAGACGTACGAGGAAGAGGTCGTG------------
Tarsius_syrichta|2570          NNNNNN---NNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------
Myotis_lucifugus|17998         ------------------------------------------------------------
Homo_sapiens|73880             AAGGTG---AAT---GAAGGTGAAAAAGTCTTTGAAGAAGAAATAGTG------------
Pan_troglodytes|31973          ------------------------------------------------------------
Procavia_capensis|7555         NNNNNN---NNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------
Tupaia_belangeri|3420          NNNNNN---NNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------
Choloepus_hoffmanni|7693       NNNNNN---NNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------
Felis_catus|40543              NNNNNN---NNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------
Cavia_porcellus|5786           AAGATGTCGTCC---GAGGGCGAGAAGCCGTTCACACAGGCATTCACA------GTCCAG
Macropus_eugenii|14010         CGGATG---AAT---GAAGGAGACAGGACGTATGAAGATGAGGTGGTG------------
Ochotona_princeps|16778        AAGACG---AGC---GATGGCGACAAGGCCTTTGAGGAGGAAGTGGTG------------
Monodelphis_domestica|11253    CGCATG---ACT---GAAGGAGACAGGACATATGAAGATGAGGTGGTG------ATCCAA
Dipodomys_ordii|2417           ------------------------------------------------------------
Dasypus_novemcinctus|4373      AAGATG---ACT---GAGGGCGACAAGGTCTTTGAAGAAGAAGTCGTG------------
Oryctolagus_cuniculus|3583     AGGGTG---AAC---GAGGGCGACAAGGCCTTTGAGGAGGAAGTGGTG------GTCCAG
Loxodonta_africana|693         AAGATG---AAC---GACGGTGACAAGGTCTTTGAAGAAGAAGTGGTG------ATTCAG
Erinaceus_europaeus|6081       AAGGTG---AAT---GATGGTGAAAAAGTCTTCGATGAAGAAGTTGTGNNNNNNNNNNNN
Mus_musculus|17689             AAGGTT---AAC---GAAGGAGAGAAGGTCTTTGATGAAGAAGTGGTG------GTCCAG
Rattus_norvegicus|35242        AAGGTC---AGC---GAAGGTGACAAGGTCTTTGATGAAGAAGTGGTG------GTCCAA
Equus_caballus|13635           AAGGTG---ACC---GACGGCGAGAAGGTCTTTGAAGAAGAAGTAATA------GTCCAG
Canis_familiaris|3877          AAGATG---AAG---GAGGGTGAAAAGGTCTTTGAAGAAGAAGTAGTG------GTCCAG
Callithrix_jacchus|31398       AAGGTG---AAT---GAAGGCGAAAAGGTCTTTGAAGAAGAAGTAGTG------ATCCAG
Pongo_abelii|24761             AAGGTG---AAT---GAAGGTGAAAAGGTCTTTGAAGAAGAAGTAGTG------GTCCAG
Tursiops_truncatus|16281       AAGGTG---AAT---GAGGGCGAAAAGGTCTTTGAAGAAGAAGTAGTG------NNNNNN
Bos_taurus|14517               AAGGTG---AAC---GAGGGTGAGAAGGTCTTTGAAGAAGAAGTAGTG------GTCCAG
Sus_scrofa|17815               AAGGTG---AAC---GAGGGCGAGAAGGTCTTTGAAGAAGAAGTAGTG------GTCCAG
Sus_scrofa|7737                AAGGTG---AAC---GAGGGCGAGAAGGTCTTTGAAGAAGAAGTAGTG------------
Xenopus_tropicalis|15115       ACGGCT---GGG---GGAGGAGACTCGGCACTGGAGGAGGAGCTAACG------ACCCAC
Anolis_carolinensis|2075       GAA------------GACCCTGAAAGACCATATGAAGAGGAAGTTGCA------GCCTTG
Gallus_gallus|13422            GCA------GAA---GATGACGAAAGATTTCTGGAGGATGAAAAAAAAAAAAAGCTCACA
Taeniopygia_guttata|9570       GCAGAA---------GCTGCTGCAAGACTGGTTCAAAGTGGTAAGGAG------CCTGTG
                                                                                           

Danio_rerio|22509              GTGATTGAAGCAAGTAGACTGGCTGCAATAGTGTCAAACATCGATAAAGACGTGTCTGTA
Gasterosteus_aculeatus|27306   GTCAGCGAGGAGCGCCGGCTCGCGGCCACGGTGCATCAGATCGACGAGGACGCGTCCGTG
Oryzias_latipes|14562          GTGACTGAGGAGAAGAGGCTGGCTGTGACAGTGCACCACATCGATGAAGAAGCATCTGTG
Tetraodon_nigroviridis|5571    GTCAGCGAGGAGTGTAGACTGGCAGTGACCATCCATCAGATCGATGAGGAGGTGTCGGTG
Fugu_rubripes|7227             GTCAGTGAGGAGAATAGACTGGCGGTGGTCATCCATCAGATCGATGAGGAGGCGTCAGTG
Nematostella_vectensis|23593   ATTAAGGAAGAAGACAGACTTGCCACAACGATTGAAGCCATTGATTACGATGTCCGTATT
Branchiostoma_floridae|48500   GTAAAGGAGGAGGATCGTCTGACCTCTGTCATTGCCACCATTGATGAGGAGGTGGCCATT
Gorilla_gorilla|16823          ATCAAGGAAGAGACCCGCTTGGTGTCTGTCATTGACCAGATTGACAAGGCTGTGGCCATC
Rhesus_macaque|28911           ATCAAGGAAGAGACCCGCTTGGTGTCTGTCATTGACCAGATTGACAAGGCTGTGGCCATC
Microcebus_murinus|5423        ---------------------------------------NNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|12977 ---------------------------------------ATCGACAAGGCCGTAGCCATC
Tarsius_syrichta|2570          ---------------------------------------ATTGACAAGGCGGTGGCTATC
Myotis_lucifugus|17998         ---------------------------------------ATCGACAAGGCGGTGGCCATT
Homo_sapiens|73880             ---------------------------------------ATTGACAAGGCTGTGGCCATC
Pan_troglodytes|31973          ---------------------------------------ATTGACAAGGCTGTGGCCATC
Procavia_capensis|7555         ---------------------------------------ATTGACAAGGCTGTGGCCATT
Tupaia_belangeri|3420          ---------------------------------------ATTGACAAGGCTGTGGCCATC
Choloepus_hoffmanni|7693       ---------------------------------------ATTGACAAGGCTGTGGCCATT
Felis_catus|40543              ---------------------------------------ATTGACAAGGCTGTGGCTATC
Cavia_porcellus|5786           GTCAAGGAAGAGACTCGCCTGGTATCTGTCATCGACCAGATTGACAAGGCTGTGGCCATC
Macropus_eugenii|14010         ---------------------------------------ATTGACAAGGCAGTGTCAGTC
Ochotona_princeps|16778        ---------------------------------------ATCGAC---GCAGTGGCCGTC
Monodelphis_domestica|11253    ATCAAGGAGGAATCTCGCCTAGTGTCAGTCATTGATCAGATTGATAAGGCAGTGGCCATC
Dipodomys_ordii|2417           ---------------------------------------ATTGACAGGGCTGTGGCCATT
Dasypus_novemcinctus|4373      ---------------------------------------ATTGACAAGGCTGTGGCCATT
Oryctolagus_cuniculus|3583     ATCAAGGAGGAGACGCGCTTGGTGTCCGTCATCGACCAGATCGACAAGGCTGTGGCCATC
Loxodonta_africana|693         ATCAAGGAAGAAACCCGCTTGGTGTCCATCATTGACCAGATAGACAAGGCTGTGGCCATT
Erinaceus_europaeus|6081       NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|17689             ATCAAGGAAGAGACTCGCTTGGTGTCCATCATTGACCAGATTGACAAGGCTGTAGCTATC
Rattus_norvegicus|35242        ATCAAGGAGGAGACTCGCTTGGTGTCCATCATCGACCAGATTGACAAGGCTGTGGCCATC
Equus_caballus|13635           ATCAAGGAAGAGACCCGCTTGGTGTCCATCATTGACCAGATTGACAAGGCTGTGTCTGTC
Canis_familiaris|3877          ATCAAGGAAGAAAACCGTTTGGTGTCTGTCATCAACCAGATTGACAAGGCTGTGGCTGTC
Callithrix_jacchus|31398       ATCAAGGAAGAGACCCGCTTAGTGTATGTCATTGACCAGATTGACAAGGCTGTGGCCATC
Pongo_abelii|24761             ATCAAGGAAGAGACCCGCTTGGTGTCTGTCATTGACCAGATTGACAAGGCTGTGGCCATC
Tursiops_truncatus|16281       NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Bos_taurus|14517               ATCAAGGAAGAGACGCGCTTGGTGTCCGTTATTGACCAGATCGACAAGGCTGTGGCTGTC
Sus_scrofa|17815               ATCAAAGAAGAGACCCGTTTGGTGTCCATCATTGATCAGATCGACAAGGCTGTGGCCGTC
Sus_scrofa|7737                ------------------------------------------------------------
Xenopus_tropicalis|15115       ATTAAGGAAGAGGTGCGGCTGACGGGCACCATCGCTATGATCGATAGGGAGGCAGCCGTG
Anolis_carolinensis|2075       ATCAAAGAGGAGACCCGTCTTGTAGCTACAATACATCAGATAGATAAAGCAGTGGGTATC
Gallus_gallus|13422            ATCAAGGAGGAGAACCGCCTTGTAGCTACAATAGAACAGATAGACAGAGCAGTTGGTATC
Taeniopygia_guttata|9570       ATCAAGGAGGAGGCCCGCCTCATAGCTACCATAGAACAGATAGACAGAGCAGTTGGTATC
                                                                                           

Danio_rerio|22509              GTCCCACGTGGTGCATTCATCAAGAGTCCCAATGGCAAAGTGCAGACAAACCGAAGCTTT
Gasterosteus_aculeatus|27306   GTGCCGCGCGGCGCCTTCGTCAAGAGTCCACGCGGCCTCGTCCACGTCAACCGCAGCTTC
Oryzias_latipes|14562          GTTCCTCGAGGAGCTTTCATCCAGAGTTTAAGGGGTCTCGTCCAGACAAACCGCAGCTTT
Tetraodon_nigroviridis|5571    ATACCCAGGGGTGCCTTTATCAAGGACCTACAAGGCCTCGTCCAAGTCAACCCCAGCTTT
Fugu_rubripes|7227             GTACCCAGAGGGGCCTTCATTAGGGACCTACGAGGACTTGTCCAAGTCAACCGCAGCTTT
Nematostella_vectensis|23593   GTCCCAAGAGGTTCATATATCAGAACAGCAACTGGTGCAGTGATAGAAAATCGCTCATTT
Branchiostoma_floridae|48500   GCACCCCGGGGGGCCTTCATCAAGACACCACATGGGGAAGTCATCCGGAACCGAAGCTTT
Gorilla_gorilla|16823          ATCCCCCGAGGCGCCCTCTTCAAGACCCCTTTTGGACCCACCCATGTCAATCGGACCTTT
Rhesus_macaque|28911           ATCCCCCGAGGCGCCCTCTTCAAGACACCTTTTGGACCCACCCATGTCAATCGGACCTTT
Microcebus_murinus|5423        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|12977 ATCCCGCGCGGGGCATTAGTCAAGACCCCCCTTGGGCCCGTTCACGTCAACAGAAGCTTT
Tarsius_syrichta|2570          ATCCCCCGAGGTGCCCTCTTCAGGACCCCTTTTGGACCCACCCATGTCAATCGGGTCTTT
Myotis_lucifugus|17998         ATCCCCCGCGGCGCCCTCTTTAAGAGCCCTTTTGGACCCACCCATGTCAATCGGACCTTT
Homo_sapiens|73880             ATCCCCCGAGGCGCCCTCTTCAAGACCCCTTTTGGACCCACCCATGTCAATCGGACCTTT
Pan_troglodytes|31973          ATCCCCCGAGGCGCCCTCTTCAAGACCCCTTTTGGACCCACCCATGTCAATCGGACGTTT
Procavia_capensis|7555         ATTCCCCGAGGAGCCCTCTTTAAGACCCCTTTTGGACCCACCCATGTCAATCGGACCTTT
Tupaia_belangeri|3420          ATCCCTCGAGGTGCCCTCTTCAAGACCCCTTTTGGACCCATCCATGTCAATCGGACCTTT
Choloepus_hoffmanni|7693       ATCCCCCGAGGTGCCCTCTTCAAGACCCCTTTTGGACCTATCCATGTCAATCGGACCTTT
Felis_catus|40543              ATCCCCCGAGGAGCCCTTTTTAAGACCCCTTTTGGACCTATCCATGTCAATCGGACTTTT
Cavia_porcellus|5786           ATCCCCCGGGGTGCATTCTTCAAGACCCCCTACGGGCCTGTCCATGTCAACCGGACATTT
Macropus_eugenii|14010         ATCCCCCGTGGAGCCCTTTTCAAGACCCCCTTTGGACCCGTCCATGTTAATAGGACCTTT
Ochotona_princeps|16778        ATCCCTCGGGGTGCCCTCTTC---ACCCCCTTTGGGCCTATTCATGTCAACCGGACNNNN
Monodelphis_domestica|11253    ATCCCCCGTGGAGCCTTCTTCAAGACCCCCTTTGGACCTGTTCATGTCAATAGGACCTTT
Dipodomys_ordii|2417           GTTCCTCGAGGTGCCCTCTTCAAGACCCCTTTTGGGTCTACTCATGTCAATCGGACCTTT
Dasypus_novemcinctus|4373      ATCCCCCGAGGTGCCCTCTTCAAGACCCCTTTTGGACCCATCCATGTCAATCGGACCTTT
Oryctolagus_cuniculus|3583     ATCCCCCGAGGCGCCCTCTTCAAAACCCCTTTTGGCCCCATCCATATCAACCGCACCTTT
Loxodonta_africana|693         ATCCCCCGAGGTGCCCTCTTCAAGACACCTTTTGGACCCACCCACGTCAATCGGACCTTT
Erinaceus_europaeus|6081       NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|17689             ATCCCTCGAGGTGCCCTCTTCAAGACCCCTTTTGGAGTCACCCATGTCAATCGGACCTTT
Rattus_norvegicus|35242        GTCCCTCGAGGTGCCCTCTTCAAGACCCCTTTTGGAGTCACCCACGTCAATCGGACCTTT
Equus_caballus|13635           ATTCCCCGTGGTGCCCTCTTTAAGACTCCTTTTGGACCCGTCCATGTCAATCGGACCTTT
Canis_familiaris|3877          ATCCCTCGAGGAGCCCTTTTTAAGACCCCTTTTGGACCCATCCATGTCAATCGGACCTTT
Callithrix_jacchus|31398       ATCCCCCGAGGCGCCCTCTTCAAGACCCCTTTTGGACCCACCCATGTCAATCGGACCTTT
Pongo_abelii|24761             ATCCCCCGAGGCGCCCTCTTCAAGACCCCTTTTGGACCCACCCATGTCAATCGGACCTTT
Tursiops_truncatus|16281       NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Bos_taurus|14517               ATCCCCCGAGGTGCCCTCTTTAAGACCCCTTTTGGACCTATCAATGTCAATCGGACCTTT
Sus_scrofa|17815               ATCCCCCGAGGCGCCCTCTTTAAGACCCCCTTTGGACCCATCCATGTCAATCGGACCTTT
Sus_scrofa|7737                ------------------------------------------------------------
Xenopus_tropicalis|15115       GCACCGCGGGGAGCCTACATCCGGAACCCCCTGGGGCAAGTCATTGTCAACCACAGCTTC
Anolis_carolinensis|2075       GTTCCACGAGGTGCATATGTAAAGTCACCACTTGGACCTGTGCATGAAAACAGGAGCTTT
Gallus_gallus|13422            ATCCCTCGACGTGCATTTATGAAGACTCCTCTTGGGTCTGTGCATGAAAACAGAAACTTT
Taeniopygia_guttata|9570       GTCCCCCGGGGCGCATTTGTGAAGACTCCTCTTGGGTCTGTGCATGAAAACAGATACTTT
                                                                                           

Danio_rerio|22509              GGAGGC------CTTCATCCCACTGAGGCTGCAAAACTGCGCAACTACCTGCACTTCCGT
Gasterosteus_aculeatus|27306   GCTGGT------TTGTCTCACTCAGAAGCAAAGAAGCTCGACAGCTTCCGTCACTTTAGA
Oryzias_latipes|14562          GGTGGA------CTTTCTGAATCAGAAGCAAGGAGGCTGGAAAATTTCATGCATTTCAGA
Tetraodon_nigroviridis|5571    GGTGGT------TTGTCTCGCTCAGAAGCAGCAAGGCTTTCAAACTTCCTTCACTTCAGC
Fugu_rubripes|7227             GCTGGT------CTGTCTCCTTCCGAAGCAACAAGGCTCTCGAACTTCCTTCACTTCAGA
Nematostella_vectensis|23593   GAAGGCAACTGGCTCTCAGTAGCAGATGCTGGAAAACTTGCAAGCTACTTTCATTTTCGT
Branchiostoma_floridae|48500   GAAGGT------CTGTCTGTGTCAGAAGCAGGGAAGCTGAACTCGTACTTCCACCTGCGT
Gorilla_gorilla|16823          GAAGGA------CTGTCCTTGTCTGAGGCCAAGAAGCTCAGCTCGTACTTCCATTTCAGG
Rhesus_macaque|28911           GAAGGA------CTGTCCTTGTCTGAGGCCAAGAAGCTCAGCTCCTACTTCCATTTCAGG
Microcebus_murinus|5423        NNNNGA------CTGTCCTTGTCTGAGGCCAAGAAGCTCAGTTCCTACTTCCACTTCAGA
Ornithorhynchus_anatinus|12977 GAAGGA------CTGTCCATGTCAGAGGCCAAGAAGCTGAGCTCCTACTTCCACTTCAAG
Tarsius_syrichta|2570          GAAGGA------CTGTCTTTGTCTGAGGCCAAGAAGCTCAGTTCCTACTTCCACTTCAGG
Myotis_lucifugus|17998         GAAGGA------CTGACCTTGTCTGAAGCGAAGAAGCTCAGTTCCTACTTCCACTTCAGG
Homo_sapiens|73880             GAAGGA------CTGTCCTTGTCTGAGGCCAAGAAGCTCAGCTCCTACTTCCATTTCAGG
Pan_troglodytes|31973          GAAGGA------CTGTCCTTGTCTGAGGCCAAGAAGCTCAGCTCCTACTTCCATTTCAGG
Procavia_capensis|7555         GAAGGA------CTGCCCTTGTCTGAGGCCAAGAAACTCAGTTCCTACTTCCACTTCAAG
Tupaia_belangeri|3420          GAAGGA------TTGTCCTTATCCGAATCCAAGAAGCTCAGCTCCTACTTCCACTTNNNN
Choloepus_hoffmanni|7693       GAT---------------------------------------------------------
Felis_catus|40543              GAAGGA------CTCTCCTTGTCTGAAGCCAAGAAGCTCAGTTCCTACTTCCACTTCAGG
Cavia_porcellus|5786           GAGGGA------CTGCCCTTGTCGGAGGCCAAGAAGCTCAGTTCCTACTTCCACTTCCGG
Macropus_eugenii|14010         GAAGGA------TTGACTCTGGCAGATTCCAAGAAACTGAGTTCCTATTTCCATTTTGCG
Ochotona_princeps|16778        NNNNGA------CTGCCCCTGTCTGAGGCCAGGAAGCTCAGCTCCTACTTCCACTTCCGG
Monodelphis_domestica|11253    GAAGGA------TTAACTCTGGCAGATGCCAAGAAGCTCACTTCCTACTTCCATTTCACG
Dipodomys_ordii|2417           GAAGGA------CTCTCCATGTCTGAGGTCAAGAAGCTCAGTTCCTACTTCCACTTCAGG
Dasypus_novemcinctus|4373      GATGGA------CTGTCTTTGTCTGAGGCCAAGAAGCTCAGTTCCTACTTCCACTTCAAG
Oryctolagus_cuniculus|3583     GAAGGA------CTGCCCTTGTCTGAGGCCAAGAAGCTCAGCTCCTACTTCCACTTCCGG
Loxodonta_africana|693         GAAGGA------CTGTCCTTGTCTGAGGCCAAGAAGCTCAGTTCCTACTTCCACTTCAAG
Erinaceus_europaeus|6081       NNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|17689             GAAGGC------CTGCCCCTGTCCGAGGTCAGGAAGCTTAGCTCGTACTTCCACTTCAGG
Rattus_norvegicus|35242        GAAGGC------CTGCCCTTGTCTGAGATCAAGAAGCTTAGCTCGTACTTCCACTTCAGG
Equus_caballus|13635           GAAGGA------CTGTCTTTGTCCCAAGCCAAGAAGCTCAGTTCCTACTTCCACTTCAGG
Canis_familiaris|3877          GAAGGA------CTGTCCTTGTCTGAAGCCAAGAAGCTTAGTTCCTACTTCCACTTTAGG
Callithrix_jacchus|31398       GAAGGA------CTGTCCTTGTCTGAGGCCAAGAAGCTCAGCTCCTACTTCCACTTCAGG
Pongo_abelii|24761             GAAGGA------CTGTCCTTGTCTGAGGCCAAGAAGCTCAGCTCCTACTTCCATTTCAGG
Tursiops_truncatus|16281       NNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Bos_taurus|14517               GAAGGA------CTGTCCTTGTCTGAAGCCAAGAAGCTGAGTTCTTACTTCCACTTCAGG
Sus_scrofa|17815               GAAGGA------CTGTCCTTATCTGAAGCCAAGAAGCTCAGTTCCTACTTCCACTTCCGG
Sus_scrofa|7737                ------------------GTGAGTGAA---------------------------------
Xenopus_tropicalis|15115       CGAGGC------CTTGAGGTGAGTGAAGGGAAGAAGTTGAGCTCCTACTTTCACTTTACC
Anolis_carolinensis|2075       GAAGGT------TTGTCATTGACAGAGGGCAAAAAGTTAAGCTCTTATTTCCATTTCACT
Gallus_gallus|13422            GAAGGT------CTTTCTTTGACGGAGGCAAAAAAATTAAGCTCCTATTTCCATTTTACT
Taeniopygia_guttata|9570       GAAGGT------CTGTCTTTGGTGGAGGCAAAAAAGTTAAGTTCCTATTTCCATTTCACT
                                                                                           

Danio_rerio|22509              GAGCCGGTTAACCTGAGGAACAAATCCATCTTGGAAATGTCTGAACTTAATCCTGCTCTT
Gasterosteus_aculeatus|27306   AAAGCGAAGAATCCGAATAAGAAAAGCATCGAGGAAATGGGGGATTTGAGTCCAGCTATC
Oryzias_latipes|14562          AAACCCAAGACTCTTCAAAAGAAACCCATCCCCGTGAAAGCGGAGTGGGCCCCAGCTATT
Tetraodon_nigroviridis|5571    AAGCCAAAACAGCTGAAGGAGAAATCCATCCTGGAAATGGCCGATTTGAACCCACGCATC
Fugu_rubripes|7227             AAGCcaaagaatcagaagaagagaCGCATCCTGGAAATGGCTGATTTGAACCCCGCTATC
Nematostella_vectensis|23593   GACCCTGTTCTCTTCAATCAAAAGTCTCTTCTTCAAAAGGCTGAACTGGACAAAGCAGTT
Branchiostoma_floridae|48500   GAGCCTCTGAAGCTGAAGGAGAAGACTCTGTTGGAGAAGGCCGATCTCGATCCATCCATC
Gorilla_gorilla|16823          GAGCCTGTTGAGCTAAAGAATAAAACCTTGCTTGAGAAGGCTGACCTGGACCCCTCCCTG
Rhesus_macaque|28911           GAGCCTGTTGAGCTAAAGAATAAGACCTTGCTTGAGAAGGCTGACCTGGACCCCTCCCTG
Microcebus_murinus|5423        GAGCCTGTTGATCTGAAGAATAAGACCTTGCTTGAGAAGGCTGATCTGGACCCCTCCCTG
Ornithorhynchus_anatinus|12977 GAGCCCGTCAACCTGAAGACCAAGACTCTGCTAGAGAAGGCCGACCTGGACCCCGCCATC
Tarsius_syrichta|2570          GAGCCTGTAGAGCTGAAGAATAAGACCTTGCTCGAGAAGGCTGATCTGGACCCCTCCCTG
Myotis_lucifugus|17998         GAGCCAGTTGACCTGAAGAACAAGACGTTGCTTGAGAAGGCAGACCTGGACCCCTCCCTG
Homo_sapiens|73880             GAGCCTGTTGAGCTAAAGAATAAGACCTTGCTTGAGAAGGCTGACCTGGACCCCTCCCTG
Pan_troglodytes|31973          GAGCCTGTTGAGCTAAAGAATAAGACCTTGCTTGAGAAGGCTGACCTGGACCCCTCCCTG
Procavia_capensis|7555         GAGGCTGTTGAACTGAAGAACAAGACCTTGCTGGAGAAGGCTGACTTGGACCCATCCCTG
Tupaia_belangeri|3420          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|7693       ------------------------------------------------------------
Felis_catus|40543              GAGCCTGTTCAGCTGAAGAACAAGACCTTGCTTGAGAAGGCTGACCTGGATCCCTCCCTG
Cavia_porcellus|5786           GAGCCTGTGAGCCTGAAGAACAAGACACTGCTGGAGAAGGCGGACTTGGACCCCTCCCTG
Macropus_eugenii|14010         GAGCCTGTGGAATTAAAGAACAAGAGCCTGCTGGAGAAAGCTGATTTGGACCCTTCTTTG
Ochotona_princeps|16778        GAGCCTGTGCTGCTGAAGAACAAGAGCTTGCTGGAGAAGGCTAGCCTGGACCCCTCGCTG
Monodelphis_domestica|11253    GAGCCTATAGAATTAAAGAACAAGAGCCTGCTGGAGAAAGCTGATTTGGACCCTTCCTTA
Dipodomys_ordii|2417           GAGGCTGTGGACCTGAAGAACAAGACCTTGCTTGAGAAGGCTAACCTGGACCCCTCCCTG
Dasypus_novemcinctus|4373      GAAGCTGTTGAACTGAAGAACAAGACCTTGCTTGAG---GCTGACTTGGACTCCTCTCTG
Oryctolagus_cuniculus|3583     GAGCCAGTGGAGCTGAGGAACAAGACCCTGCTGGAGAAGGCCAGCCTGGACCCCTCACTT
Loxodonta_africana|693         GAGGCTGTTGAACTGAAGAACAAGACCTTGCTTGAGAAGGCTGACTTGGACCCTTCCCTG
Erinaceus_europaeus|6081       NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|17689             GAGGCTATTGATCTGAAGAACAAGACCTTGCTGGAGAAGTCGGACTTGGAGCCCTCGCTG
Rattus_norvegicus|35242        GAGGCCATTGACCTGAAGAACAAGACCTTGCTTGAGAAGGCAGACTTGGAGCCCTCACTG
Equus_caballus|13635           GAGCCTGTTGAGCTGAAGAACAAGACCTTGCTTGAGAAGGCTGACCTGGACCCCTCCCTG
Canis_familiaris|3877          GAGCCTGTTGAGCTGAAGAACAAGACCTTACTTGAGAAGGCTGACCTGGACCCCTCCCTG
Callithrix_jacchus|31398       GAGCCTGTTGAGCTAAAGAACAAGACCTTGCTTGAGAAGGCTGACCTGGACCCCTCCTTG
Pongo_abelii|24761             GAGCCTGTTGAGCTAAAGAATAAGACCTTGCTTGAGAAGGCTGACCTGGACCCCTCCCTG
Tursiops_truncatus|16281       NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTCTGAG
Bos_taurus|14517               GAGCCTGTTGAGCTGAAGAACAAGACCTTGCTGGAGAAGGCTGAGCTCGACCCGTCCCTA
Sus_scrofa|17815               GAGCCTGTTGAGCTGAAGAACAAGACCTTGCTTGAGAAGGCCGACCTGGACCCTTCCCTA
Sus_scrofa|7737                ------------------------------------------------------------
Xenopus_tropicalis|15115       CCCTCGCTGAACCCCAAGAAGAAGTCCCTTCTGGAAAAGGCCGCGCTGGACCCCTCCATA
Anolis_carolinensis|2075       GAGCCTGAAAATCTGAAGAATAAAACTCTCTTGGAGAAAGCTGACTTAGATCCAGCCATT
Gallus_gallus|13422            GAGCCTGTTAACTTGAAGAATAAAACCCTGCTGGAAAAAGCTGACCTGGACCCATCCACT
Taeniopygia_guttata|9570       GAGCCTGCTAACCTGAAGAATAAAACCCTGCTGGAAAAGGCTGACCTGGACCCATCCACT
                                                                                           

Danio_rerio|22509              ---------------GACTTCCTAGATCCTTTGAGCGAAGACATTCTCAAA---GGG---
Gasterosteus_aculeatus|27306   ---------------GACTTCCTGGATACGCTGAGTGACGACATCCCTGAA---GGA---
Oryzias_latipes|14562          ---------------GATTTTCTGGACGTCCTGAGCGAGGACATTCCAAAA---GGA---
Tetraodon_nigroviridis|5571    ---------------GATTTCCTAGATGTTGTGAGTGATGACATCCCGAAA---GGA---
Fugu_rubripes|7227             ---------------GACTTCCTGGATGTTGTGAGCGATGACGTTCCAAAG---GGA---
Nematostella_vectensis|23593   ---------------GATTTCTTGGATCCAATTGACACAGACGTCCCCAAAGGAGGG---
Branchiostoma_floridae|48500   ---------------GACTTCCTGGACTCTATTGAAGAGGACATTCCCAGAGGAGGC---
Gorilla_gorilla|16823          ---------------GATTTCATGGACTCCTTGGAGCATGACATTCCCAAA---GGG---
Rhesus_macaque|28911           ---------------GATTTCATGGACTCCTTGGAGCATGACATTCCCAAA---GGG---
Microcebus_murinus|5423        ---------------GATTTCATGGACTCCTTGGAGCATGACATCCCCAAA---GNNNNN
Ornithorhynchus_anatinus|12977 ---------------GACTTCCTGGATTCCCTGGAACACGACATTCCCAAA---------
Tarsius_syrichta|2570          ---------------GACTTCATGGATTCCTTGGAGCATGACATCCCCAAA---GNNNNN
Myotis_lucifugus|17998         ---------------GACTTCATGGACTCCTTGGGGAGTGACATCCCCAAA---GGGTCT
Homo_sapiens|73880             ---------------GATTTCATGGACTCCTTGGAGCATGACATTCCCAAA---GGGTCT
Pan_troglodytes|31973          ---------------GATTTCATGGACTCCTTGGAGCATGACATTCCCAAA---GGGTCT
Procavia_capensis|7555         ---------------GACTTCATGGACTCCTTGGAGCATGATATCCCTAGA---GGGTCT
Tupaia_belangeri|3420          ---------------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NGGTCT
Choloepus_hoffmanni|7693       ------------------------------------------------------------
Felis_catus|40543              ---------------GACTTCATGGACTCCTTAGAGCATGACATCCCCAAA---GGGACT
Cavia_porcellus|5786           ---------------GATTTCCTGGACTCCTTGGAGTATGACATTCCTAAA---GGG---
Macropus_eugenii|14010         ---------------GACTTTTTGGATTCCCTGGAACATGATATTCCTAAA---GNNNNN
Ochotona_princeps|16778        ---------------GACTTCATGGACTCCCTGGAGCACGACATCCCTAAA---------
Monodelphis_domestica|11253    ---------------GACTTTCTGGACAACCTAGAACATGATATCCCTAAA---GGG---
Dipodomys_ordii|2417           ---------------GACTTCCTGGATTCCCTGGAGTATGACATCCCCAAA---GNNNNN
Dasypus_novemcinctus|4373      ---------------GACTTCATGGACTCCTTTGAGCATGACATCCCCAAA---GGG---
Oryctolagus_cuniculus|3583     ---------------GACTTCATGGACTCCCTGGAGCATGACATCCCCAAA---GGG---
Loxodonta_africana|693         ---------------GACTTCATGGACTCCTTGGAGCATGATATCCCCAGA---GGG---
Erinaceus_europaeus|6081       ---------------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------
Mus_musculus|17689             ---------------GATTTCCTGGACTCCCTGGAATATGACATCCCCAGA---GGG---
Rattus_norvegicus|35242        ---------------GATTTCCTGGACTCCCTGGAGTATGATATCCCCAGA---------
Equus_caballus|13635           ---------------GACTTCTTGGATTCCTTGGAGCATGACATCCCCAAA---GGG---
Canis_familiaris|3877          ---------------GACTTCATGGACTCCTTGGAGCATGACATCCCCAAA---GGG---
Callithrix_jacchus|31398       ---------------GATTTCATGGACTCCTTGGAGCACGATGTCCCCAAA---GGG---
Pongo_abelii|24761             ---------------GATTTCATGGACTCCTTGGAGCATGACATTCCCAAA---GGG---
Tursiops_truncatus|16281       GCGATTGTTCAGGGGAACTTCATGTCATCTGTGAGCAGGTATGGCTTAGAT---TGG---
Bos_taurus|14517               ---------------GACTTCATGGACTCTTTGGAGCACGACATCCCCAAA---GGG---
Sus_scrofa|17815               ---------------GACTTCATGGACTCCTTGGAGCATGACATTCCCAAA---GGG---
Sus_scrofa|7737                ------------------------------------------------------------
Xenopus_tropicalis|15115       ---------------GACTTCCTGGACTCACTAGAACATGATATTCCCAGA---GGT---
Anolis_carolinensis|2075       ---------------GATTTCTTGGATTCTCTTGAACATGATATTCCAAAA---GGG---
Gallus_gallus|13422            ---------------GACTTTCTGGACTCTCTGGAGCATGATGTCCCACAA---GGC---
Taeniopygia_guttata|9570       ---------------GACTTTCTAGACTCTCTGGAGCATGATATTCCACGA---GGC---
                                                                                           

Danio_rerio|22509              ------------------------------------------------------------
Gasterosteus_aculeatus|27306   ------------------------------------------------------------
Oryzias_latipes|14562          ------------------------------------------------------------
Tetraodon_nigroviridis|5571    ------------------------------------------------------------
Fugu_rubripes|7227             ------------------------------------------------------------
Nematostella_vectensis|23593   ------------------------------------------------------------
Branchiostoma_floridae|48500   ------------------------------------------------------------
Gorilla_gorilla|16823          ------------------------------------------------------------
Rhesus_macaque|28911           ------------------------------------------------------------
Microcebus_murinus|5423        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|12977 ------GTTACTGTAACGGGGCCGAGGGGCTGCCATTCCTGGCTTGGGCAGCAGAGACCG
Tarsius_syrichta|2570          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Myotis_lucifugus|17998         GAGGCAGTCATTCAGGACTTCGTGTCACTTGTGAGCAGGTCTGGCACAGGCTGGCCCTGT
Homo_sapiens|73880             GAGGCAGTTGTTCAGGGTGACTTCACGTGGCTTCTGAGCAGGTGTGGTTTTGGTTGGCCC
Pan_troglodytes|31973          GAGGCAGTTGTTCAGGGTGACTTCATGTGGCTTCTGAGCAGGTGTGGTTTTGGTTGGCCC
Procavia_capensis|7555         GAAACAGTTGTACAGGTCTTTGGGTCACCTCTAAGCAGATGTTGTTCAGGCTGTCCCTGT
Tupaia_belangeri|3420          GAGGTGATTGTTCAGGGTGACACGGTGTCATCTCTGAGCACGTGTGGCCTCGGTCAGCCC
Choloepus_hoffmanni|7693       ------------------------------------------------------------
Felis_catus|40543              GAGGTGACTGTTGACTCTTCACCCGTTAGCAGGTATGGTTTAGGTTGGGCCTGTCCCCAG
Cavia_porcellus|5786           ------------------------------------------------------------
Macropus_eugenii|14010         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|16778        ------------------------------------------------------------
Monodelphis_domestica|11253    ------------------------------------------------------------
Dipodomys_ordii|2417           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dasypus_novemcinctus|4373      ------------TCTGAACAAGGTGACTTCATGTCACTGAGCAGGGATGACGGTTGGCCA
Oryctolagus_cuniculus|3583     ------------------------------------------------------------
Loxodonta_africana|693         ------------------------------------------------------------
Erinaceus_europaeus|6081       ---------------------------------------------NNNNNNNNNNNNNNN
Mus_musculus|17689             ------------------------------------------------------------
Rattus_norvegicus|35242        ------------------------------------------------------------
Equus_caballus|13635           ------------------------------------------------------------
Canis_familiaris|3877          ------------------------------------------------------------
Callithrix_jacchus|31398       ------------------------------------------------------------
Pongo_abelii|24761             ------------------------------------------------------------
Tursiops_truncatus|16281       ------------------------------------------------------------
Bos_taurus|14517               ------------------------------------------------------------
Sus_scrofa|17815               ------------------------------------------------------------
Sus_scrofa|7737                ------------------------------------------------------------
Xenopus_tropicalis|15115       ------------------------------------------------------------
Anolis_carolinensis|2075       ------------------------------------------------------------
Gallus_gallus|13422            ------------------------------------------------------------
Taeniopygia_guttata|9570       ------------------------------------------------------------
                                                                                           

Danio_rerio|22509              ------------------------TCATGGAGC------------------CTGCAGCTG
Gasterosteus_aculeatus|27306   ------------------------TCATGGAGT------------------CTTCAGCGG
Oryzias_latipes|14562          ------------------------TCATGGAGT------------------CTCCAGTTT
Tetraodon_nigroviridis|5571    ------------------------TCGTGGAGT------------------CTTCAGTTC
Fugu_rubripes|7227             ------------------------TCGTGGAGT------------------CTTCAGTTA
Nematostella_vectensis|23593   ------------------------TCCTGGAGT------------------ATTCAATTT
Branchiostoma_floridae|48500   ------------------------TCCTGGAGT------------------GTGCAGTTT
Gorilla_gorilla|16823          ------------------------TCCTGGAGT------------------ATCCAGATG
Rhesus_macaque|28911           ------------------------TCCTGGAGT------------------ATCCAGATG
Microcebus_murinus|5423        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNG------------------GTCCTGGAG
Ornithorhynchus_anatinus|12977 GCTGGACGGCCGAGGGGCTGCCATTCCTGGCTT------GGGCAGCAGAGGCTCCTGGAG
Tarsius_syrichta|2570          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNG------------------ATCCTGGAG
Myotis_lucifugus|17998         ------------------------CCCTGGGACTCCTGCTCTGTGCCCATGGTCCTGGAG
Homo_sapiens|73880             TGTTCCTGGGACTCCTGCTCTGTGTCCATGAGG------------------GTCCTGGAG
Pan_troglodytes|31973          TGTTCCTGGGACTCCTGCTCTGTGTCCATGAGG------------------GTCCTGGAG
Procavia_capensis|7555         ------------------------TCCTGGGACTCCTGCTCTGTTCCCATGGTCCTGGAG
Tupaia_belangeri|3420          TGTCCTTGGGCCTCTTGCTCTGGGCCAATGTGG------------------GTCCTGGAG
Choloepus_hoffmanni|7693       ------------------------------------------------------------
Felis_catus|40543              GACTCCTGCTCTCTGTGC------CTGTGGAGG------------------GTCCTGGAG
Cavia_porcellus|5786           ------------------------TCCTGGAGC------------------ATCCAGCTG
Macropus_eugenii|14010         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNG------------------ATCCTGGAG
Ochotona_princeps|16778        ---------------------------------------------------GTCCTGGAG
Monodelphis_domestica|11253    ------------------------TCCTGGAGT------------------GTCCAGATG
Dipodomys_ordii|2417           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNG------------------GTCCTGGAG
Dasypus_novemcinctus|4373      CATCCCTGGGACTCCTGCTCTTTGCCGTGGATG------------------GTCCTGGAG
Oryctolagus_cuniculus|3583     ------------------------TCCTGGAGC------------------GTGCAGATG
Loxodonta_africana|693         ------------------------TCCTGGAGC------------------GTCCAGATG
Erinaceus_europaeus|6081       NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNG------------------CTCCTGGAG
Mus_musculus|17689             ------------------------TCTTGGAGC------------------ATCCAGATG
Rattus_norvegicus|35242        ---------------------------------------------------Gta------
Equus_caballus|13635           ------------------------TCCTGGAGC------------------ATCCAGATG
Canis_familiaris|3877          ------------------------TCCTGGAGC------------------ATCCAGATG
Callithrix_jacchus|31398       ------------------------TCCTGGAGT------------------ATCCAGATG
Pongo_abelii|24761             ------------------------TCCTGGAGT------------------ATCCAGATG
Tursiops_truncatus|16281       ------------------------CCCTGGGGC------------------GTCCTGGAG
Bos_taurus|14517               ------------------------TCTTGGAGT------------------GTCCAGATG
Sus_scrofa|17815               ------------------------TCCTGGAGC------------------ATCCAGACG
Sus_scrofa|7737                ------------------------------------------------------------
Xenopus_tropicalis|15115       ------------------------TCGTGGAGC------------------CTCCAGTTG
Anolis_carolinensis|2075       ------------------------TCCTGGAGT------------------ATCCAAGTG
Gallus_gallus|13422            ------------------------TCCTGGACC------------------GTCCAGTTT
Taeniopygia_guttata|9570       ------------------------TCCTGGAGT------------------ATCCAGCTG
                                                                                           

Danio_rerio|22509              GATCGGGGCGGCACTGTGTGTGTATTACGAAGTTTACTATGGCTGGGTTTCACCTTCTTC
Gasterosteus_aculeatus|27306   GAATGCGCCGGTAACGTGTGCGTGCTGCGCAGCCTGCTGTGGCTCGGACTGACCTTCTAC
Oryzias_latipes|14562          GAGTGTGCCAGGCGTGTGTGTGTGCTGCGCAGCCTCCTGTGGCTCGGTCTGACATTCTAC
Tetraodon_nigroviridis|5571    GAAGGTGCGGGCCAAGTGTGTGTACTCCGCAGCCTGCTGTGGCCGGGCCTGACGCTCTAC
Fugu_rubripes|7227             GAAGGTGCTGGCCAAGTGTGCATACTGCGCAGCCTCCTGTGGCCAGGCCTGACGCTCTAC
Nematostella_vectensis|23593   GAGCGAGGAAGTGGATTGGTCTCCCTGCGTAGCCTTCACTGGCTCGGATTCACCTTCTTT
Branchiostoma_floridae|48500   GAGCGTGGCAGTGGGCTGGTGGCCCTGCGCAGCCTGGTGTGGCTGGGTTACACGTTCTTC
Gorilla_gorilla|16823          GAGAGGGGCAATGCCCTGGTGGTGCTGCGCAGCCTGCTCTGGCCGGGCCTCACCTTCTAC
Rhesus_macaque|28911           GAGAGGGGCAATGCCCTGGTGGTGCTGCGCAGCCTGCTCTGGCCAGGCCTCACCTTCTAC
Microcebus_murinus|5423        CATCCAGATGGAGAGAGGCAATGCGTTGGTGGTGCTGCGCAGCCTGCTCTGGCCGGGCCT
Ornithorhynchus_anatinus|12977 CATCCAGATGGAAAGAGGCAACTCGCTGCTGGTGCTGCGGAGCCTGCTCTGGCCAGGCCT
Tarsius_syrichta|2570          CATCCAGATGGAAAGGGGCAACGCCTTGGTGGTGCTGCGCAGCCTGCTCTGGCCCGGCCT
Myotis_lucifugus|17998         CATCCAGATGGAGCGAGGCAACGCCCTGGTGGTGCTGCGCAGCCTGCTCTGGCCAGGCCT
Homo_sapiens|73880             CATCCAGATGGAGAGGGGCAATGCCCTGGTGGTGCTGCGCAGCCTGCTCTGGCCGGGCCT
Pan_troglodytes|31973          CATCCAGATGGAGAGGGGCAATGCCCTGGTGGTGCTGCGCAGCCTGCTCTGGCCGGGCCT
Procavia_capensis|7555         CATCCAGATGGAGCGGGGCAACACCTTAGTTGTGCTGCGCAGCCTGCTGTGGCCGGGCCT
Tupaia_belangeri|3420          CATCCAGATGGAGCGAGGCAACGCCCTGGTGGTGCTACGCAGCCTGCTTTGGCCAGGCCT
Choloepus_hoffmanni|7693       ------------------------------------------------------------
Felis_catus|40543              CATCCAGATGGAGAGGGGCAACGCACTGGTGGTGCTGCGCAGCCTGCTCTGGCCAGGCCT
Cavia_porcellus|5786           GAGCGGGGCAACTCGCTGGTGGTGCTGCGCAGCCTGCTGTGGCCGGGCCTGACCTTTTTC
Macropus_eugenii|14010         TATCCAGATGGAGAGGGGTGCACT---GGTTGTGCTTCGAAGCTTGCTCTGGCCAGGCCT
Ochotona_princeps|16778        CATCCAGATGGAGAGAGGCAACGCCCTGGTGGTGCTCCGCAGCCTGCTGTGGCCTGGACT
Monodelphis_domestica|11253    GAGAGAGGAAATGCATTGGTTGTACTACGAAGTTTGCTTTGGCCAGGGCTGACATTCTTC
Dipodomys_ordii|2417           CATCCAGATGGAGAGGGGCAACGCTCTGGTGGTGCTACGCAGCCTGCTCTGGCCAGGCCT
Dasypus_novemcinctus|4373      CATCCAGATGGAGAGGGGCCACGCCTTGGTGGTGCTGCGCAGCCTGCTCTGGCCAGGCCT
Oryctolagus_cuniculus|3583     GAGAGGGGCAACGCCTTGGTGGTGCTGCGCAGCCTGCTCTGGCCGGGCCTCACCTTCTAC
Loxodonta_africana|693         GAGCGAGGCAACACCTTGGTTGTGCTGCGCAGCCTGCTCTGGCCAGGTCTCACCTTCTAC
Erinaceus_europaeus|6081       CATGCAGATGGAGAGGGGCAACACGCTGGTGGTGCTGCGCAGCCTGCTCTGGCCAGGCCT
Mus_musculus|17689             GAAAGGGGCAACGCACTGGTGGTGCTGCGCAGCCTGCTCTGGCCAGGCCTCACCTTCTAC
Rattus_norvegicus|35242        ------------------------------------------------------------
Equus_caballus|13635           GAGAGGGGCAATGCCCTGGTGGTCCTGCGCAGCCTGCTCTGGCCAGGCCTTACCTTCTTC
Canis_familiaris|3877          GAGAGGGGCAACGCCCTGGTGGTGCTGCGCAGCCTGCTCTGGCCGGGCCTCACCTTCTTC
Callithrix_jacchus|31398       GAGAGGGGCAACGCCCTGGTGGTACTGCGCAGCCTGCTCTGGCCAGGCCTCACCTTCTAT
Pongo_abelii|24761             GAGAGGGGCAATGCCCTGGTGGTGCTGCGCAGCCTGCTCTGGCCGGGCCTCACCTTCTAC
Tursiops_truncatus|16281       CATCCAGATGGAGAGAGGCAACACCCTGGTGGTGCTGCGCAGCCTGCTCTGGCCAGGTCT
Bos_taurus|14517               GAGAGGGGCAACGCCCTGGTGGTGCTGCGCAGCCTGCTCTGGCCCGGCCTCACCTTCTAC
Sus_scrofa|17815               GAGCGGGGCAACGCCCTGGTGGTGCTGCGCAGCTTGCTCTGGCCAGGCCTCACCTTCTAC
Sus_scrofa|7737                ------------------------------------------------------------
Xenopus_tropicalis|15115       GAGCAGGGGGACAGTGTTCTGATCCTGCGCAGCCTCCTATGGCTGGGAATGACTTTCTAT
Anolis_carolinensis|2075       GAGAGAGGAGGCAGAGTGCTAATACTACGAAGTCTCCTATGGCTTGGGCTTACATTCTAC
Gallus_gallus|13422            GAGAAGGGAGGCACTGTGGTTGTGTTGAGAAGTCTGCTGTGGCTTGGACTGACATTCTAC
Taeniopygia_guttata|9570       GAGAAGGGAGGCACTGTGGTTGTGCTGCGGAGCCTGCTGTGGCTGGGACTGACATTCTAT
                                                                                           

Danio_rerio|22509              CATGTTCCCCAGACTCCTCAACATGGG------TACATATACATGGGAGATGGCCTC---
Gasterosteus_aculeatus|27306   CATCTGCCGATGACGCCGCAGCACGGA------TACATCTACATCGGCGATGGGACC---
Oryzias_latipes|14562          CATGTGCCAATGACACCACAGCACGGA------TACATTTATGTGGGCCTTGGAATG---
Tetraodon_nigroviridis|5571    CACGTGCTGAAGACACCACAGCACGGA------TATATTTATATTGGTAATGGGAAT---
Fugu_rubripes|7227             CATGTGCTGATGACGCCACAGCATGGT------TATATTTATATCGGGAGCGGGATG---
Nematostella_vectensis|23593   CACGTGCCAGAGACAAGAAAATATGGG------ATGGTTTATATTGGAACAGGGAAC---
Branchiostoma_floridae|48500   CATGTTCCTGGTACACTCAAGTTTGGC------TCAATGTACATTGGAAATGGCGAG---
Gorilla_gorilla|16823          CATGCTCCCCGCACCAAGAACTATGGC------TACATCTACGTGGGCACTGGCGAG---
Rhesus_macaque|28911           CATGCTCCCCGCACCAAGCACTATGGC------TACATCTACGTGGGCACTGGTGAG---
Microcebus_murinus|5423        CACCTTCTACCATGCTCCCCGCACCAAGAACTATGGCTACATCTACGTGGGCACTGGCGA
Ornithorhynchus_anatinus|12977 GACCTTCTTCCACGTCCCCCAGACCAAGAACTACGGCTACTTCTACGTGGGCACGGGAGA
Tarsius_syrichta|2570          CACCTTCTACCACGCCCCCCGCACCAAGAACTACGGCTCCATCTATGTGGGCACCGGCGA
Myotis_lucifugus|17998         CACCTTCTTCCACGCTCCGGGCACCAAGAACTGTGGCTACATCTATGTGGGCACTGG---
Homo_sapiens|73880             CACCTTCTACCATGCTCCCCGCACCAAGAACTATGGCTACGTCTACGTGGGCACTGGCGA
Pan_troglodytes|31973          CACCTTCTACCATGCTCCCCACACCAAGAACTATGGCTACATCTACGTGGGCACTGGCGA
Procavia_capensis|7555         CACCTTCTACCACGCTCCCTACACCAGGAACTACGGCTACATCTACGTGGGCACAGGGGA
Tupaia_belangeri|3420          CACCTTCTTCCACGCCCCCCGCACCAGGAACTATGGCTACATCTACGTGGGCACTGGCGA
Choloepus_hoffmanni|7693       ------------------------------------------------------------
Felis_catus|40543              CACCTTCTTCCATGCTCCCCGCACCAAGAACTGTGGCTACATCTACGTGGGTACCGG---
Cavia_porcellus|5786           CACACCCCGCGCACCAGGAACCACGGC------TACATCTACGTGGGCACCGGCGAG---
Macropus_eugenii|14010         GACCTTCTATCATGCTCCCCGGACCAAGAATCACGGTTATATTTATGTGGGCACTGG---
Ochotona_princeps|16778        CACCTTCTACCACACTCCTCGCACGAG---CTACGGCTATATCTACGTGGGCACCGG---
Monodelphis_domestica|11253    CATGCTCCCAGGACCAAGAACCATGGT------TATATTTATGTGGGCACTGGTGAG---
Dipodomys_ordii|2417           CACCTTCTACCATGCTCCTCGTACCAAAAACTATGGCTACATCTACGTGGGCACTGG---
Dasypus_novemcinctus|4373      CACCTTCTTCCATGCGCCCCGCACCAAGAACTACGGCTACATCTACGTTGGCACTGG---
Oryctolagus_cuniculus|3583     CACACTCCCAACACCAAGAGCTACGGC------TACGTCTACGTGGGCACTGGCGAG---
Loxodonta_africana|693         CATGCCCCCTGCACCAAGAACTACGGC------TACATCTACGTGGGCACCGGGGAG---
Erinaceus_europaeus|6081       CACCTTCTTCCACGCTCCCCACACCAAGAACTGTGGCTACATGGACGTGGGCACTGG---
Mus_musculus|17689             CACGCTCCTCGCACCAAGAACTATGGC------TACATCTACGTAGGCACAGGAGAG---
Rattus_norvegicus|35242        ------------------------------------------------------------
Equus_caballus|13635           CACGCTCCCCGCACCAAGAACTGTGGC------TACATCTACGTGGGCACCGGTGAG---
Canis_familiaris|3877          CATGCTCCCCGCACCAAGAACTATGGC------TACATCTACATGGGCACTGGTGAG---
Callithrix_jacchus|31398       CATGCTCCCCGCACCAGGAACTATGGC------TACATCTATGTGGGCACTGGTGAG---
Pongo_abelii|24761             CATGCTCCCCGCACCAAGACCTATGGC------TACATCTACGTGGGCACTGGTGAG---
Tursiops_truncatus|16281       CACCTTCTACCATGCTCCTCGCACCAAGAACTATGGCTACATCTACGTGGGCACTGG---
Bos_taurus|14517               CACGCTCCTCGCACCAAAAACTATGGC------TACATCTACGTGGGCACCGGCGAG---
Sus_scrofa|17815               CATGCTCCCCGCACTAAGAACTGCGGC------TACATCTACGTGGGCACCGGCGAG---
Sus_scrofa|7737                ------------------------------------------------------------
Xenopus_tropicalis|15115       CATGTGCCCCTCACCCCACTGCATGGG------CACCTTTACATTGGCACCGGGGAG---
Anolis_carolinensis|2075       CATGTTCACAATACAAAACAGCATGGT------TATATCTACTTTGGCAATGGAGAG---
Gallus_gallus|13422            CATGTCCCAATGACTAAGCAATACGGC------TACATCTACTGTGGCACTGGTGAG---
Taeniopygia_guttata|9570       CATGTCCCAATGACCAAGCAATTTGGC------TACGTCTATTTTGGCACTGGTGAG---
                                                                                           

Danio_rerio|22509              ATGAACCTTGACCTGCCCTTCATGTTA---------------------------------
Gasterosteus_aculeatus|27306   AAGAACCTGAACCTTCCCTTCATGCTG---------------------------------
Oryzias_latipes|14562          AAAAATCTCGATCTTCCATTCATGCTG---------------------------------
Tetraodon_nigroviridis|5571    AGGAATTTGGACCTTCCTTTCATGCTT---------------------------------
Fugu_rubripes|7227             AAAAATTTGGACCTTCCTTTCATGCTT---------------------------------
Nematostella_vectensis|23593   AAGAATCTAGACTTGCCATTCATGCTG---------------------------------
Branchiostoma_floridae|48500   AAGAACAACGACTTACCATTTATGTTG---------------------------------
Gorilla_gorilla|16823          AAGAACATGGACTTGCCCTTCATGCTA---------------------------------
Rhesus_macaque|28911           AAGAACATGGACTTGCCTTTCATGCTA---------------------------------
Microcebus_murinus|5423        GAAGAACATAGACTTGCCCTTCATGCTATAGGATGGAGGCCAGCCTGGATATTT------
Ornithorhynchus_anatinus|12977 GAAAAATATGGATCTGCCCTTCATGCTGTGAGCCGGCCTGGGGCCCAGCCCGCGGCGGAC
Tarsius_syrichta|2570          GAAGAACATGGACTTGCCCTTCATGCTGTAGGAAGGGTCAGATTTAGCAGAGTCCGA---
Myotis_lucifugus|17998         GAAGAACATGGACTTGCCCTTCATGCTGTAGGAGGCCCGCCCAGGGACTGCGTATGTAGA
Homo_sapiens|73880             GAAGAACATGGACTTGCCCTTCATGCTATAGAATGGGAGCCAGCCTGGATGTTTTTAAAC
Pan_troglodytes|31973          GAAGAACATGGACTTGCCCTTCATGCTATAGAATGGGAGCCAGCCTGGATGTTTTTAAAC
Procavia_capensis|7555         GAAGAACATAGACCTGCCCTTCATGCTGTAGGACGGCGGTTGGCCTGGGGTGTCTGTAGA
Tupaia_belangeri|3420          GAAGAACCTGGACTTGCCCTTCATGCTGTAGGATGGGAGGGCCGGATGGTCGTATGCAGT
Choloepus_hoffmanni|7693       ------------------------------------------------------------
Felis_catus|40543              GAAGAACATAGACCTCCCCTTCATGCTCTAGGGGGGGCAGGGGTGTCAGCCTGGGGTTTA
Cavia_porcellus|5786           AAGAACATGGATTTGCCTTTCATGCTG---------------------------------
Macropus_eugenii|14010         GAAGAACATAGACCTACCCTTCATGCT---------------------------------
Ochotona_princeps|16778        CGAGAAGAACATAGACCTGCCCTTCATGCTGTACCAGGGTGGCTGCTCTTTGGCGGC---
Monodelphis_domestica|11253    AAGAACATAGACTTGCCCTTCATGCTG---------------------------------
Dipodomys_ordii|2417           GAAGAACTTGGACTTGCCCTTCATGCTGTAGGAGCGCCAGGCTGGATTTTAATCTTA---
Dasypus_novemcinctus|4373      GAAGAACATGGACTTGCCCTTCATGCTATAGGATGGGGGCCAGTCCGGGCGTTTTGTATG
Oryctolagus_cuniculus|3583     AAAAACATAGACCTGCCCTTCATGCTG---------------------------------
Loxodonta_africana|693         AAGAACATAGACTTACCCTTCATGCTG---------------------------------
Erinaceus_europaeus|6081       GAAGAACATAGA------------------------------------------------
Mus_musculus|17689             AAGAACATGGACTTGCCCTTCATGCTG---------------------------------
Rattus_norvegicus|35242        ------------------------------------------------------------
Equus_caballus|13635           AAGAACATAGACTTGCCCTTCATGCTG---------------------------------
Canis_familiaris|3877          AAGAACATAGACCTCCCCTTCATGCTG---------------------------------
Callithrix_jacchus|31398       AAGAACATGGACTTGCCCTTCATGCTA---------------------------------
Pongo_abelii|24761             AAGAACATGGACTTGCCCTTCATGCTA---------------------------------
Tursiops_truncatus|16281       CGAGAAGAACATCGACCTGCCGTTCATGCTGTAGGAGGGCTGCCAGTCTGGAGAGTC---
Bos_taurus|14517               AAGAACCTAGACCTGCCCTTCATGCTG---------------------------------
Sus_scrofa|17815               AAGAACATGGACCTGCCCTTCATGCTG---------------------------------
Sus_scrofa|7737                ------------------------------------------------------------
Xenopus_tropicalis|15115       CGCAACCTCGACCTTCCATTCATGATC---------------------------------
Anolis_carolinensis|2075       AAGAACATAGATTTGCCTTTCATGCTA---------------------------------
Gallus_gallus|13422            AAGAACTTAGATCTGCCTTTCATGCTG---------------------------------
Taeniopygia_guttata|9570       AAGAATCTTGATCTGCCCTTCATGCTG---------------------------------
                                                                                           

Danio_rerio|22509              ---------TAA
Gasterosteus_aculeatus|27306   ---------TGA
Oryzias_latipes|14562          ---------TGA
Tetraodon_nigroviridis|5571    ---------TGA
Fugu_rubripes|7227             ---------TGA
Nematostella_vectensis|23593   ---------TAG
Branchiostoma_floridae|48500   ---------TAA
Gorilla_gorilla|16823          ---------TAG
Rhesus_macaque|28911           ---------TAG
Microcebus_murinus|5423        ------------
Ornithorhynchus_anatinus|12977 CCAAAG------
Tarsius_syrichta|2570          ------------
Myotis_lucifugus|17998         GCATCA------
Homo_sapiens|73880             AGAGTC---TAA
Pan_troglodytes|31973          AGAGTC---TAA
Procavia_capensis|7555         CTC------TAG
Tupaia_belangeri|3420          GCATCA------
Choloepus_hoffmanni|7693       ------------
Felis_catus|40543              TGTAGAGTCTGA
Cavia_porcellus|5786           ---------TAG
Macropus_eugenii|14010         ------------
Ochotona_princeps|16778        ---------TGA
Monodelphis_domestica|11253    ---------TGA
Dipodomys_ordii|2417           ---------TAA
Dasypus_novemcinctus|4373      AGAGCC---TAA
Oryctolagus_cuniculus|3583     ---------TAG
Loxodonta_africana|693         ---------TAG
Erinaceus_europaeus|6081       ------------
Mus_musculus|17689             ---------TAG
Rattus_norvegicus|35242        ---------taa
Equus_caballus|13635           ---------TAG
Canis_familiaris|3877          ---------TAG
Callithrix_jacchus|31398       ---------TAG
Pongo_abelii|24761             ---------TAG
Tursiops_truncatus|16281       ---------TAA
Bos_taurus|14517               ---------TAG
Sus_scrofa|17815               ---------TAG
Sus_scrofa|7737                ------------
Xenopus_tropicalis|15115       ---------TGA
Anolis_carolinensis|2075       ---------TGA
Gallus_gallus|13422            ---------TGA
Taeniopygia_guttata|9570       ---------TGA
                                           

multiple sequence alignment in CLUSTALW format


Danio_rerio|3915              MDSDSLHYSLDLAAANGLTLSSEQRAALQSSLLIVKRNYKFSRVLFWGKILGIKSDYFIA
Gasterosteus_aculeatus|17039  MDCSSSCCSLDLVAGNGCTLSVEHRAALQTSMVLLKKNYKFQRVLLWGKIFGLNRDYFIA
Oryzias_latipes|20306         MDFNSLPYSLEFVAGSGCILTLEERTALQTSLVIVKTNYKFQRILFWGKILGLQHDYFVA
Tetraodon_nigroviridis|7250   MDSQSLHYSLEHVGSSGYNLNIEQRAALQSSLLILKKNYKFHRILFWGKILCLKEDYFIA
Fugu_rubripes|38794           MDSESLQYSLEHVAGSGYKLNIEQQAALQTSILIMKKNYKFQRVLFWGKILSLKEEYFIA
Nematostella_vectensis|13288  -------------------------------------NYKFEKVRYWGKILGVKNDYFII
Branchiostoma_floridae|3845   MDSEDLIQYVDFVASSGVVLSSEQKAALQTSLVIMKNHYKFHRVYLWGKILGIKDDYFIA
Gorilla_gorilla|13491         MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIA
Rhesus_macaque|28426          MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIA
Microcebus_murinus|4611       MDAEGLLLSLELASGSGQGLGPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVSDYYIA
Ornithorhynchus_anatinus|2861 MEAEALLLSLELAAGSGQGLSPDRRAALLTSLLILRRDYRYRRVLFWGRILGLTADYYIA
Tarsius_syrichta|2355         ------------------------------------------RVLLQICILGLVGDHFIS
Myotis_lucifugus|16194        ------------------------------------------------------------
Homo_sapiens|53072            MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIA
Pan_troglodytes|24203         MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIA
Procavia_capensis|7091        MDCESLLLSLELASGSGLGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIA
Tupaia_belangeri|2966         MDAESLLLSLELASGSGQGLSPD-RVSLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIA
Choloepus_hoffmanni|6795      MDAESLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIA
Felis_catus|6283              MDAESLLLSLELASGSGQGLSPDRRASLLTSLPLVKRDYRYDRVLFWGRILGLVADYYIA
Cavia_porcellus|4497          MDTESLMLSLELAAGSGQGLSPDRRAALLTSLLLVKRDYRYNRVLFWGRILGIVADYYIA
Macropus_eugenii|12743        MDSESLLLSLELASGSGQGLSPDRRASLLTSLLLVKRDYRYERVLFWGRILGLVADYYIA
Ochotona_princeps|14628       MDAESLLLSLELASGSGQGLSPDRRASLLTSLTLVKRDYRYSRVLFWGRILGVVADYYIA
Monodelphis_domestica|24408   MDSESLLLSLELASGSGQGLSPDRRASLLTSLLLVKRDYRYDRVLFWGRILGLVADYYIA
Dipodomys_ordii|2265          ------------------------------------------------------------
Dasypus_novemcinctus|3855     MDAESLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIA
Oryctolagus_cuniculus|14664   MDAESLLLSLELASGSGQGLSPDRRASLLTSLTLVKRDYRYNRVLFWGRILGVVADYYIA
Loxodonta_africana|16291      MDSESLLLSLELASGSGQGLSPDRRASLLTSLLLVKRDYRYDRILFWGRILGLVADYYIA
Erinaceus_europaeus|4993      MDSESLLLSLELASGSGQGLSPDRRASLLTSLTLVKRDYRYDRVLFWGRILGIVADYYIA
Mus_musculus|10923            MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRFARVLFWGRILGLVADYYIA
Rattus_norvegicus|21377       MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRFARVLFWGRILGLVADYYIA
Equus_caballus|621            ------------------------------------------------------------
Canis_familiaris|7966         ------------------------------------------------------------
Callithrix_jacchus|23304      MDAESLLLSLELASGSGQGLSPDRRASLLTSLLLVKRDYRYDRVLFWGRILGLVADYYIA
Pongo_abelii|14140            MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIA
Tursiops_truncatus|15412      MDEESLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRFDRVLFWGRILGLVDDYYIA
Bos_taurus|11696              MDAESLLLALELASGSGQGLSPDRRASLLTSLMLVKRDYRFDRVLFWGRILGLVADYYIA
Sus_scrofa|1839               MDSESLLLSLELASGSGQGLSPDRRASLLTSLTLVKRDYRFDRVLFWGRILGLIADYYIA
Sus_scrofa|17263              MDSESLLLSLELASGSGQGLSPDRRASLLTSLTLVKRDYRFDRVLFWGRILGLIADYYIA
Xenopus_tropicalis|16003      ------------------------------------------------------------
Anolis_carolinensis|542       MDAEALPYALDLVASSGVCLSPEKRAALRNSLLLVRRDYRFEQVRLWGRIQGIRGAYYIA
Gallus_gallus|12587           MEPAALPTALQLAASGDTGLSLEKRAALGASLLLLQRDYRFERVWFWGCIQGVRGTYYIA
Taeniopygia_guttata|11890     MEALSLPAALALVAGGGAGLSPERRAALGASLPLVQRDYRFERVWFWGCIQGLRGAYYIA
                                                                                          

Danio_rerio|3915              QGVEDDELKNRKSLY--SLNCVDWHLLPPATESMIADVALAATGRFTGDPSHEYEHTEIR
Gasterosteus_aculeatus|17039  QGRGEDEMLDKKNLY--SFNCMDWFLLPSATDSMVEDAAIAAKRRFIGDPSFVYERLEMS
Oryzias_latipes|20306         QGRGEDEMTDRKSLY--SLNCVDWLLLPSVTDAMVEEVSKAAQGRFKGNPSFVYEHKVSQ
Tetraodon_nigroviridis|7250   QGRGEDELQDKRNLY--SFNCVEWLLLPPVTEDMIKQVSQAAKGRFRGDPSYLYEHLEVS
Fugu_rubripes|38794           QGRGEDEMQDKRNLY--SFNCIDWLLLPPITEDMMKAVSVAAKGRFRGDPSYVYEHLEAL
Nematostella_vectensis|13288  QGVGKDELKERKTLY--SQDCIHWGLLPVVTDKMRHDCSF-VKGRFTGDPSYEYEHTETV
Branchiostoma_floridae|3845   QGVSRDEMAERKTLY--SLDCVQWNLLPPATKAMRDHTSV-VKGRFTGDPSYEYEHTEIR
Gorilla_gorilla|13491         QGLSEDQLAPRKTLYRKSLLRSEWAKWPESVASTVLGSSW-GSGRQVGKIAKRKEGSEKD
Rhesus_macaque|28426          QGLSEDQLAPRKTLY--RGR-AGWAGQPMEPREMWAGSEM-RPRAWWGGPGDGQEEENLD
Microcebus_murinus|4611       QGVSEDQLAPRKTLY--XXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXX
Ornithorhynchus_anatinus|2861 QGLGPDQLGDRKTLY--SLNCMEWSLLPPATEKIVTQTSV-VKGRFVGDPSHEYDHTEVQ
Tarsius_syrichta|2355         QGMREDQLAPRQTLY--XXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXX
Myotis_lucifugus|16194        ------------------------------------------------------------
Homo_sapiens|53072            QGLSEDQLAPRKTLY--SLNCTEWSLLPPATEEMVAQSSV-VKGRFMGDPSYEYEHTELQ
Pan_troglodytes|24203         QG----------------------------------------------------------
Procavia_capensis|7091        QGLSEDQLAPRKTLY--XXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXX
Tupaia_belangeri|2966         QGLSEDQLAPRKTLY--XXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXX
Choloepus_hoffmanni|6795      QGLSEDQLAPRKTLY--XXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXX
Felis_catus|6283              QGLSEDQLAPRKTLY--XXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXX
Cavia_porcellus|4497          QGLAEDQLAPRKTLY--SLNCMEWSLLPPATEEMAAQVAT-VKGRFMGDPSHEYEQTEFQ
Macropus_eugenii|12743        QGLAEDQLEERKSLY--SLNCMEWSLLPPATEEMVTRTSV-VKGRFMGDPSHEYEHVEMQ
Ochotona_princeps|14628       QGLSENQLAPRKTLY--SLNCIEWSLLPPATEEMAAQTAM-VKGRFMGDPSHEYEHTELQ
Monodelphis_domestica|24408   QGLGPDQLGERKSLY--SLNCMEWSLLPPATEEMVTQTSV-VKGRFMGDPSHEYEHVEMQ
Dipodomys_ordii|2265          ------------------------------------------------------------
Dasypus_novemcinctus|3855     QGLSEDQFAPRKTLY--SLNCTEWSLLPPATEEMMAQTSV-VNGRFMGDPSHEYEHTELQ
Oryctolagus_cuniculus|14664   QGLSENQLAPRKTLY--SLNCVEWSLLPPATEEMAAQTAV-VKGRFMGDPSHEYEHTELQ
Loxodonta_africana|16291      QGLTEDQLAPRKTLY--SLNCMEWSLLPPATEEMLLQTSV-VSGRFMGDPSHEYEHTELQ
Erinaceus_europaeus|4993      QGLSADQLAPRKTLY--SLNCMEWSLLPPATEEMMTQTSV-VKGRFMGDPSHEYEHTEMQ
Mus_musculus|10923            QGLSEDQLAPRKTLY--SLNCTEWSLLPPATEEMAMQISV-VSGRFMGDPSHEYEHTELQ
Rattus_norvegicus|21377       QGLSEDQLAPRKTLY--SLNCTEWSLLPPATEEMVTQTSV-VSGRFMGDPSHEYEHTELQ
Equus_caballus|621            -----------------SLNCMEWSLLPPATDEMMVQTSV-VKGRFTGDPSHEYEHTELQ
Canis_familiaris|7966         QGLSEDQLAPRKTLY--SLNCMEWSLLPPATEEMAVETSV-VKGRFMGDPSHEYEHTELQ
Callithrix_jacchus|23304      QGLSEDQLAPRKTLY--SLNCTEWSLLPPATEEMVAQSSV-VKGRFMGDPSYEYEHIELQ
Pongo_abelii|14140            QGLSEDQLAPRKTLY--SLNCTEWSLLPPATEEMVAQSSV-VKGRFMGDPSYEYEHTELQ
Tursiops_truncatus|15412      QGLSEDQLAPRKTLY--SLNCMEWSLLPPATEEMEMQTSV-VKGRFMGDPSHAYEHTELQ
Bos_taurus|11696              QGVSEDQLAPRKTLY--SLNCMEWSLLPPATKEMETQTSV-VKGRFMGDPSHEYEHTELQ
Sus_scrofa|1839               QGLSEDQLAPRKTLY--SLNCMEWSLLPPATEEMVTQTSV-VKGRFMGDPSHEYEHTELQ
Sus_scrofa|17263              QGLSEDQLAPRKTLY--SLNCMEWSLLPPATEEMVTQTSV-VKGRFMGDPSHEYEHTELQ
Xenopus_tropicalis|16003      -----------------SLNCVDWCLLPPATDAHIAQTQG-IKGRFVGDPAHEYEYIVRN
Anolis_carolinensis|542       EGLGPDRAGARSRLY--SLNCVDWSLLPPPTEEMVTLTAG-LKGRFQGDPSYEYEQPEKK
Gallus_gallus|12587           QGLGPDLAAPRSRLY--SLNCVEWSLLPPATVEMVEQAAL-LKGLFQGDPSFEYEYAEVN
Taeniopygia_guttata|11890     EGLGPDRAAPRCRLY--SLNCLDWSLLTPATEEMLVLAEQ-LKGHFQGDPSFEYSLAEIN
                                                                                          

Danio_rerio|3915              TE-G-EGDEATHEEVT--VKVIEASRLAAIVSNIDKDVSVVPRGAFIKSPNGKVQTNRSF
Gasterosteus_aculeatus|17039  E--G-QGGAA-EGEVG--ATVSEERRLAATVHQIDEDASVVPRGAFVKSPRGLVHVNRSF
Oryzias_latipes|20306         QEGK-EQEKVVRKLLH--FSVTEEKRLAVTVHHIDEEASVVPRGAFIQSLRGLVQTNRSF
Tetraodon_nigroviridis|7250   ---G-KSEEFPKRSPT---KVSEECRLAVTIHQIDEEVSVIPRGAFIKDLQGLVQVNPSF
Fugu_rubripes|38794           N--T-RSVMVFLLNPWLQSKVSEENRLAVVIHQIDEEASVVPRGAFIRDLRGLVQVNRSF
Nematostella_vectensis|13288  KIDNQDGEKTEGGEEENTILIKEEDRLATTIEAIDYDVRIVPRGSYIRTATGAVIENRSF
Branchiostoma_floridae|3845   KI-G-EGEDATEEEHT--IQVKEEDRLTSVIATIDEEVAIAPRGAFIKTPHGEVIRNRSF
Gorilla_gorilla|13491         FL-S-QQKKVRKKEPE--VQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTF
Rhesus_macaque|28426          R--K-EGEGLPRVICV---QIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTF
Microcebus_murinus|4611       XX-X-XXXXXXXXXXX-----------------XXXXXXXXXXXXXXXXXXXXXXXXXXX
Ornithorhynchus_anatinus|2861 KV-E-EGDKTYEEEVV-----------------IDKAVAIIPRGALVKTPLGPVHVNRSF
Tarsius_syrichta|2355         XX-X-XXXXXXXXXXX-----------------IDKAVAIIPRGALFRTPFGPTHVNRVF
Myotis_lucifugus|16194        ---------------------------------IDKAVAIIPRGALFKSPFGPTHVNRTF
Homo_sapiens|53072            KV-N-EGEKVFEEEIV-----------------IDKAVAIIPRGALFKTPFGPTHVNRTF
Pan_troglodytes|24203         ---------------------------------IDKAVAIIPRGALFKTPFGPTHVNRTF
Procavia_capensis|7091        XX-X-XXXXXXXXXXX-----------------IDKAVAIIPRGALFKTPFGPTHVNRTF
Tupaia_belangeri|2966         XX-X-XXXXXXXXXXX-----------------IDKAVAIIPRGALFKTPFGPIHVNRTF
Choloepus_hoffmanni|6795      XX-X-XXXXXXXXXXX-----------------IDKAVAIIPRGALFKTPFGPIHVNRTF
Felis_catus|6283              XX-X-XXXXXXXXXXX-----------------IDKAVAIIPRGALFKTPFGPIHVNRTF
Cavia_porcellus|4497          KMSS-EGEKPFTQAFT--VQVKEETRLVSVIDQIDKAVAIIPRGAFFKTPYGPVHVNRTF
Macropus_eugenii|12743        RM-N-EGDRTYEDEVV-----------------IDKAVSVIPRGALFKTPFGPVHVNRTF
Ochotona_princeps|14628       KT-S-DGDKAFEEEVV-----------------ID-AVAVIPRGALF-TPFGPIHVNRTX
Monodelphis_domestica|24408   RM-T-EGDRTYEDEVV--IQIKEESRLVSVIDQIDKAVAIIPRGAFFKTPFGPVHVNRTF
Dipodomys_ordii|2265          ---------------------------------IDRAVAIVPRGALFKTPFGSTHVNRTF
Dasypus_novemcinctus|3855     KM-T-EGDKVFEEEVV-----------------IDKAVAIIPRGALFKTPFGPIHVNRTF
Oryctolagus_cuniculus|14664   RV-N-EGDKAFEEEVV--VQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPIHINRTF
Loxodonta_africana|16291      KM-N-DGDKVFEEEVV--IQIKEETRLVSIIDQIDKAVAIIPRGALFKTPFGPTHVNRTF
Erinaceus_europaeus|4993      KV-N-DGEKVFDEEVVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Mus_musculus|10923            KV-N-EGEKVFDEEVV--VQIKEETRLVSIIDQIDKAVAIIPRGALFKTPFGVTHVNRTF
Rattus_norvegicus|21377       KV-S-EGDKVFDEEVV--VQIKEETRLVSIIDQIDKAVAIVPRGALFKTPFGVTHVNRTF
Equus_caballus|621            KV-T-DGEKVFEEEVI--VQIKEETRLVSIIDQIDKAVSVIPRGALFKTPFGPVHVNRTF
Canis_familiaris|7966         KM-K-EGEKVFEEEVV--VQIKEENRLVSVINQIDKAVAVIPRGALFKTPFGPIHVNRTF
Callithrix_jacchus|23304      KV-N-EGEKVFEEEVV--IQIKEETRLVYVIDQIDKAVAIIPRGALFKTPFGPTHVNRTF
Pongo_abelii|14140            KV-N-EGEKVFEEEVV--VQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTF
Tursiops_truncatus|15412      KV-N-EGEKVFEEEVV--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Bos_taurus|11696              KV-N-EGEKVFEEEVV--VQIKEETRLVSVIDQIDKAVAVIPRGALFKTPFGPINVNRTF
Sus_scrofa|1839               KV-N-EGEKVFEEEVV--VQIKEETRLVSIIDQIDKAVAVIPRGALFKTPFGPIHVNRTF
Sus_scrofa|17263              KV-N-EGEKVFEEEVV--------------------------------------------
Xenopus_tropicalis|16003      TA-G-GGDSALEEELT--THIKEEVRLTGTIAMIDREAAVAPRGAYIRNPLGQVIVNHSF
Anolis_carolinensis|542       E----DPERPYEEEVA--ALIKEETRLVATIHQIDKAVGIVPRGAYVKSPLGPVHENRSF
Gallus_gallus|12587           A--E-DDERFLEDEKKKKLTIKEENRLVATIEQIDRAVGIIPRRAFMKTPLGSVHENRNF
Taeniopygia_guttata|11890     AE---AAARLVQSGKE--PVIKEEARLIATIEQIDRAVGIVPRGAFVKTPLGSVHENRYF
                                                                                          

Danio_rerio|3915              GG--LHPTEAAKLRNYLHFREPVNLRNKSILEMSELNPAL-----DFLDPLSEDILK-G-
Gasterosteus_aculeatus|17039  AG--LSHSEAKKLDSFRHFRKAKNPNKKSIEEMGDLSPAI-----DFLDTLSDDIPE-G-
Oryzias_latipes|20306         GG--LSESEARRLENFMHFRKPKTLQKKPIPVKAEWAPAI-----DFLDVLSEDIPK-G-
Tetraodon_nigroviridis|7250   GG--LSRSEAARLSNFLHFSKPKQLKEKSILEMADLNPRI-----DFLDVVSDDIPK-G-
Fugu_rubripes|38794           AG--LSPSEATRLSNFLHFRKPKNQKKRRILEMADLNPAI-----DFLDVVSDDVPK-G-
Nematostella_vectensis|13288  EGNWLSVADAGKLASYFHFRDPVLFNQKSLLQKAELDKAV-----DFLDPIDTDVPKGG-
Branchiostoma_floridae|3845   EG--LSVSEAGKLNSYFHLREPLKLKEKTLLEKADLDPSI-----DFLDSIEEDIPRGG-
Gorilla_gorilla|13491         EG--LSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSL-----DFMDSLEHDIPK-G-
Rhesus_macaque|28426          EG--LSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSL-----DFMDSLEHDIPK-G-
Microcebus_murinus|4611       XX--LSLSEAKKLSSYFHFREPVDLKNKTLLEKADLDPSL-----DFMDSLEHDIPK-XX
Ornithorhynchus_anatinus|2861 EG--LSMSEAKKLSSYFHFKEPVNLKTKTLLEKADLDPAI-----DFLDSLEHDIPK---
Tarsius_syrichta|2355         EG--LSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSL-----DFMDSLEHDIPK-XX
Myotis_lucifugus|16194        EG--LTLSEAKKLSSYFHFREPVDLKNKTLLEKADLDPSL-----DFMDSLGSDIPK-GS
Homo_sapiens|53072            EG--LSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSL-----DFMDSLEHDIPK-GS
Pan_troglodytes|24203         EG--LSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSL-----DFMDSLEHDIPK-GS
Procavia_capensis|7091        EG--LPLSEAKKLSSYFHFKEAVELKNKTLLEKADLDPSL-----DFMDSLEHDIPR-GS
Tupaia_belangeri|2966         EG--LSLSESKKLSSYFHXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXXXXXX-XS
Choloepus_hoffmanni|6795      D-----------------------------------------------------------
Felis_catus|6283              EG--LSLSEAKKLSSYFHFREPVQLKNKTLLEKADLDPSL-----DFMDSLEHDIPK-GT
Cavia_porcellus|4497          EG--LPLSEAKKLSSYFHFREPVSLKNKTLLEKADLDPSL-----DFLDSLEYDIPK-G-
Macropus_eugenii|12743        EG--LTLADSKKLSSYFHFAEPVELKNKSLLEKADLDPSL-----DFLDSLEHDIPK-XX
Ochotona_princeps|14628       XX--LPLSEARKLSSYFHFREPVLLKNKSLLEKASLDPSL-----DFMDSLEHDIPK---
Monodelphis_domestica|24408   EG--LTLADAKKLTSYFHFTEPIELKNKSLLEKADLDPSL-----DFLDNLEHDIPK-G-
Dipodomys_ordii|2265          EG--LSMSEVKKLSSYFHFREAVDLKNKTLLEKANLDPSL-----DFLDSLEYDIPK-XX
Dasypus_novemcinctus|3855     DG--LSLSEAKKLSSYFHFKEAVELKNKTLLE-ADLDSSL-----DFMDSFEHDIPK-G-
Oryctolagus_cuniculus|14664   EG--LPLSEAKKLSSYFHFREPVELRNKTLLEKASLDPSL-----DFMDSLEHDIPK-G-
Loxodonta_africana|16291      EG--LSLSEAKKLSSYFHFKEAVELKNKTLLEKADLDPSL-----DFMDSLEHDIPR-G-
Erinaceus_europaeus|4993      XX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXXXXXX---
Mus_musculus|10923            EG--LPLSEVRKLSSYFHFREAIDLKNKTLLEKSDLEPSL-----DFLDSLEYDIPR-G-
Rattus_norvegicus|21377       EG--LPLSEIKKLSSYFHFREAIDLKNKTLLEKADLEPSL-----DFLDSLEYDIPR---
Equus_caballus|621            EG--LSLSQAKKLSSYFHFREPVELKNKTLLEKADLDPSL-----DFLDSLEHDIPK-G-
Canis_familiaris|7966         EG--LSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSL-----DFMDSLEHDIPK-G-
Callithrix_jacchus|23304      EG--LSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSL-----DFMDSLEHDVPK-G-
Pongo_abelii|14140            EG--LSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSL-----DFMDSLEHDIPK-G-
Tursiops_truncatus|15412      XX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSEAIVQGNFMSSVSRYGLD-W-
Bos_taurus|11696              EG--LSLSEAKKLSSYFHFREPVELKNKTLLEKAELDPSL-----DFMDSLEHDIPK-G-
Sus_scrofa|1839               EG--LSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSL-----DFMDSLEHDIPK-G-
Sus_scrofa|17263              ------VSE---------------------------------------------------
Xenopus_tropicalis|16003      RG--LEVSEGKKLSSYFHFTPSLNPKKKSLLEKAALDPSI-----DFLDSLEHDIPR-G-
Anolis_carolinensis|542       EG--LSLTEGKKLSSYFHFTEPENLKNKTLLEKADLDPAI-----DFLDSLEHDIPK-G-
Gallus_gallus|12587           EG--LSLTEAKKLSSYFHFTEPVNLKNKTLLEKADLDPST-----DFLDSLEHDVPQ-G-
Taeniopygia_guttata|11890     EG--LSLVEAKKLSSYFHFTEPANLKNKTLLEKADLDPST-----DFLDSLEHDIPR-G-
                                                                                          

Danio_rerio|3915              ----------------------------SWS------LQLDRGGTVCVLRSLLWLGFTFF
Gasterosteus_aculeatus|17039  ----------------------------SWS------LQRECAGNVCVLRSLLWLGLTFY
Oryzias_latipes|20306         ----------------------------SWS------LQFECARRVCVLRSLLWLGLTFY
Tetraodon_nigroviridis|7250   ----------------------------SWS------LQFEGAGQVCVLRSLLWPGLTLY
Fugu_rubripes|38794           ----------------------------SWS------LQLEGAGQVCILRSLLWPGLTLY
Nematostella_vectensis|13288  ----------------------------SWS------IQFERGSGLVSLRSLHWLGFTFF
Branchiostoma_floridae|3845   ----------------------------SWS------VQFERGSGLVALRSLVWLGYTFF
Gorilla_gorilla|13491         ----------------------------SWS------IQMERGNALVVLRSLLWPGLTFY
Rhesus_macaque|28426          ----------------------------SWS------IQMERGNALVVLRSLLWPGLTFY
Microcebus_murinus|4611       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------VLEHPDGERQCVGGAAQPALAGP
Ornithorhynchus_anatinus|2861 --VTVTGPRGCHSWLGQQRPAGRPRGCHSWL--GQQRLLEHPDGKRQLAAGAAEPALARP
Tarsius_syrichta|2355         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------ILEHPDGKGQRLGGAAQPALARP
Myotis_lucifugus|16194        EAVIQDFVSLVSRSGTGWPC--------PWDSCSVPMVLEHPDGARQRPGGAAQPALARP
Homo_sapiens|53072            EAVVQGDFTWLLSRCGFGWPCSWDSCSVSMR------VLEHPDGEGQCPGGAAQPALAGP
Pan_troglodytes|24203         EAVVQGDFMWLLSRCGFGWPCSWDSCSVSMR------VLEHPDGEGQCPGGAAQPALAGP
Procavia_capensis|7091        ETVVQVFGSPLSRCCSGCPC--------SWDSCSVPMVLEHPDGAGQHLSCAAQPAVAGP
Tupaia_belangeri|2966         EVIVQGDTVSSLSTCGLGQPCPWASCSGPMW------VLEHPDGARQRPGGATQPALARP
Choloepus_hoffmanni|6795      ------------------------------------------------------------
Felis_catus|6283              EVTVDSSPVSRYGLGWACPQDSCSLC--LWR------VLEHPDGEGQRTGGAAQPALARP
Cavia_porcellus|4497          ----------------------------SWS------IQLERGNSLVVLRSLLWPGLTFF
Macropus_eugenii|12743        XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------ILEYPDGEGCT-GCASKLALARP
Ochotona_princeps|14628       -------------------------------------VLEHPDGERQRPGGAPQPAVAWT
Monodelphis_domestica|24408   ----------------------------SWS------VQMERGNALVVLRSLLWPGLTFF
Dipodomys_ordii|2265          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------VLEHPDGEGQRSGGATQPALARP
Dasypus_novemcinctus|3855     ----SEQGDFMSLSRDDGWPHPWDSCSLPWM------VLEHPDGEGPRLGGAAQPALARP
Oryctolagus_cuniculus|14664   ----------------------------SWS------VQMERGNALVVLRSLLWPGLTFY
Loxodonta_africana|16291      ----------------------------SWS------VQMERGNTLVVLRSLLWPGLTFY
Erinaceus_europaeus|4993      ---------------XXXXXXXXXXXXXXXX------LLEHADGEGQHAGGAAQPALARP
Mus_musculus|10923            ----------------------------SWS------IQMERGNALVVLRSLLWPGLTFY
Rattus_norvegicus|21377       -------------------------------------V----------------------
Equus_caballus|621            ----------------------------SWS------IQMERGNALVVLRSLLWPGLTFF
Canis_familiaris|7966         ----------------------------SWS------IQMERGNALVVLRSLLWPGLTFF
Callithrix_jacchus|23304      ----------------------------SWS------IQMERGNALVVLRSLLWPGLTFY
Pongo_abelii|14140            ----------------------------SWS------IQMERGNALVVLRSLLWPGLTFY
Tursiops_truncatus|15412      ----------------------------PWG------VLEHPDGERQHPGGAAQPALARS
Bos_taurus|11696              ----------------------------SWS------VQMERGNALVVLRSLLWPGLTFY
Sus_scrofa|1839               ----------------------------SWS------IQTERGNALVVLRSLLWPGLTFY
Sus_scrofa|17263              ------------------------------------------------------------
Xenopus_tropicalis|16003      ----------------------------SWS------LQLEQGDSVLILRSLLWLGMTFY
Anolis_carolinensis|542       ----------------------------SWS------IQVERGGRVLILRSLLWLGLTFY
Gallus_gallus|12587           ----------------------------SWT------VQFEKGGTVVVLRSLLWLGLTFY
Taeniopygia_guttata|11890     ----------------------------SWS------IQLEKGGTVVVLRSLLWLGLTFY
                                                                                          

Danio_rerio|3915              HVPQTPQHG--YIYMGDGL-MNLDLPFML--------------
Gasterosteus_aculeatus|17039  HLPMTPQHG--YIYIGDGT-KNLNLPFML--------------
Oryzias_latipes|20306         HVPMTPQHG--YIYVGLGM-KNLDLPFML--------------
Tetraodon_nigroviridis|7250   HVLKTPQHG--YIYIGNGN-RNLDLPFML--------------
Fugu_rubripes|38794           HVLMTPQHG--YIYIGSGM-KNLDLPFML--------------
Nematostella_vectensis|13288  HVPETRKYG--MVYIGTGN-KNLDLPFML--------------
Branchiostoma_floridae|3845   HVPGTLKFG--SMYIGNGE-KNNDLPFML--------------
Gorilla_gorilla|13491         HAPRTKNYG--YIYVGTGE-KNMDLPFML--------------
Rhesus_macaque|28426          HAPRTKHYG--YIYVGTGE-KNMDLPFML--------------
Microcebus_murinus|4611       HLLPCSPHQELWLHLRGHWREEHRLALHAIGWRPAWIF-----
Ornithorhynchus_anatinus|2861 DLLPRPPDQELRLLLRGHGREKYGSALHAVSRPGAQPAADPK-
Tarsius_syrichta|2355         HLLPRPPHQELRLHLCGHRREEHGLALHAVGRVRFSRVR----
Myotis_lucifugus|16194        HLLPRSGHQELWLHLCGHW-EEHGLALHAVGGPPRDCVCRAS-
Homo_sapiens|53072            HLLPCSPHQELWLRLRGHWREEHGLALHAIEWEPAWMFLNRV-
Pan_troglodytes|24203         HLLPCSPHQELWLHLRGHWREEHGLALHAIEWEPAWMFLNRV-
Procavia_capensis|7091        HLLPRSLHQELRLHLRGHRGEEHRPALHAVGRRLAWGVCRL--
Tupaia_belangeri|2966         HLLPRPPHQELWLHLRGHWREEPGLALHAVGWEGRMVVCSAS-
Choloepus_hoffmanni|6795      -------------------------------------------
Felis_catus|6283              HLLPCSPHQELWLHLRGYR-EEHRPPLHALGGAGVSAWGLCRV
Cavia_porcellus|4497          HTPRTRNHG--YIYVGTGE-KNMDLPFML--------------
Macropus_eugenii|12743        DLLSCSPDQESRLYLCGHW-EEHRPTLHA--------------
Ochotona_princeps|14628       HLLPHSSHE-LRLYLRGHR-REEHRPALHAVPGWLLFGG----
Monodelphis_domestica|24408   HAPRTKNHG--YIYVGTGE-KNIDLPFML--------------
Dipodomys_ordii|2265          HLLPCSSYQKLWLHLRGHW-EELGLALHAVGAPGWILIL----
Dasypus_novemcinctus|3855     HLLPCAPHQELRLHLRWHW-EEHGLALHAIGWGPVRAFCMRA-
Oryctolagus_cuniculus|14664   HTPNTKSYG--YVYVGTGE-KNIDLPFML--------------
Loxodonta_africana|16291      HAPCTKNYG--YIYVGTGE-KNIDLPFML--------------
Erinaceus_europaeus|4993      HLLPRSPHQELWLHGRGHW-EEHR-------------------
Mus_musculus|10923            HAPRTKNYG--YIYVGTGE-KNMDLPFML--------------
Rattus_norvegicus|21377       -------------------------------------------
Equus_caballus|621            HAPRTKNCG--YIYVGTGE-KNIDLPFML--------------
Canis_familiaris|7966         HAPRTKNYG--YIYMGTGE-KNIDLPFML--------------
Callithrix_jacchus|23304      HAPRTRNYG--YIYVGTGE-KNMDLPFML--------------
Pongo_abelii|14140            HAPRTKTYG--YIYVGTGE-KNMDLPFML--------------
Tursiops_truncatus|15412      HLLPCSSHQELWLHLRGHW-REEHRPAVHAVGGLPVWRV----
Bos_taurus|11696              HAPRTKNYG--YIYVGTGE-KNLDLPFML--------------
Sus_scrofa|1839               HAPRTKNCG--YIYVGTGE-KNMDLPFML--------------
Sus_scrofa|17263              -------------------------------------------
Xenopus_tropicalis|16003      HVPLTPLHG--HLYIGTGE-RNLDLPFMI--------------
Anolis_carolinensis|542       HVHNTKQHG--YIYFGNGE-KNIDLPFML--------------
Gallus_gallus|12587           HVPMTKQYG--YIYCGTGE-KNLDLPFML--------------
Taeniopygia_guttata|11890     HVPMTKQFG--YVYFGTGE-KNLDLPFML--------------