Orthologs Set ID: EOG4006DG


Orthology Database
OrthoDB4
Gene Symbol(s)
LRTM2B

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Oryzias latipes 18058 52, 397, 667
Tetraodon nigroviridis 5107 51, 388, 667

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Oryzias latipes 18058 ENSORLT00000000901 ENSORLG00000000732 lrtm2b oryLat2
Tetraodon nigroviridis 5107 ENSTNIT00000007297 ENSTNIG00000004493 lrtm2b tetNig2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Oryzias latipes 809 ENSORLP00000000900 ENSORLG00000000732 lrtm2b oryLat2
Tetraodon nigroviridis 15080 ENSTNIP00000007140 ENSTNIG00000004493 lrtm2b tetNig2

multiple sequence alignment in CLUSTALW format


Oryzias_latipes|18058       TACCTTTCAGAAACCTCCACCTGCTCCTGTGAGCTCAGCTCAGCTGGTTTGGTCTGTGTT
Tetraodon_nigroviridis|5107 ------------------------GGAACCACAGGCAGCCGGAGGGGCAGGCTCTGCcta
                                                      .:  ...  ****  ..  ** : * ****  *:

Oryzias_latipes|18058       GCTCTCGTCAGCTTGGTTCTGGTTCTGCCTGGATTCGTGGGCTCGGTCAGCAGCTGCCCG
Tetraodon_nigroviridis|5107 gcctgctgctcctggctctgctggctccaGTCCCTC---------------GGCTGTCCT
                            **   *  *: ** * *       ** *.   . **               .**** ** 

Oryzias_latipes|18058       AGCGCCTGCACCTGCTATGCTAACACAACCGACTGCTCTGCTGTTGGCCTTCAAACTCTG
Tetraodon_nigroviridis|5107 GGACGGTGCAGCTGCTACGCTAACACCACGGACTGCactgctgctggactccagtCTCTG
                            .*.   **** ****** ********.** ******:****** ***.** **.:*****

Oryzias_latipes|18058       ACCCCCATCATGGAGATGCTGGGCCGAGATGCCCTGTCTCTCCGACTTTCCCAAAACAAC
Tetraodon_nigroviridis|5107 CCAGCCGTCCTAGCTGGGCTGGACCGGCGCGCGTCCACGCTGCTCCTGTCCCAGAACAAC
                            .*. **.**.*.*. . *****.***. . **    :* ** * .** *****.******

Oryzias_latipes|18058       CTCTCATCTTTGGGAAGGACCGACACTTTCAACCTGAGCGGCGTGGAGCTGCTGGATCTC
Tetraodon_nigroviridis|5107 CTGTCCTCTTTGGCCCTGGTGGAACTGTCCGGTTTGAGCCACCTGGAGCTTTTGGATCTT
                            ** **.******* .. *.  **..  * *..  ***** .* *******  ******* 

Oryzias_latipes|18058       TCCCAGAACAACTTCCACAGCCTCCAGCCTGGAACCTTCTTGGGCTTTAGCAGTCTGCGT
Tetraodon_nigroviridis|5107 TCTCAGAACCGTTtctctgggctgcagccagATGTTTTCTCCAGTCTGAGCAGTCTTTGC
                            ** ******.. *** . .* ** *****:*.:.  ****  .*  * ********  * 

Oryzias_latipes|18058       TGGTTAAATCTTTCTTCTAACTACCTC---------GGTTTGAGCAGCAAGGTTTTCATG
Tetraodon_nigroviridis|5107 TGGCTCAACCTCTCTGCTAACAACCTAGGAAGCCAGGGCCTGACCGGGGAAGCCTTCAAC
                            *** *.** ** *** *****:****.         **  *** *.* .*.*  ****: 

Oryzias_latipes|18058       GGGCTGTGGTCACTGCAGGGGCTCGACCTATCTTCAAATGGTTTCCAGTGGCTTCCGAAG
Tetraodon_nigroviridis|5107 GGACTGTGGCAGCTGCGAGGGCTGGACCTGTCCCACAACAGCCTCCTGTGGCTGCCCAGA
                            **.****** ..****..***** *****.**  ..** .*  ***:****** ** *..

Oryzias_latipes|18058       GGCCTTCTGGATGGACTGCAGAGGCTCACCTGGCTATCGCTTGCCAGTAACCGCCTTGTG
Tetraodon_nigroviridis|5107 GGCCTGCTGGACGCAGTCCCGAGACTCACCTGGCTGTCCCTGGCCAGCAACAAGATGGCC
                            ***** ***** * * * *.***.***********.** ** ***** ***.. .* *  

Oryzias_latipes|18058       GCCCTGGAAAGGGCCCTTTTCGAGCCGCTTGTATCGCTGCAGCAGCTCCAGCTGGTGGGG
Tetraodon_nigroviridis|5107 GCTCTCGACAGGGTGACCTTTGAAGCCCTGGTGGGGCTGCGGCAGCTGCATCTGGAGGGA
                            ** ** **.****  .  ** **. * ** **.  *****.****** ** ****:***.

Oryzias_latipes|18058       AACCCCTGGGAGTGTGACTGCAGGCTGAGGGACTTTAAGCACTGGATGGAGTGGCTGCTT
Tetraodon_nigroviridis|5107 AACCCGTGGGCGTGCGACTGCAGGCTGAGGGACTTCAAGCACTGGATGGAGTGGCTAATC
                            ***** ****.*** ******************** ********************..* 

Oryzias_latipes|18058       TACAGAGGTGGGCAGGTGGATTTGATGCAGTGCAGTCTCCCTGACGATTTGAAGGGCAGG
Tetraodon_nigroviridis|5107 TACAGAGATGGACAGGTGGACGCCATGCGGTGCAgccttcctgcagagctgcagggccGG
                            *******.***.********    ****.****** ** ****..**  **.*****.**

Oryzias_latipes|18058       GACATCCGCAGCGTGCCAGCAGAGATGTTCGTCCACTGCCTGCAGGGTGCCATCAAGGAG
Tetraodon_nigroviridis|5107 GACATCCGCAGCGTGCCCTCAGAGATGTTCAGCTTGTGTCCACTGAAAGCG------GAC
                            *****************. ***********. * : ** * .*:*..:**       ** 

Oryzias_latipes|18058       GGGGTCCGGCACACAGTCAGCCGGCCCCCCTGCCCACCTGGCAGGGTCACCAGCACAGAT
Tetraodon_nigroviridis|5107 GAGGTCGGACCTTCCGGCCACCGCCCCTCCTGGCCTCCCGGTCGGGTGGGCGCCACCGAC
                            *.**** *.*. :*.* *..*** *** **** **:** ** .**** . *. ***.** 

Oryzias_latipes|18058       GACTGTGTTCGGCAGCGCTACAGGCCTGTGAGTGTGCGCCGCGCCCATGGCACGCAGATA
Tetraodon_nigroviridis|5107 GAGCGCGTTCGCCAGCGGTACCGGCCGGTCAGCGTGCGGCGAGCACACGGCACACAGATT
                            **  * ***** ***** ***.**** ** ** ***** **.**.** *****.*****:

Oryzias_latipes|18058       GTTGCGGGCGTGGTTTGTGGCACAGTGTGCATCATGATGGTGGTTGCGGCAACATACGGC
Tetraodon_nigroviridis|5107 GTTGCAGGTGTGATCTGCGGCacggtgtgtgtgatgatggtggtggcggCCGTCTACGGC
                            *****.** ***.* ** *****.***** .* *********** *****.. .******

Oryzias_latipes|18058       TGTGTCTACGCCACGCTGATGGCGCGGTACCAGAGGGAGATGAAAAACCGCGGACAGCCT
Tetraodon_nigroviridis|5107 TGTGTGTACGCCTCCATGATGGCGCGTTACCAGAGGGACGTGAAGACACGCGGTCCAGCC
                            ***** ******:* .********** *********** .****.*..*****:*.. * 

Oryzias_latipes|18058       CTGATGGCTGAGTCTGGAGCTGAGACCGACCAGGAGGATGGGCAGATGTCATCTCCTGAC
Tetraodon_nigroviridis|5107 CTGATGGCCGAGTCTGGA---------GACCTGGAGGAC---------GCAGGCCCGCCG
                            ******** *********         ****:******           **   **  . 

Oryzias_latipes|18058       ACGCCCGAGGCC
Tetraodon_nigroviridis|5107 GCCTTGCACTCT
                            .*     *  * 

multiple sequence alignment in CLUSTALW format


Oryzias_latipes|809          YLSETSTCSCELSSAGLVCVALVSLVLVLPGFVGSVSSCPSACTCYANTTDCSAVGLQTL
Tetraodon_nigroviridis|15080 --------GTTGSRRGRLCLACCSWLCWLQSL-----GCPGRCSCYANTTDCTAAGLQSL
                                     .   *  * :*:*  * :  * .:     .**. *:********:*.***:*

Oryzias_latipes|809          TPIMEMLGRDALSLRLSQNNLSSLGRTDTFNLSGVELLDLSQNNFHSLQPGTFLGFSSLR
Tetraodon_nigroviridis|15080 PAVLAGLDRRASTLLLSQNNLSSLALVELSGLSHLELLDLSQNRFSGLQPDVFSSLSSLC
                             ..::  *.* * :* *********. .:  .** :********.* .***..* .:*** 

Oryzias_latipes|809          WLNLSSNYL---GLSSKVFMGLWSLQGLDLSSNGFQWLPKGLLDGLQRLTWLSLASNRLV
Tetraodon_nigroviridis|15080 WLNLSANNLGSQGLTGEAFNGLWQLRGLDLSHNSLLWLPRGLLDAVPRLTWLSLASNKMA
                             *****:* *   **:.:.* ***.*:***** *.: ***:****.: **********::.

Oryzias_latipes|809          ALERALFEPLVSLQQLQLVGNPWECDCRLRDFKHWMEWLLYRGGQVDLMQCSLPDDLKGR
Tetraodon_nigroviridis|15080 ALDRVTFEALVGLRQLHLEGNPWACDCRLRDFKHWMEWLIYRDGQVDAMRCSLPAELQGR
                             **:*. **.**.*:**:* **** ***************:**.**** *:**** :*:**

Oryzias_latipes|809          DIRSVPAEMFVHCLQGAIKEGVRHTVSRPPCPPGRVTSTDDCVRQRYRPVSVRRAHGTQI
Tetraodon_nigroviridis|15080 DIRSVPSEMFSLCPLKA--DEVGPSGHRPSWPPGRVGATDERVRQRYRPVSVRRAHGTQI
                             ******:***  *   *  : *  :  **. ***** :**: ******************

Oryzias_latipes|809          VAGVVCGTVCIMMVVAATYGCVYATLMARYQREMKNRGQPLMAESGAETDQEDGQMSSPD
Tetraodon_nigroviridis|15080 VAGVICGTVCVMMVVAAVYGCVYASMMARYQRDVKTRGPALMAESG---DLED---AGPP
                             ****:*****:******.******::******::*.** .******   * **   :.* 

Oryzias_latipes|809          TPEA
Tetraodon_nigroviridis|15080 ALHS
                             : .: